F394711

General Info

Members Datasets Scaffolds Average Seq Length
299 157 598 139

Family's Representative Sequence

Representative Sequence 3300005466|Ga0070685_11304887|Ga0070685_113048871
Length 152
Sequence MLENPPDRAASKAASVHTAKVQWIGQQKFVAVGPSGHAVAMDSDRNSNTAPGAMEFLLLALGACTATDVVIILEKKRQKLHSLEVICSGERAADPPQVWTKLNILFRLRGQLEESGVKQAIQLSEEKYCSVSATLKKTADLTWNYEILPLPD

Samples

Sample ID Description Type Environment
1 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
43 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
58 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
59 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
81 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
85 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
89 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
90 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
91 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
92 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
93 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
94 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
95 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
96 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
97 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
98 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
99 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
100 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
101 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
102 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
105 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
106 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
107 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
108 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
109 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
110 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
111 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
112 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
113 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
114 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
115 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
116 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
117 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
118 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
119 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
120 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
121 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
122 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
123 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
124 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
125 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
126 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
127 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
128 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
129 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
130 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
131 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
132 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
133 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
134 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
135 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
136 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
137 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
138 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
139 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
140 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
141 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
142 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
143 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
144 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
145 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
149 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
150 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
151 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
152 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
153 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
154 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
155 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
156 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
157 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.33
Metatranscriptomes 1.67
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.68
Rhizosphere 94.98
Stem 0
Stem Tuber 0
Unclassified 35.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070685_11304887 3300005466 Unclassified 554
2 Ga0065707_10007313 3300005295 Unclassified 2820
3 Ga0070680_100164986 3300005336 Bacteria 1862
4 Ga0070668_100934304 3300005347 Bacteria 777
5 Ga0070703_10005421 3300005406 Bacteria 3565
6 Ga0070709_10031991 3300005434 Bacteria 3169
7 Ga0070709_10032788 3300005434 Bacteria 3135
8 Ga0070709_10033239 3300005434 Unclassified 3118
9 Ga0070709_10108685 3300005434 Bacteria 1861
10 Ga0070714_100094885 3300005435 Bacteria 2619
11 Ga0070714_100251571 3300005435 Bacteria 1634
12 Ga0070714_101573621 3300005435 Unclassified 642
13 Ga0070713_100025889 3300005436 Bacteria 4596
14 Ga0070713_100027042 3300005436 Unclassified 4513
15 Ga0070713_101172141 3300005436 Bacteria 743
16 Ga0070710_10013544 3300005437 Unclassified 4087
17 Ga0070710_10953795 3300005437 Unclassified 622
18 Ga0070711_100005710 3300005439 Bacteria 7460
19 Ga0070711_100105540 3300005439 Bacteria 2058
20 Ga0070711_100145461 3300005439 Bacteria 1782
21 Ga0070711_100183185 3300005439 Unclassified 1604
22 Ga0070711_100408110 3300005439 Bacteria 1104
23 Ga0070705_100013439 3300005440 Bacteria 4189
24 Ga0070705_101442398 3300005440 Unclassified 575
25 Ga0070694_100001094 3300005444 Bacteria 15532
26 Ga0070708_100004098 3300005445 Bacteria 11443
27 Ga0070708_100193208 3300005445 Unclassified 1904
28 Ga0070708_100195663 3300005445 Bacteria 1892
29 Ga0070708_100325270 3300005445 Bacteria 1448
30 Ga0070708_101366622 3300005445 Unclassified 661
31 Ga0070681_10598092 3300005458 Unclassified 1017
32 Ga0070681_10614561 3300005458 Bacteria 1001
33 Ga0070706_100005569 3300005467 Bacteria 11989
34 Ga0070706_100122911 3300005467 Bacteria 2420
35 Ga0070706_100190082 3300005467 Unclassified 1919
36 Ga0070707_100206265 3300005468 Bacteria 1916
37 Ga0070698_100015876 3300005471 Bacteria 7951
38 Ga0070698_100063498 3300005471 Bacteria 3724
39 Ga0070699_100009581 3300005518 Bacteria 8392
40 Ga0070699_100533191 3300005518 Unclassified 1068
41 Ga0070679_100001256 3300005530 Bacteria 22367
42 Ga0070697_100001294 3300005536 Bacteria 18842
43 Ga0070697_100004739 3300005536 Bacteria 10421
44 Ga0070697_100095080 3300005536 Bacteria 2470
45 Ga0070697_100308817 3300005536 Unclassified 1360
46 Ga0070697_100326198 3300005536 Bacteria 1323
