F394716

General Info

Members Datasets Scaffolds Average Seq Length
299 186 598 196

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100416990|Ga0070707_1004169901
Length 219
Sequence MSKVVAFISLTLDGVMQAPGRPDEDRRGGFEFGGWATAYADSVQASLAGESMTSTGALLFGRRTYEDFYAVWPNRTDNPFTEVLNNTQKYVASTTLTEPLRWSNSTLLEGDAAEAVARLRAQPGKDLVVLGSGELLRSLMRRNLVDEYILLIHPLLLGSGRRLFSEDGSFAALRLVKTRTTTTGVVIATYQPIEPAASDDGLRHARRSLPAVTSRSNIR

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
118 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
119 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
135 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
136 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
137 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
138 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
139 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
140 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
141 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
142 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
143 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
163 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
164 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
165 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
166 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
167 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
168 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
169 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
170 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
171 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
172 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
175 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
176 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
177 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
178 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
182 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
183 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
184 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
185 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
186 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.33
Metatranscriptomes 1.67
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.34
Rhizosphere 98.33
Stem 0
Stem Tuber 0
Unclassified 10.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100416990 3300005468 Bacteria 1303
2 JGI25407J50210_10002846 3300003373 Bacteria 4118
3 Ga0065712_10286979 3300005290 Unclassified 884
4 Ga0065712_10407370 3300005290 Bacteria 725
5 Ga0070683_100018046 3300005329 Bacteria 6242
6 Ga0070670_100088694 3300005331 Bacteria 2659
7 Ga0070670_100359709 3300005331 Bacteria 1280
8 Ga0068869_100065297 3300005334 Bacteria 2679
9 Ga0070680_100055931 3300005336 Bacteria 3224
10 Ga0070680_100384488 3300005336 Unclassified 1195
11 Ga0070680_100542448 3300005336 Bacteria 996
12 Ga0070660_100102935 3300005339 Bacteria 2264
13 Ga0070687_100016010 3300005343 Bacteria 3407
14 Ga0070668_100486350 3300005347 Bacteria 1066
15 Ga0070669_100068709 3300005353 Bacteria 2616
16 Ga0070675_100087261 3300005354 Unclassified 2609
