F394643

General Info

Members Datasets Scaffolds Average Seq Length
299 206 598 325

Family's Representative Sequence

Representative Sequence 3300005295|Ga0065707_10000575|Ga0065707_1000057526
Length 379
Sequence LFHDAKGRGLHSFTRRLLLGIGSTLVLPGAAHGFAHATDVAAGNRSSTSPRSRVIDVHTHMLNSSFVELLRTRGGAHYSIKQVIGGQTGVYRDGAPFMTLTPGMFDYELRLRAMDEACVDMAIVTLTSPNCYWGTSDDTLKAAQIVNDDMAAQSRRYPDRIRFMCSLPWLDAKLAVAELKRACDSLGAVGVMVLANVDEGSLTDKRFEPIWDEIDGRALPVLVHPTAPPATKYLDVVQYNLIASVGFMFDTSLAISRMIFDGFLDRYPNLKLIAAHGGGALPYLAGRLDICYDNMPAARVKISQQPSTYLRRIYYDSVVFRQDALAMCIAVAGDDRVLYGSDYPHNIGDMKGCLARVDALPAGQRDAVRGGNAERLFGL

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
110 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
111 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
112 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
113 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
114 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
115 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
116 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
117 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
118 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
119 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
121 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
123 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
128 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
129 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
130 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
131 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
132 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
133 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
134 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
135 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
136 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
137 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
138 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
139 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
140 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
141 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
142 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
146 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
147 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
148 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
149 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
150 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
151 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
152 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
153 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
154 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
155 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
156 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
157 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
160 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
161 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
179 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
180 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
181 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
182 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
183 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
184 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
185 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
188 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
189 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
199 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
200 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
201 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
202 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
203 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
204 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
205 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
206 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.66
Metatranscriptomes 0
Isolates 1.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.67
Nodule 0
Rhizoplane 3.68
Rhizosphere 92.98
Stem 0
Stem Tuber 0
Unclassified 3.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10000575 3300005295 Bacteria 20383
2 Ga0055540_1017294 3300003792 Bacteria 2017
3 Ga0065712_10189341 3300005290 Bacteria 1152
4 Ga0070658_10049034 3300005327 Bacteria 3421
5 Ga0070676_10028664 3300005328 Bacteria 3163
6 Ga0070676_10104285 3300005328 Bacteria 1757
7 Ga0070690_100000398 3300005330 Bacteria 21982
8 Ga0070690_100006533 3300005330 Bacteria 6618
9 Ga0068869_100001796 3300005334 Bacteria 12871
10 Ga0068869_100207381 3300005334 Bacteria 1548
11 Ga0070680_100001167 3300005336 Bacteria 18875
12 Ga0070680_100032528 3300005336 Bacteria 4198
13 Ga0070680_100087305 3300005336 Bacteria 2579
14 Ga0068868_100005562 3300005338 Bacteria 8862
15 Ga0070689_100000188 3300005340 Bacteria 37400