47 Ga0068853_100207262 3300005539 Unclassified 1786
48 Ga0070695_100006098 3300005545 Bacteria 7123
49 Ga0070695_101102108 3300005545 Unclassified 650
50 Ga0070696_100000740 3300005546 Bacteria 20843
51 Ga0070693_100001006 3300005547 Bacteria 12576
52 Ga0070693_100018101 3300005547 Bacteria 3675
53 Ga0070665_100016819 3300005548 Bacteria 7333
54 Ga0070704_100006564 3300005549 Bacteria 6861
55 Ga0068859_100204988 3300005617 Bacteria 2057
56 Ga0068859_101032856 3300005617 Unclassified 903
57 Ga0068864_100398021 3300005618 Unclassified 1308
58 Ga0068861_100641111 3300005719 Unclassified 980
59 Ga0068858_100859511 3300005842 Unclassified 886
60 Ga0068860_100036434 3300005843 Bacteria 4714
61 Ga0068860_100178932 3300005843 Unclassified 2050
62 Ga0068860_100450355 3300005843 Bacteria 1280
63 Ga0070717_10297916 3300006028 Unclassified 1433
64 Ga0070717_11363841 3300006028 Unclassified 644
65 Ga0070717_11368053 3300006028 Bacteria 643
66 Ga0070715_10300841 3300006163 Unclassified 858
67 Ga0070715_10797288 3300006163 Unclassified 573
68 Ga0070715_11089359 3300006163 Unclassified 502
69 Ga0070716_100001859 3300006173 Bacteria 9569
70 Ga0070716_100008289 3300006173 Bacteria 5155
71 Ga0070716_100063905 3300006173 Unclassified 2138
72 Ga0070716_100243727 3300006173 Bacteria 1220
73 Ga0070716_100307567 3300006173 Bacteria 1105
74 Ga0070716_100737870 3300006173 Unclassified 756
75 Ga0070716_100783201 3300006173 Unclassified 737
76 Ga0070712_100021050 3300006175 Bacteria 4276
77 Ga0070712_100029338 3300006175 Bacteria 3687
78 Ga0070712_100035892 3300006175 Bacteria 3369
79 Ga0070712_100113252 3300006175 Bacteria 2028
80 Ga0070712_100413859 3300006175 Bacteria 1116
81 Ga0070712_100567022 3300006175 Unclassified 958
82 Ga0070712_101598295 3300006175 Unclassified 570
83 Ga0068871_100020135 3300006358 Bacteria 5106
84 Ga0068871_101092962 3300006358 Bacteria 745
85 Ga0075434_100006130 3300006871 Bacteria 11010
86 Ga0075429_100086143 3300006880 Bacteria 2738
87 Ga0075436_100000696 3300006914 Bacteria 22198
88 Ga0075436_100013932 3300006914 Bacteria 5504
89 Ga0075436_100050824 3300006914 Bacteria 2861
90 Ga0075436_100333894 3300006914 Unclassified 1090
91 Ga0075436_100749262 3300006914 Unclassified 725
92 Ga0097620_100204990 3300006931 Bacteria 2057
93 Ga0097620_101032610 3300006931 Unclassified 903
94 Ga0075435_100084620 3300007076 Bacteria 2610
95 Ga0075435_100177898 3300007076 Bacteria 1797
96 Ga0075435_101016494 3300007076 Bacteria 724
97 Ga0075435_101391504 3300007076 Unclassified 615
98 Ga0099794_10002079 3300007265 Bacteria 7271
99 Ga0099794_10002978 3300007265 Bacteria 6388
100 Ga0099794_10003636 3300007265 Bacteria 5922
101 Ga0099794_10004258 3300007265 Bacteria 5591
102 Ga0099794_10007964 3300007265 Unclassified 4381
103 Ga0099794_10010973 3300007265 Unclassified 3867
104 Ga0099794_10026865 3300007265 Bacteria 2664
105 Ga0099794_10032252 3300007265 Bacteria 2458
106 Ga0099794_10063458 3300007265 Unclassified 1798
107 Ga0099794_10068823 3300007265 Bacteria 1731
108 Ga0099794_10080599 3300007265 Unclassified 1605
109 Ga0099794_10098710 3300007265 Bacteria 1456
110 Ga0099794_10166576 3300007265 Bacteria 1122
111 Ga0099795_10105108 3300007788 Bacteria 1112
112 Ga0099795_10156549 3300007788 Bacteria 937
113 Ga0099795_10241826 3300007788 Unclassified 775
114 Ga0099795_10335275 3300007788 Unclassified 673
115 Ga0105240_10143457 3300009093 Unclassified 2853
116 Ga0105247_10075957 3300009101 Bacteria 2109
117 Ga0105248_11168938 3300009177 Bacteria 870