17 Ga0070675_100182604 3300005354 Bacteria 1814
18 Ga0070673_100014063 3300005364 Bacteria 5559
19 Ga0070688_100013292 3300005365 Bacteria 4636
20 Ga0070659_100379709 3300005366 Unclassified 1190
21 Ga0070667_100014377 3300005367 Bacteria 6540
22 Ga0070709_10114536 3300005434 Bacteria 1817
23 Ga0070714_100498702 3300005435 Bacteria 1161
24 Ga0070714_100879548 3300005435 Unclassified 869
25 Ga0070713_100078505 3300005436 Bacteria 2810
26 Ga0070701_10157963 3300005438 Bacteria 1311
27 Ga0070711_100376377 3300005439 Bacteria 1147
28 Ga0070705_100016056 3300005440 Bacteria 3883
29 Ga0070694_100236666 3300005444 Bacteria 1376
30 Ga0070708_100012585 3300005445 Bacteria 6908
31 Ga0070708_100018081 3300005445 Bacteria 5896
32 Ga0070708_100026343 3300005445 Bacteria 4975
33 Ga0070708_100075674 3300005445 Bacteria 3039
34 Ga0070708_100308736 3300005445 Bacteria 1490
35 Ga0070708_100335422 3300005445 Bacteria 1425
36 Ga0070708_100507628 3300005445 Bacteria 1137
37 Ga0070681_10097114 3300005458 Bacteria 2894
38 Ga0070681_10257968 3300005458 Bacteria 1655
39 Ga0070685_10501556 3300005466 Bacteria 859
40 Ga0070706_100000027 3300005467 Bacteria 156057
41 Ga0070706_100007832 3300005467 Bacteria 9989
42 Ga0070706_100010567 3300005467 Bacteria 8566
43 Ga0070706_100370428 3300005467 Bacteria 1334
44 Ga0070706_100492070 3300005467 Bacteria 1141
45 Ga0070707_100000112 3300005468 Bacteria 75211
46 Ga0070707_100001127 3300005468 Bacteria 26363
47 Ga0070707_100002788 3300005468 Bacteria 16630
48 Ga0070707_100023264 3300005468 Bacteria 5862
49 Ga0070707_100081877 3300005468 Bacteria 3117
50 Ga0070707_100176342 3300005468 Bacteria 2083
51 Ga0070707_100284203 3300005468 Bacteria 1608
52 Ga0070707_100917533 3300005468 Unclassified 840
53 Ga0070698_100000059 3300005471 Bacteria 78871
54 Ga0070698_100001707 3300005471 Bacteria 24503
55 Ga0070698_100034219 3300005471 Bacteria 5263
56 Ga0070698_100102518 3300005471 Bacteria 2832
57 Ga0070698_100212491 3300005471 Bacteria 1869
58 Ga0070698_100383374 3300005471 Bacteria 1338
59 Ga0070698_100394294 3300005471 Bacteria 1317
60 Ga0070698_100701519 3300005471 Unclassified 954
61 Ga0070699_100025061 3300005518 Bacteria 5143
62 Ga0070699_100164613 3300005518 Archaea 1964
63 Ga0070699_100175756 3300005518 Bacteria 1898
64 Ga0070699_100222530 3300005518 Bacteria 1682
65 Ga0070699_100314452 3300005518 Bacteria 1406
66 Ga0070679_100089374 3300005530 Bacteria 3067
67 Ga0070679_100105935 3300005530 Bacteria 2798
68 Ga0070679_100218398 3300005530 Bacteria 1868
69 Ga0070697_100173298 3300005536 Bacteria 1827
70 Ga0070697_100219027 3300005536 Bacteria 1622
71 Ga0070697_100394540 3300005536 Archaea 1200
72 Ga0070697_101245327 3300005536 Unclassified 663
73 Ga0070672_100030023 3300005543 Bacteria 4081
74 Ga0070686_100851628 3300005544 Bacteria 738
75 Ga0070696_100143560 3300005546 Bacteria 1747
76 Ga0070693_100012882 3300005547 Bacteria 4245
77 Ga0070693_100252019 3300005547 Bacteria 1170
78 Ga0070704_100056473 3300005549 Bacteria 2788
79 Ga0070704_100609726 3300005549 Bacteria 960
80 Ga0068855_100509268 3300005563 Bacteria 1307
81 Ga0068855_100522762 3300005563 Bacteria 1287
82 Ga0068855_100585188 3300005563 Unclassified 1205
83 Ga0068855_100647565 3300005563 Bacteria 1135
84 Ga0068857_100109437 3300005577 Bacteria 2483
85 Ga0068857_100126842 3300005577 Bacteria 2300
86 Ga0068856_100654750 3300005614 Bacteria 1071
87 Ga0068859_100014453 3300005617 Bacteria 7923
88 Ga0068864_100582609 3300005618 Bacteria 1084
89 Ga0068863_100564871 3300005841 Bacteria 1124
90 Ga0081455_10051438 3300005937 Bacteria 3534
91 Ga0081538_10000424 3300005981 Bacteria 47554
92 Ga0081538_10001001 3300005981 Bacteria 30067
93 Ga0081538_10002215 3300005981 Bacteria 19256
94 Ga0081538_10003625 3300005981 Bacteria 14514
95 Ga0081538_10091785 3300005981 Bacteria 1567
96 Ga0081538_10103016 3300005981 Bacteria 1430
97 Ga0081539_10098422 3300005985 Bacteria 1496
98 Ga0081539_10143064 3300005985 Bacteria 1160
99 Ga0070717_10003314 3300006028 Bacteria 11503
100 Ga0070717_10010237 3300006028 Bacteria 7066
101 Ga0070717_10358672 3300006028 Unclassified 1304
102 Ga0070717_10687968 3300006028 Bacteria 929
103 Ga0075432_10031987 3300006058 Bacteria 1822
104 Ga0070716_100064079 3300006173 Bacteria 2136
105 Ga0075428_100144958 3300006844 Bacteria 2581
106 Ga0075428_100210854 3300006844 Bacteria 2099
107 Ga0075428_100885410 3300006844 Bacteria 947
108 Ga0075430_100004915 3300006846 Bacteria 11242
109 Ga0075430_100618633 3300006846 Bacteria 893
110 Ga0075431_100404296 3300006847 Bacteria 1366
111 Ga0075431_100418467 3300006847 Bacteria 1339
112 Ga0075433_10020678 3300006852 Bacteria 5508
113 Ga0075434_100153598 3300006871 Bacteria 2322
114 Ga0075429_100036372 3300006880 Bacteria 4282
115 Ga0075429_100190326 3300006880 Unclassified 1798
116 Ga0075429_100414441 3300006880 Bacteria 1180
117 Ga0075429_100634267 3300006880 Bacteria 936
118 Ga0068865_100027143 3300006881 Unclassified 3779
119 Ga0075436_100328492 3300006914 Bacteria 1099
120 Ga0097620_100014450 3300006931 Bacteria 7923
121 Ga0075435_100450758 3300007076 Bacteria 1109
122 Ga0099794_10090919 3300007265 Bacteria 1514
123 Ga0105240_10172649 3300009093 Bacteria 2559
124 Ga0111539_10006650 3300009094 Bacteria 14893
125 Ga0111539_10011145 3300009094 Bacteria 11309
126 Ga0105245_10077191 3300009098 Bacteria 3036
127 Ga0114129_10015117 3300009147 Bacteria 10985
128 Ga0114129_10157081 3300009147 Bacteria 3109
129 Ga0114129_10226331 3300009147 Bacteria 2520
130 Ga0105241_10068043 3300009174 Bacteria 2758
131 Ga0105241_10081156 3300009174 Bacteria 2540
132 Ga0105242_10035546 3300009176 Bacteria 3995
133 Ga0105246_10433263 3300011119 Bacteria 1100
134 Ga0157370_10096145 3300013104 Unclassified 2779
135 Ga0157369_10183610 3300013105 Bacteria 2200
136 Ga0157369_10478555 3300013105 Unclassified 1289
137 Ga0163162_10086474 3300013306 Bacteria 3213
138 Ga0157372_10498120 3300013307 Bacteria 1421
139 Ga0157375_10013962 3300013308 Bacteria 7160
140 Ga0157377_10408142 3300014745 Bacteria 927
141 Ga0197907_11453911 3300020069 Bacteria 2115
142 Ga0206356_11347963 3300020070 Bacteria 1522
143 Ga0206350_10396278 3300020080 Bacteria 2232
144 Ga0224712_10000990 3300022467 Bacteria 6188
145 Ga0224712_10093249 3300022467 Unclassified 1265
146 Ga0207680_10021674 3300025903 Bacteria 3480