118 Ga0105248_12310201 3300009177 Unclassified 612
119 Ga0105237_10438475 3300009545 Bacteria 1312
120 Ga0105237_10838705 3300009545 Unclassified 926
121 Ga0099796_10029214 3300010159 Bacteria 1777
122 Ga0099796_10136610 3300010159 Bacteria 955
123 Ga0105239_11060316 3300010375 Unclassified 933
124 Ga0157374_10404932 3300013296 Bacteria 1361
125 Ga0157378_11098612 3300013297 Bacteria 832
126 Ga0163162_10973684 3300013306 Unclassified 959
127 Ga0163162_12521176 3300013306 Bacteria 591
128 Ga0157372_10201199 3300013307 Bacteria 2307
129 Ga0157375_10101675 3300013308 Bacteria 2958
130 Ga0157379_10022265 3300014968 Bacteria 5613
131 Ga0157379_10637609 3300014968 Unclassified 997
132 Ga0157376_10000017 3300014969 Bacteria 268501
133 Ga0157376_10000143 3300014969 Bacteria 49045
134 Ga0213874_10103132 3300021377 Bacteria 951
135 Ga0228598_1003117 3300024227 Bacteria 3591
136 Ga0228598_1046947 3300024227 Bacteria 855
137 Ga0207653_10005977 3300025885 Bacteria 3797
138 Ga0207692_10295851 3300025898 Unclassified 984
139 Ga0207685_10036801 3300025905 Bacteria 1797
140 Ga0207685_10473873 3300025905 Unclassified 655
141 Ga0207685_10594396 3300025905 Unclassified 593
142 Ga0207685_10834424 3300025905 Unclassified 509
143 Ga0207699_10018393 3300025906 Bacteria 3702
144 Ga0207699_10020705 3300025906 Bacteria 3531
145 Ga0207699_10186708 3300025906 Bacteria 1397
146 Ga0207699_10584949 3300025906 Unclassified 812
147 Ga0207684_10011618 3300025910 Bacteria 7693
148 Ga0207684_10248667 3300025910 Bacteria 1534
149 Ga0207684_10920555 3300025910 Unclassified 734
150 Ga0207707_10762110 3300025912 Bacteria 809
151 Ga0207695_10098003 3300025913 Unclassified 2931
152 Ga0207693_10038776 3300025915 Unclassified 3751
153 Ga0207693_10640062 3300025915 Unclassified 826
154 Ga0207663_10012107 3300025916 Bacteria 4653
155 Ga0207663_10257449 3300025916 Bacteria 1287
156 Ga0207663_10517297 3300025916 Unclassified 929
157 Ga0207660_10419161 3300025917 Bacteria 1080
158 Ga0207652_10011674 3300025921 Bacteria 7088
159 Ga0207646_10127381 3300025922 Unclassified 2290
160 Ga0207646_11007659 3300025922 Unclassified 736
161 Ga0207700_10050406 3300025928 Bacteria 3102
162 Ga0207700_10062811 3300025928 Bacteria 2822
163 Ga0207700_10898900 3300025928 Bacteria 792
164 Ga0207664_10647812 3300025929 Unclassified 949
165 Ga0207704_10342974 3300025938 Bacteria 1160
166 Ga0207665_10000023 3300025939 Bacteria 104745
167 Ga0207665_10002821 3300025939 Bacteria 11648
168 Ga0207665_10049939 3300025939 Unclassified 2812
169 Ga0207665_10097839 3300025939 Unclassified 2043
170 Ga0207665_10305740 3300025939 Bacteria 1190
171 Ga0207665_10362380 3300025939 Bacteria 1096
172 Ga0207665_10463170 3300025939 Unclassified 974
173 Ga0207665_10617913 3300025939 Unclassified 847
174 Ga0207711_10504448 3300025941 Bacteria 1128
175 Ga0207667_10274594 3300025949 Bacteria 1723
176 Ga0207703_11410803 3300026035 Unclassified 670
177 Ga0209179_1019118 3300027512 Bacteria 1316
178 Ga0209588_1002316 3300027671 Bacteria 5155
179 Ga0209588_1009421 3300027671 Bacteria 2920
180 Ga0209588_1011615 3300027671 Unclassified 2663
181 Ga0209588_1014495 3300027671 Unclassified 2414
182 Ga0209588_1023165 3300027671 Bacteria 1956
183 Ga0209588_1064129 3300027671 Bacteria 1187
184 Ga0209588_1102418 3300027671 Bacteria 921
185 Ga0209588_1126671 3300027671 Unclassified 816
186 Ga0265354_1000026 3300028016 Bacteria 23406
187 Ga0265354_1003618 3300028016 Bacteria 1708