147 Ga0207699_10062131 3300025906 Bacteria 2251
148 Ga0207645_10078621 3300025907 Bacteria 2114
149 Ga0207643_10021358 3300025908 Bacteria 3555
150 Ga0207684_10000007 3300025910 Bacteria 612969
151 Ga0207684_10000015 3300025910 Bacteria 427232
152 Ga0207684_10185918 3300025910 Bacteria 1792
153 Ga0207684_10241514 3300025910 Unclassified 1558
154 Ga0207684_10251686 3300025910 Bacteria 1524
155 Ga0207684_10541050 3300025910 Bacteria 997
156 Ga0207684_10641952 3300025910 Bacteria 905
157 Ga0207707_10049920 3300025912 Bacteria 3645
158 Ga0207707_10361128 3300025912 Bacteria 1250
159 Ga0207693_10502414 3300025915 Bacteria 946
160 Ga0207660_10343005 3300025917 Bacteria 1196
161 Ga0207660_10599573 3300025917 Bacteria 897
162 Ga0207662_10022672 3300025918 Bacteria 3602
163 Ga0207657_10506063 3300025919 Unclassified 946
164 Ga0207652_10063933 3300025921 Bacteria 3183
165 Ga0207652_10181547 3300025921 Bacteria 1891
166 Ga0207652_10209992 3300025921 Bacteria 1753
167 Ga0207646_10000043 3300025922 Bacteria 184713
168 Ga0207646_10000069 3300025922 Bacteria 143056
169 Ga0207646_10000954 3300025922 Bacteria 37245
170 Ga0207646_10001765 3300025922 Bacteria 26200
171 Ga0207646_10011429 3300025922 Bacteria 8603
172 Ga0207646_10069311 3300025922 Bacteria 3150
173 Ga0207646_10094117 3300025922 Bacteria 2683
174 Ga0207646_10287241 3300025922 Bacteria 1486
175 Ga0207646_10559682 3300025922 Bacteria 1028
176 Ga0207646_10820051 3300025922 Unclassified 828
177 Ga0207694_10797757 3300025924 Bacteria 797
178 Ga0207650_10108081 3300025925 Bacteria 2150
179 Ga0207650_10194418 3300025925 Bacteria 1622
180 Ga0207659_10139748 3300025926 Bacteria 1879
181 Ga0207659_10150540 3300025926 Bacteria 1816
182 Ga0207687_10153599 3300025927 Bacteria 1759
183 Ga0207700_10376612 3300025928 Bacteria 1240
184 Ga0207664_10002514 3300025929 Bacteria 12127
185 Ga0207690_10101561 3300025932 Bacteria 2055
186 Ga0207686_10241294 3300025934 Unclassified 1315
187 Ga0207709_10155200 3300025935 Bacteria 1590
188 Ga0207670_10058751 3300025936 Bacteria 2613
189 Ga0207665_10025345 3300025939 Bacteria 3912
190 Ga0207665_10148317 3300025939 Bacteria 1678
191 Ga0207665_10209436 3300025939 Bacteria 1423
192 Ga0207691_10015270 3300025940 Bacteria 7307
193 Ga0207691_10460449 3300025940 Bacteria 1082
194 Ga0207689_10084325 3300025942 Bacteria 2612
195 Ga0207689_10847023 3300025942 Unclassified 772
196 Ga0207661_10012721 3300025944 Bacteria 6129
197 Ga0207667_10514812 3300025949 Bacteria 1212
198 Ga0207667_10593278 3300025949 Unclassified 1118
199 Ga0207667_10921609 3300025949 Bacteria 865
200 Ga0207651_10063210 3300025960 Bacteria 2584
201 Ga0207651_10605975 3300025960 Bacteria 958
202 Ga0207712_10014075 3300025961 Bacteria 5135
203 Ga0207668_10977103 3300025972 Bacteria 756
204 Ga0207658_10083445 3300025986 Bacteria 2456
205 Ga0207658_10175794 3300025986 Bacteria 1768
206 Ga0207703_10491265 3300026035 Unclassified 1151
207 Ga0207648_10051204 3300026089 Bacteria 3609
208 Ga0207676_10555260 3300026095 Bacteria 1098
209 Ga0207674_10115866 3300026116 Unclassified 2651
210 Ga0207674_10163603 3300026116 Bacteria 2179