188 Ga0265357_1007296 3300028023 Unclassified 1065
189 Ga0268266_10000444 3300028379 Bacteria 61604
190 Ga0268264_10039426 3300028381 Bacteria 3903
191 Ga0268264_10399176 3300028381 Bacteria 1321
192 Ga0265338_10069505 3300028800 Unclassified 3025
193 Ga0265770_1001077 3300030878 Bacteria 3774
194 Ga0265770_1011546 3300030878 Bacteria 1297
195 Ga0265765_1000099 3300030879 Bacteria 4890
196 Ga0265760_10006404 3300031090 Bacteria 3368
197 Ga0265760_10020084 3300031090 Bacteria 1926
198 Ga0265340_10133510 3300031247 Bacteria 1137
199 Ga0316212_1001005 3300033547 Bacteria 3724
200 Ga0316212_1001669 3300033547 Unclassified 3061
201 Ga0316212_1002260 3300033547 Bacteria 2736
202 Ga0373926_0000603 3300035083 Bacteria 9744
203 Ga0373926_0223427 3300035083 Bacteria 727
204 Ga0373934_0048181 3300035086 Unclassified 1686
205 Ga0373923_0090821 3300035111 Bacteria 1336
206 Ga0373941_0406981 3300035115 Unclassified 564
207 Ga0373954_0002252 3300035118 Bacteria 8028
208 Ga0373956_0064355 3300035119 Unclassified 1665
209 Ga0373946_0023291 3300035171 Bacteria 2418
210 Ga0373955_0000159 3300035172 Bacteria 27173
211 Ga0373955_0112734 3300035172 Unclassified 1574
212 Ga0373931_0021076 3300035691 Bacteria 3268
213 Ga0373935_0359430 3300035692 Unclassified 1039
214 Ga0373935_0651285 3300035692 Unclassified 773
215 Ga0373927_0000250 3300035695 Bacteria 42453
216 Ga0373927_0441841 3300035695 Bacteria 859
217 Ga0373933_0006738 3300035724 Bacteria 6261
218 Ga0373947_0001109 3300035725 Bacteria 16525
219 Ga0373947_0363424 3300035725 Bacteria 972
220 Ga0373937_0002331 3300036401 Bacteria 15854
221 Ga0373937_0018095 3300036401 Bacteria 6286
222 Ga0373937_0186608 3300036401 Bacteria 1948
223 Ga0373925_0000395 3300037068 Bacteria 44643
224 Ga0373925_0255536 3300037068 Bacteria 1406
225 Ga0436365_0772610 3300039437 Unclassified 829
226 Ga0436365_1699787 3300039437 Bacteria 3327
227 Ga0436363_1397464 3300039450 Unclassified 939
228 Ga0453683_0019488 3300044673 Bacteria 4344
229 Ga0453684_0139404 3300044712 Bacteria 2899
230 Ga0495603_0543991 3300046455 Unclassified 665
231 Ga0495629_0034883 3300046459 Bacteria 3556
232 Ga0495641_0049072 3300046461 Bacteria 1934
233 Ga0495641_0113502 3300046461 Unclassified 1209
234 Ga0495580_0113002 3300046472 Bacteria 1886
235 Ga0495580_0390984 3300046472 Bacteria 939
236 Ga0495580_0908811 3300046472 Unclassified 565
237 Ga0495582_0002924 3300046473 Bacteria 9551
238 Ga0495639_0014194 3300046475 Bacteria 3448
239 Ga0495662_0077241 3300046476 Bacteria 1617
240 Ga0495664_0154192 3300046477 Bacteria 1393
241 Ga0495664_0161416 3300046477 Bacteria 1360
242 Ga0495594_0035498 3300046499 Bacteria 2716
243 Ga0495606_0247791 3300046507 Bacteria 990
244 Ga0495608_0121883 3300046511 Unclassified 1672
245 Ga0495618_0091401 3300046514 Bacteria 1946
246 Ga0495628_0128376 3300046516 Bacteria 1941
247 Ga0495630_0010431 3300046517 Bacteria 6708
248 Ga0495630_0029970 3300046517 Bacteria 4046
249 Ga0495632_0017326 3300046519 Unclassified 3980
250 Ga0495666_0381237 3300046526 Unclassified 634
251 Ga0495652_0144240 3300046529 Unclassified 1869
252 Ga0495665_0051430 3300046531 Bacteria 2182
253 Ga0495640_0022054 3300046533 Bacteria 4663
254 Ga0495586_0005192 3300046535 Bacteria 6971
255 Ga0495587_0011243 3300046536 Bacteria 5674
256 Ga0495587_0029043 3300046536 Bacteria 3359
257 Ga0495645_0123680 3300046543 Unclassified 1819
258 Ga0495667_0785044 3300046559 Unclassified 588
259 Ga0495667_0901927 3300046559 Unclassified 542
260 Ga0495634_0031899 3300046642 Bacteria 3627
261 Ga0495635_0945651 3300046663 Unclassified 550
262 Ga0495623_0152367 3300046679 Unclassified 1366
263 Ga0495647_0282685 3300046681 Unclassified 744
264 Ga0495658_0007656 3300046683 Bacteria 5355
265 Ga0495624_0356228 3300046690 Unclassified 880
266 Ga0495604_0191530 3300047317 Unclassified 1425
267 Ga0495636_0226742 3300047318 Bacteria 859
268 Ga0495674_0058998 3300047319 Bacteria 3353
269 Ga0495674_0060030 3300047319 Bacteria 3319
270 Ga0495674_1211355 3300047319 Unclassified 570
271 Ga0495676_0051064 3300047321 Bacteria 3311
272 Ga0495676_0118837 3300047321 Bacteria 1927
273 Ga0495680_0129430 3300047322 Bacteria 1856
274 Ga0495675_0762099 3300047444 Bacteria 538
275 Ga0495684_0005435 3300047471 Bacteria 9914
276 Ga0495602_0019075 3300048088 Bacteria 6822
277 Ga0496104_0458623 3300048907 Unclassified 1186
278 Ga0496105_0205242 3300048908 Unclassified 1608
279 Ga0496114_0054080 3300048917 Unclassified 3347
280 Ga0496114_0060106 3300048917 Bacteria 3176
281 Ga0496115_0005244 3300048918 Bacteria 9417
282 Ga0496115_0049917 3300048918 Unclassified 3350
283 Ga0496115_0212925 3300048918 Archaea 1596
284 Ga0496115_0241189 3300048918 Bacteria 1490
285 nmdc:mga0n895_1954819_c1 3300050512 Unclassified 545
286 nmdc:mga0n895_27666_c1 3300050512 Bacteria 5389
287 nmdc:mga0n895_5974_c1 3300050512 Bacteria 10250
288 nmdc:mga0rr50_1051968_c1 3300050513 Unclassified 693
289 nmdc:mga0rr50_45133_c1 3300050513 Bacteria 3236
290 nmdc:mga0rr50_71871_c1 3300050513 Bacteria 2641
291 nmdc:mga08x19_123_c1 3300050514 Bacteria 68147
292 nmdc:mga08x19_236_c1 3300050514 Bacteria 42242
293 nmdc:mga08x19_854319_c1 3300050514 Bacteria 646
294 nmdc:mga08x19_966803_c1 3300050514 Unclassified 605
295 nmdc:mga0a205_702224_c1 3300050515 Unclassified 861
296 Ga0495601_0004029 3300053077 Bacteria 8462
297 Ga0495612_0235073 3300053078 Bacteria 813
298 Ga0495619_0274088 3300053085 Bacteria 1169
299 Ga0530510_0237910 3300061734 Unclassified 1355
300 Ga0070685_11304887
301 Ga0065707_10007313
302 Ga0070680_100164986
303 Ga0070668_100934304
304 Ga0070703_10005421
305 Ga0070709_10031991
306 Ga0070709_10032788
307 Ga0070709_10033239
308 Ga0070709_10108685
309 Ga0070714_100094885
310 Ga0070714_100251571
311 Ga0070714_101573621
312 Ga0070713_100025889
313 Ga0070713_100027042
314 Ga0070713_101172141
315 Ga0070710_10013544
316 Ga0070710_10953795
317 Ga0070711_100005710
318 Ga0070711_100105540
319 Ga0070711_100145461
320 Ga0070711_100183185
321 Ga0070711_100408110
322 Ga0070705_100013439
323 Ga0070705_101442398
324 Ga0070694_100001094
325 Ga0070708_100004098
326 Ga0070708_100193208
327 Ga0070708_100195663
328 Ga0070708_100325270
329 Ga0070708_101366622
330 Ga0070681_10598092
331 Ga0070681_10614561
332 Ga0070706_100005569
333 Ga0070706_100122911
334 Ga0070706_100190082
335 Ga0070707_100206265
336 Ga0070698_100015876
337 Ga0070698_100063498
338 Ga0070699_100009581
339 Ga0070699_100533191
340 Ga0070679_100001256
341 Ga0070697_100001294
342 Ga0070697_100004739
343 Ga0070697_100095080
344 Ga0070697_100308817
345 Ga0070697_100326198
346 Ga0068853_100207262
347 Ga0070695_100006098
348 Ga0070695_101102108
349 Ga0070696_100000740
350 Ga0070693_100001006
351 Ga0070693_100018101
352 Ga0070665_100016819
353 Ga0070704_100006564
354 Ga0068859_100204988
355 Ga0068859_101032856
356 Ga0068864_100398021
357 Ga0068861_100641111
358 Ga0068858_100859511
359 Ga0068860_100036434
360 Ga0068860_100178932