211 Ga0207675_100206163 3300026118 Bacteria 1889
212 Ga0207675_100218796 3300026118 Bacteria 1834
213 Ga0207683_10033162 3300026121 Bacteria 4485
214 Ga0207698_10940755 3300026142 Unclassified 873
215 Ga0207428_10004357 3300027907 Bacteria 13512
216 Ga0207428_10100263 3300027907 Bacteria 2238
217 Ga0268265_11040568 3300028380 Bacteria 810
218 Ga0265339_10037243 3300031249 Bacteria 2719
219 Ga0316576_10220354 3300031727 Unclassified 1427
220 Ga0316578_10275813 3300031728 Bacteria 1007
221 Ga0307405_10005574 3300031731 Bacteria 6087
222 Ga0307405_10069885 3300031731 Bacteria 2253
223 Ga0307405_10360426 3300031731 Bacteria 1125
224 Ga0316577_10085833 3300031733 Unclassified 1762
225 Ga0307410_10396455 3300031852 Bacteria 1114
226 Ga0307412_10305197 3300031911 Bacteria 1260
227 Ga0307409_100223836 3300031995 Bacteria 1700
228 Ga0307409_100255335 3300031995 Bacteria 1605
229 Ga0307416_101992455 3300032002 Bacteria 683
230 Ga0307414_10444512 3300032004 Bacteria 1136
231 Ga0307411_10382599 3300032005 Bacteria 1158
232 Ga0307415_100001389 3300032126 Bacteria 11555
233 Ga0307415_100283534 3300032126 Bacteria 1363
234 Ga0307415_100876969 3300032126 Bacteria 825
235 Ga0395900_0103261 3300037418 Bacteria 2928
236 Ga0395898_0010995 3300037466 Bacteria 9431
237 Ga0395898_0012870 3300037466 Bacteria 8632
238 Ga0395905_0071764 3300037471 Bacteria 3246
239 Ga0395901_0190344 3300038443 Bacteria 2152
240 Ga0395901_0309845 3300038443 Bacteria 1635
241 Ga0436365_0014382 3300039437 Unclassified 816
242 Ga0439450_005646 3300042008 Bacteria 2211
243 Ga0439455_0109114 3300042012 Bacteria 769
244 Ga0439463_027485 3300042016 Bacteria 1432
245 Ga0450912_004391 3300042116 Bacteria 1044
246 Ga0439460_0034730 3300042461 Bacteria 1455
247 Ga0439460_0207673 3300042461 Unclassified 669
248 Ga0439440_0037980 3300042993 Bacteria 1164
249 Ga0453683_0424562 3300044673 Bacteria 858
250 Ga0495664_0266250 3300046477 Bacteria 1036
251 Ga0495588_0268640 3300046674 Bacteria 899
252 Ga0495674_0165348 3300047319 Bacteria 1849
253 Ga0495602_0045663 3300048088 Bacteria 3963
254 Ga0496104_0607601 3300048907 Bacteria 1004
255 Ga0496108_0030603 3300048911 Bacteria 4461
256 Ga0496111_0291938 3300048914 Bacteria 1209
257 Ga0496112_0475198 3300048915 Bacteria 1187
258 Ga0501031_0005617 3300049568 Bacteria 8171
259 Ga0501032_0021228 3300049569 Bacteria 4516
260 Ga0501033_0007582 3300049570 Bacteria 8441
261 Ga0501036_0002658 3300049572 Bacteria 14100
262 Ga0501037_0011442 3300049573 Bacteria 6531
263 Ga0501038_0256079 3300049574 Bacteria 1384
264 Ga0501039_0001366 3300049575 Bacteria 17904
265 Ga0501040_0001612 3300049576 Bacteria 14382
266 Ga0501041_0002843 3300049577 Bacteria 9905
267 Ga0501042_0000857 3300049578 Bacteria 16960
268 Ga0501043_0212607 3300049579 Bacteria 1498
269 Ga0501046_0002833 3300049580 Bacteria 16132
270 Ga0501048_0001565 3300049582 Bacteria 17385
271 Ga0501071_0002729 3300049587 Bacteria 10822
272 Ga0501072_0002226 3300049588 Bacteria 14488
273 Ga0501074_0008959 3300049590 Bacteria 7258
274 Ga0501075_0000649 3300049591 Bacteria 21308
275 Ga0501076_0001473 3300049592 Bacteria 15777
276 Ga0501077_0018589 3300049593 Bacteria 4395
277 Ga0501259_090059 3300049688 Bacteria 688
278 Ga0501079_0000052 3300049741 Bacteria 51253
279 Ga0501080_0011748 3300049742 Bacteria 8026
280 Ga0501081_0001825 3300049743 Bacteria 13184
281 Ga0501035_0142113 3300049822 Bacteria 2086
282 Ga0501044_0436554 3300049823 Unclassified 1218
283 Ga0501045_0000065 3300049824 Bacteria 48521
284 nmdc:mga05p37_186754_c1 3300050507 Bacteria 2520
285 nmdc:mga09592_309002_c1 3300050508 Unclassified 1370
286 nmdc:mga09592_524648_c1 3300050508 Bacteria 1018
287 nmdc:mga09592_54237_c1 3300050508 Bacteria 3387
288 nmdc:mga0qj67_69931_c1 3300050509 Bacteria 2800
289 nmdc:mga06r32_100557_c1 3300050510 Bacteria 2837
290 nmdc:mga06r32_1039446_c1 3300050510 Bacteria 770
291 nmdc:mga08y16_121772_c1 3300050511 Bacteria 2715
292 nmdc:mga08y16_6470_c1 3300050511 Bacteria 12295
293 nmdc:mga0n895_62664_c1 3300050512 Bacteria 3676
294 nmdc:mga0a205_16075_c1 3300050515 Bacteria 7005
295 Ga0495601_0145679 3300053077 Unclassified 1546
296 Ga0495612_0045661 3300053078 Bacteria 1793
297 Ga0501084_0002291 3300054114 Bacteria 15377
298 Ga0501082_0003071 3300060353 Bacteria 14564
299 Ga0530510_0003102 3300061734 Bacteria 11402
300 Ga0070707_100416990
301 JGI25407J50210_10002846
302 Ga0065712_10286979
303 Ga0065712_10407370
304 Ga0070683_100018046
305 Ga0070670_100088694
306 Ga0070670_100359709
307 Ga0068869_100065297
308 Ga0070680_100055931
309 Ga0070680_100384488
310 Ga0070680_100542448
311 Ga0070660_100102935
312 Ga0070687_100016010
313 Ga0070668_100486350
314 Ga0070669_100068709
315 Ga0070675_100087261
316 Ga0070675_100182604
317 Ga0070673_100014063
318 Ga0070688_100013292
319 Ga0070659_100379709
320 Ga0070667_100014377
321 Ga0070709_10114536
322 Ga0070714_100498702
323 Ga0070714_100879548
324 Ga0070713_100078505
325 Ga0070701_10157963
326 Ga0070711_100376377
327 Ga0070705_100016056
328 Ga0070694_100236666
329 Ga0070708_100012585
330 Ga0070708_100018081
331 Ga0070708_100026343
332 Ga0070708_100075674
333 Ga0070708_100308736
334 Ga0070708_100335422
335 Ga0070708_100507628
336 Ga0070681_10097114
337 Ga0070681_10257968
338 Ga0070685_10501556
339 Ga0070706_100000027
340 Ga0070706_100007832
341 Ga0070706_100010567
342 Ga0070706_100370428
343 Ga0070706_100492070
344 Ga0070707_100000112
345 Ga0070707_100001127
346 Ga0070707_100002788
347 Ga0070707_100023264
348 Ga0070707_100081877
349 Ga0070707_100176342
350 Ga0070707_100284203
351 Ga0070707_100917533
352 Ga0070698_100000059
353 Ga0070698_100001707
354 Ga0070698_100034219
355 Ga0070698_100102518
356 Ga0070698_100212491
357 Ga0070698_100383374
358 Ga0070698_100394294
359 Ga0070698_100701519
360 Ga0070699_100025061
361 Ga0070699_100164613
362 Ga0070699_100175756
363 Ga0070699_100222530
364 Ga0070699_100314452
365 Ga0070679_100089374
366 Ga0070679_100105935
367 Ga0070679_100218398
368 Ga0070697_100173298
369 Ga0070697_100219027
370 Ga0070697_100394540
371 Ga0070697_101245327
372 Ga0070672_100030023
373 Ga0070686_100851628
374 Ga0070696_100143560
375 Ga0070693_100012882
376 Ga0070693_100252019
377 Ga0070704_100056473
378 Ga0070704_100609726
379 Ga0068855_100509268
380 Ga0068855_100522762
381 Ga0068855_100585188
382 Ga0068855_100647565