361 Ga0068860_100450355
362 Ga0070717_10297916
363 Ga0070717_11363841
364 Ga0070717_11368053
365 Ga0070715_10300841
366 Ga0070715_10797288
367 Ga0070715_11089359
368 Ga0070716_100001859
369 Ga0070716_100008289
370 Ga0070716_100063905
371 Ga0070716_100243727
372 Ga0070716_100307567
373 Ga0070716_100737870
374 Ga0070716_100783201
375 Ga0070712_100021050
376 Ga0070712_100029338
377 Ga0070712_100035892
378 Ga0070712_100113252
379 Ga0070712_100413859
380 Ga0070712_100567022
381 Ga0070712_101598295
382 Ga0068871_100020135
383 Ga0068871_101092962
384 Ga0075434_100006130
385 Ga0075429_100086143
386 Ga0075436_100000696
387 Ga0075436_100013932
388 Ga0075436_100050824
389 Ga0075436_100333894
390 Ga0075436_100749262
391 Ga0097620_100204990
392 Ga0097620_101032610
393 Ga0075435_100084620
394 Ga0075435_100177898
395 Ga0075435_101016494
396 Ga0075435_101391504
397 Ga0099794_10002079
398 Ga0099794_10002978
399 Ga0099794_10003636
400 Ga0099794_10004258
401 Ga0099794_10007964
402 Ga0099794_10010973
403 Ga0099794_10026865
404 Ga0099794_10032252
405 Ga0099794_10063458
406 Ga0099794_10068823
407 Ga0099794_10080599
408 Ga0099794_10098710
409 Ga0099794_10166576
410 Ga0099795_10105108
411 Ga0099795_10156549
412 Ga0099795_10241826
413 Ga0099795_10335275
414 Ga0105240_10143457
415 Ga0105247_10075957
416 Ga0105248_11168938
417 Ga0105248_12310201
418 Ga0105237_10438475
419 Ga0105237_10838705
420 Ga0099796_10029214
421 Ga0099796_10136610
422 Ga0105239_11060316
423 Ga0157374_10404932
424 Ga0157378_11098612
425 Ga0163162_10973684
426 Ga0163162_12521176
427 Ga0157372_10201199
428 Ga0157375_10101675
429 Ga0157379_10022265
430 Ga0157379_10637609
431 Ga0157376_10000017
432 Ga0157376_10000143
433 Ga0213874_10103132
434 Ga0228598_1003117
435 Ga0228598_1046947
436 Ga0207653_10005977
437 Ga0207692_10295851
438 Ga0207685_10036801
439 Ga0207685_10473873
440 Ga0207685_10594396
441 Ga0207685_10834424
442 Ga0207699_10018393
443 Ga0207699_10020705
444 Ga0207699_10186708
445 Ga0207699_10584949
446 Ga0207684_10011618
447 Ga0207684_10248667
448 Ga0207684_10920555
449 Ga0207707_10762110
450 Ga0207695_10098003
451 Ga0207693_10038776
452 Ga0207693_10640062
453 Ga0207663_10012107
454 Ga0207663_10257449
455 Ga0207663_10517297
456 Ga0207660_10419161
457 Ga0207652_10011674
458 Ga0207646_10127381
459 Ga0207646_11007659
460 Ga0207700_10050406
461 Ga0207700_10062811
462 Ga0207700_10898900
463 Ga0207664_10647812
464 Ga0207704_10342974
465 Ga0207665_10000023
466 Ga0207665_10002821
467 Ga0207665_10049939
468 Ga0207665_10097839
469 Ga0207665_10305740
470 Ga0207665_10362380
471 Ga0207665_10463170
472 Ga0207665_10617913
473 Ga0207711_10504448
474 Ga0207667_10274594
475 Ga0207703_11410803
476 Ga0209179_1019118
477 Ga0209588_1002316
478 Ga0209588_1009421
479 Ga0209588_1011615
480 Ga0209588_1014495
481 Ga0209588_1023165
482 Ga0209588_1064129
483 Ga0209588_1102418
484 Ga0209588_1126671
485 Ga0265354_1000026
486 Ga0265354_1003618
487 Ga0265357_1007296
488 Ga0268266_10000444
489 Ga0268264_10039426
490 Ga0268264_10399176
491 Ga0265338_10069505
492 Ga0265770_1001077
493 Ga0265770_1011546
494 Ga0265765_1000099
495 Ga0265760_10006404
496 Ga0265760_10020084
497 Ga0265340_10133510
498 Ga0316212_1001005
499 Ga0316212_1001669
500 Ga0316212_1002260
501 Ga0373926_0000603
502 Ga0373926_0223427
503 Ga0373934_0048181
504 Ga0373923_0090821
505 Ga0373941_0406981
506 Ga0373954_0002252
507 Ga0373956_0064355
508 Ga0373946_0023291
509 Ga0373955_0000159
510 Ga0373955_0112734