383 Ga0068857_100109437
384 Ga0068857_100126842
385 Ga0068856_100654750
386 Ga0068859_100014453
387 Ga0068864_100582609
388 Ga0068863_100564871
389 Ga0081455_10051438
390 Ga0081538_10000424
391 Ga0081538_10001001
392 Ga0081538_10002215
393 Ga0081538_10003625
394 Ga0081538_10091785
395 Ga0081538_10103016
396 Ga0081539_10098422
397 Ga0081539_10143064
398 Ga0070717_10003314
399 Ga0070717_10010237
400 Ga0070717_10358672
401 Ga0070717_10687968
402 Ga0075432_10031987
403 Ga0070716_100064079
404 Ga0075428_100144958
405 Ga0075428_100210854
406 Ga0075428_100885410
407 Ga0075430_100004915
408 Ga0075430_100618633
409 Ga0075431_100404296
410 Ga0075431_100418467
411 Ga0075433_10020678
412 Ga0075434_100153598
413 Ga0075429_100036372
414 Ga0075429_100190326
415 Ga0075429_100414441
416 Ga0075429_100634267
417 Ga0068865_100027143
418 Ga0075436_100328492
419 Ga0097620_100014450
420 Ga0075435_100450758
421 Ga0099794_10090919
422 Ga0105240_10172649
423 Ga0111539_10006650
424 Ga0111539_10011145
425 Ga0105245_10077191
426 Ga0114129_10015117
427 Ga0114129_10157081
428 Ga0114129_10226331
429 Ga0105241_10068043
430 Ga0105241_10081156
431 Ga0105242_10035546
432 Ga0105246_10433263
433 Ga0157370_10096145
434 Ga0157369_10183610
435 Ga0157369_10478555
436 Ga0163162_10086474
437 Ga0157372_10498120
438 Ga0157375_10013962
439 Ga0157377_10408142
440 Ga0197907_11453911
441 Ga0206356_11347963
442 Ga0206350_10396278
443 Ga0224712_10000990
444 Ga0224712_10093249
445 Ga0207680_10021674
446 Ga0207699_10062131
447 Ga0207645_10078621
448 Ga0207643_10021358
449 Ga0207684_10000007
450 Ga0207684_10000015
451 Ga0207684_10185918
452 Ga0207684_10241514
453 Ga0207684_10251686
454 Ga0207684_10541050
455 Ga0207684_10641952
456 Ga0207707_10049920
457 Ga0207707_10361128
458 Ga0207693_10502414
459 Ga0207660_10343005
460 Ga0207660_10599573
461 Ga0207662_10022672
462 Ga0207657_10506063
463 Ga0207652_10063933
464 Ga0207652_10181547
465 Ga0207652_10209992
466 Ga0207646_10000043
467 Ga0207646_10000069
468 Ga0207646_10000954
469 Ga0207646_10001765
470 Ga0207646_10011429
471 Ga0207646_10069311
472 Ga0207646_10094117
473 Ga0207646_10287241
474 Ga0207646_10559682
475 Ga0207646_10820051
476 Ga0207694_10797757
477 Ga0207650_10108081
478 Ga0207650_10194418
479 Ga0207659_10139748
480 Ga0207659_10150540
481 Ga0207687_10153599
482 Ga0207700_10376612
483 Ga0207664_10002514
484 Ga0207690_10101561
485 Ga0207686_10241294
486 Ga0207709_10155200
487 Ga0207670_10058751
488 Ga0207665_10025345
489 Ga0207665_10148317
490 Ga0207665_10209436
491 Ga0207691_10015270
492 Ga0207691_10460449
493 Ga0207689_10084325
494 Ga0207689_10847023
495 Ga0207661_10012721
496 Ga0207667_10514812
497 Ga0207667_10593278
498 Ga0207667_10921609
499 Ga0207651_10063210
500 Ga0207651_10605975
501 Ga0207712_10014075
502 Ga0207668_10977103
503 Ga0207658_10083445
504 Ga0207658_10175794
505 Ga0207703_10491265
506 Ga0207648_10051204
507 Ga0207676_10555260
508 Ga0207674_10115866
509 Ga0207674_10163603
510 Ga0207675_100206163
511 Ga0207675_100218796
512 Ga0207683_10033162
513 Ga0207698_10940755
514 Ga0207428_10004357
515 Ga0207428_10100263
516 Ga0268265_11040568
517 Ga0265339_10037243
518 Ga0316576_10220354
519 Ga0316578_10275813
520 Ga0307405_10005574
521 Ga0307405_10069885
522 Ga0307405_10360426
523 Ga0316577_10085833
524 Ga0307410_10396455
525 Ga0307412_10305197
526 Ga0307409_100223836
527 Ga0307409_100255335
528 Ga0307416_101992455
529 Ga0307414_10444512
530 Ga0307411_10382599
531 Ga0307415_100001389
532 Ga0307415_100283534
533 Ga0307415_100876969
534 Ga0395900_0103261
535 Ga0395898_0010995
536 Ga0395898_0012870
537 Ga0395905_0071764
538 Ga0395901_0190344
539 Ga0395901_0309845
540 Ga0436365_0014382
541 Ga0439450_005646
542 Ga0439455_0109114
543 Ga0439463_027485
544 Ga0450912_004391
545 Ga0439460_0034730
546 Ga0439460_0207673
547 Ga0439440_0037980
548 Ga0453683_0424562
549 Ga0495664_0266250
550 Ga0495588_0268640
551 Ga0495674_0165348
552 Ga0495602_0045663
553 Ga0496104_0607601
554 Ga0496108_0030603
555 Ga0496111_0291938
556 Ga0496112_0475198
557 Ga0501031_0005617
558 Ga0501032_0021228
559 Ga0501033_0007582
560 Ga0501036_0002658
561 Ga0501037_0011442
562 Ga0501038_0256079
563 Ga0501039_0001366
564 Ga0501040_0001612
565 Ga0501041_0002843
566 Ga0501042_0000857
567 Ga0501043_0212607
568 Ga0501046_0002833
569 Ga0501048_0001565
570 Ga0501071_0002729
571 Ga0501072_0002226
572 Ga0501074_0008959
573 Ga0501075_0000649
574 Ga0501076_0001473
575 Ga0501077_0018589
576 Ga0501259_090059
577 Ga0501079_0000052
578 Ga0501080_0011748
579 Ga0501081_0001825
580 Ga0501035_0142113
581 Ga0501044_0436554
582 Ga0501045_0000065
583 nmdc:mga05p37_186754_c1
584 nmdc:mga09592_309002_c1
585 nmdc:mga09592_524648_c1
586 nmdc:mga09592_54237_c1
587 nmdc:mga0qj67_69931_c1
588 nmdc:mga06r32_100557_c1
589 nmdc:mga06r32_1039446_c1
590 nmdc:mga08y16_121772_c1
591 nmdc:mga08y16_6470_c1
592 nmdc:mga0n895_62664_c1
593 nmdc:mga0a205_16075_c1
594 Ga0495601_0145679
595 Ga0495612_0045661
596 Ga0501084_0002291
597 Ga0501082_0003071
598 Ga0530510_0003102

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

2

187

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.837 1 191
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8291 1 193
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.8284 1 191
2gd9-assembly1.cif.gz_B crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution 0.8247 2 193
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8246 1 193
ID Description Score Start End Superfamily
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8505 1 193 3.40.430.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8459 1 193 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8233 3 190 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8138 3 190 3.40.430.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8034 2 194 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A536E258-F1-model_v4 Dihydrofolate reductase 0.9785 1 194 GO:0008703
GO:0009231
AF-A0A535MPM8-F1-model_v4 Dihydrofolate reductase 0.9778 1 193 GO:0008703
GO:0009231
AF-A0A6J4H673-F1-model_v4 Dihydrofolate reductase (EC 1.5.1.3) 0.9742 1 194 GO:0004146
GO:0008703
GO:0009231
AF-A0A536E258-F1-model_v4 Dihydrofolate reductase 0.9735 1 194 GO:0008703
GO:0009231
AF-A0A317KQP5-F1-model_v4 Pyrimidine reductase 0.9724 2 194 GO:0008703
GO:0009231

Map