511 Ga0373931_0021076
512 Ga0373935_0359430
513 Ga0373935_0651285
514 Ga0373927_0000250
515 Ga0373927_0441841
516 Ga0373933_0006738
517 Ga0373947_0001109
518 Ga0373947_0363424
519 Ga0373937_0002331
520 Ga0373937_0018095
521 Ga0373937_0186608
522 Ga0373925_0000395
523 Ga0373925_0255536
524 Ga0436365_0772610
525 Ga0436365_1699787
526 Ga0436363_1397464
527 Ga0453683_0019488
528 Ga0453684_0139404
529 Ga0495603_0543991
530 Ga0495629_0034883
531 Ga0495641_0049072
532 Ga0495641_0113502
533 Ga0495580_0113002
534 Ga0495580_0390984
535 Ga0495580_0908811
536 Ga0495582_0002924
537 Ga0495639_0014194
538 Ga0495662_0077241
539 Ga0495664_0154192
540 Ga0495664_0161416
541 Ga0495594_0035498
542 Ga0495606_0247791
543 Ga0495608_0121883
544 Ga0495618_0091401
545 Ga0495628_0128376
546 Ga0495630_0010431
547 Ga0495630_0029970
548 Ga0495632_0017326
549 Ga0495666_0381237
550 Ga0495652_0144240
551 Ga0495665_0051430
552 Ga0495640_0022054
553 Ga0495586_0005192
554 Ga0495587_0011243
555 Ga0495587_0029043
556 Ga0495645_0123680
557 Ga0495667_0785044
558 Ga0495667_0901927
559 Ga0495634_0031899
560 Ga0495635_0945651
561 Ga0495623_0152367
562 Ga0495647_0282685
563 Ga0495658_0007656
564 Ga0495624_0356228
565 Ga0495604_0191530
566 Ga0495636_0226742
567 Ga0495674_0058998
568 Ga0495674_0060030
569 Ga0495674_1211355
570 Ga0495676_0051064
571 Ga0495676_0118837
572 Ga0495680_0129430
573 Ga0495675_0762099
574 Ga0495684_0005435
575 Ga0495602_0019075
576 Ga0496104_0458623
577 Ga0496105_0205242
578 Ga0496114_0054080
579 Ga0496114_0060106
580 Ga0496115_0005244
581 Ga0496115_0049917
582 Ga0496115_0212925
583 Ga0496115_0241189
584 nmdc:mga0n895_1954819_c1
585 nmdc:mga0n895_27666_c1
586 nmdc:mga0n895_5974_c1
587 nmdc:mga0rr50_1051968_c1
588 nmdc:mga0rr50_45133_c1
589 nmdc:mga0rr50_71871_c1
590 nmdc:mga08x19_123_c1
591 nmdc:mga08x19_236_c1
592 nmdc:mga08x19_854319_c1
593 nmdc:mga08x19_966803_c1
594 nmdc:mga0a205_702224_c1
595 Ga0495601_0004029
596 Ga0495612_0235073
597 Ga0495619_0274088
598 Ga0530510_0237910

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

45

144

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ml8-assembly1.cif.gz_A-2 structural genomics 0.9547 8 139
2e8c-assembly1.cif.gz_A crystal structure of a hypothetical protein (aq_1549) from aquifex aeolicus vf5 0.9472 7 141
1ml8-assembly1.cif.gz_A-2 structural genomics 0.9334 8 139
2e8c-assembly1.cif.gz_A crystal structure of a hypothetical protein (aq_1549) from aquifex aeolicus vf5 0.9197 7 141
2pn2-assembly1.cif.gz_A-2 crystal structure of a putative osmotic stress induced and detoxification response protein (psyc_0566) from psychrobacter arcticus 273-4 at 2.15 a resolution 0.8893 8 136
ID Description Score Start End Superfamily
2egtA02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9768 42 141 3.30.300.20
2egtA02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9673 42 141 3.30.300.20
1ml8A02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9617 42 139 3.30.300.20
2e8fA00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9478 7 141 3.30.300.20
1ml8A02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9423 42 139 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A7V9R5N6-F1-model_v4 OsmC family protein 0.9901 40 139
AF-A0A381GXS0-F1-model_v4 deleted 0.9878 50 139
AF-A0A0H3GZC9-F1-model_v4 OsmC/Ohr family protein 0.9874 44 139
AF-A0A259P8C9-F1-model_v4 Peroxiredoxin 0.9866 58 139
AF-A0A2V9XGA0-F1-model_v4 Osmotically inducible protein OsmC 0.9839 7 142

Map