16 Ga0070689_100046035 3300005340 Bacteria 3360
17 Ga0070691_10001176 3300005341 Bacteria 10947
18 Ga0070687_100000069 3300005343 Bacteria 33055
19 Ga0070692_10001429 3300005345 Bacteria 8658
20 Ga0070668_100070286 3300005347 Bacteria 2725
21 Ga0070669_100059581 3300005353 Bacteria 2803
22 Ga0070671_100016195 3300005355 Bacteria 6029
23 Ga0070674_100010247 3300005356 Bacteria 5656
24 Ga0070673_100077430 3300005364 Bacteria 2687
25 Ga0070659_100163169 3300005366 Bacteria 1823
26 Ga0070659_100272107 3300005366 Bacteria 1408
27 Ga0070703_10011210 3300005406 Bacteria 2531
28 Ga0070701_10000603 3300005438 Bacteria 12535
29 Ga0070705_100001149 3300005440 Bacteria 14607
30 Ga0070705_100021227 3300005440 Bacteria 3451
31 Ga0070700_100008466 3300005441 Bacteria 5600
32 Ga0070700_100087590 3300005441 Bacteria 2024
33 Ga0070694_100001966 3300005444 Bacteria 12184
34 Ga0070694_100049161 3300005444 Bacteria 2839
35 Ga0070681_10004879 3300005458 Bacteria 12865
36 Ga0070681_10017563 3300005458 Bacteria 7149
37 Ga0068867_100000296 3300005459 Bacteria 32704
38 Ga0070679_100035619 3300005530 Bacteria 4938
39 Ga0070697_100037326 3300005536 Bacteria 3926
40 Ga0068853_100136533 3300005539 Bacteria 2199
41 Ga0070672_100024194 3300005543 Bacteria 4484
42 Ga0070686_100000090 3300005544 Bacteria 63246
43 Ga0070695_100000188 3300005545 Bacteria 29840
44 Ga0070696_100000719 3300005546 Bacteria 21155
45 Ga0070693_100000525 3300005547 Bacteria 17212
46 Ga0070704_100000168 3300005549 Bacteria 26018
47 Ga0068855_100000833 3300005563 Bacteria 38155
48 Ga0068854_100000657 3300005578 Bacteria 20579
49 Ga0068856_100003103 3300005614 Bacteria 16966
50 Ga0070702_100000002 3300005615 Bacteria 83999
51 Ga0068859_100000195 3300005617 Bacteria 59015
52 Ga0068866_10002071 3300005718 Bacteria 8341
53 Ga0068861_100000043 3300005719 Bacteria 57807
54 Ga0068870_10045442 3300005840 Unclassified 2299
55 Ga0068863_100246843 3300005841 Bacteria 1724
56 Ga0068858_100005138 3300005842 Bacteria 12824
57 Ga0068860_100002559 3300005843 Bacteria 19020
58 Ga0068862_100002188 3300005844 Bacteria 17538
59 Ga0068862_100058984 3300005844 Bacteria 3294
60 Ga0075362_10074053 3300006177 Bacteria 1560
61 Ga0097621_100000045 3300006237 Bacteria 65278
62 Ga0068871_100000040 3300006358 Bacteria 69044
63 Ga0075428_100000047 3300006844 Bacteria 96882
64 Ga0075428_100004780 3300006844 Bacteria 15003
65 Ga0075430_100019382 3300006846 Bacteria 5785
66 Ga0075430_100035024 3300006846 Bacteria 4262
67 Ga0075431_100000582 3300006847 Bacteria 30956
68 Ga0075431_100307623 3300006847 Bacteria 1600
69 Ga0075434_100047891 3300006871 Bacteria 4241
70 Ga0075434_100418020 3300006871 Bacteria 1362
71 Ga0075429_100000067 3300006880 Bacteria 51949
72 Ga0068865_100001956 3300006881 Bacteria 12156
73 Ga0097620_100000195 3300006931 Bacteria 59015
74 Ga0111539_10005836 3300009094 Bacteria 15919
75 Ga0111539_10193777 3300009094 Bacteria 2371
76 Ga0111539_10320706 3300009094 Bacteria 1803
77 Ga0111539_10580658 3300009094 Bacteria 1305
78 Ga0105245_10000306 3300009098 Bacteria 47026
79 Ga0105247_10074178 3300009101 Bacteria 2133
80 Ga0114129_10000040 3300009147 Bacteria 107971
81 Ga0114129_10002403 3300009147 Bacteria 25997
82 Ga0114129_10184987 3300009147 Bacteria 2832
83 Ga0114129_10569817 3300009147 Archaea 1470
84 Ga0105243_10000035 3300009148 Bacteria 177598
85 Ga0105243_10002936 3300009148 Bacteria 14105
86 Ga0105241_10047589 3300009174 Bacteria 3262
87 Ga0105242_10004996 3300009176 Bacteria 10258
88 Ga0105242_10254787 3300009176 Bacteria 1583
89 Ga0105248_10168745 3300009177 Bacteria 2467
90 Ga0105248_10848119 3300009177 Bacteria 1031
91 Ga0105239_10046556 3300010375 Bacteria 4753
92 Ga0105239_10116528 3300010375 Bacteria 2964
93 Ga0157370_10024681 3300013104 Bacteria 5953
94 Ga0157369_10001813 3300013105 Bacteria 25856
95 Ga0157369_10211728 3300013105 Bacteria 2031
96 Ga0157374_10008199 3300013296 Bacteria 8928
97 Ga0157378_10001996 3300013297 Bacteria 18243
98 Ga0163162_10051390 3300013306 Bacteria 4136
99 Ga0163162_10343532 3300013306 Bacteria 1625
100 Ga0157372_10167539 3300013307 Bacteria 2541
101 Ga0163163_10386365 3300014325 Bacteria 1457
102 Ga0157380_10008319 3300014326 Bacteria 7395
103 Ga0157377_10016093 3300014745 Bacteria 3841
104 Ga0157379_10080837 3300014968 Bacteria 2912
105 Ga0157376_10000403 3300014969 Bacteria 28093
106 Ga0207653_10015259 3300025885 Bacteria 2411
107 Ga0207688_10019059 3300025901 Bacteria 3734
108 Ga0207680_10179880 3300025903 Bacteria 1429
109 Ga0207643_10056566 3300025908 Bacteria 2231
110 Ga0207654_10055934 3300025911 Bacteria 2287
111 Ga0207707_10005644 3300025912 Bacteria 10950
112 Ga0207707_10019758 3300025912 Bacteria 5881
113 Ga0207660_10006506 3300025917 Bacteria 7582
114 Ga0207660_10180201 3300025917 Bacteria 1640
115 Ga0207662_10000006 3300025918 Bacteria 105457
116 Ga0207652_10015854 3300025921 Bacteria 6141
117 Ga0207681_10023390 3300025923 Bacteria 3951
118 Ga0207681_10039996 3300025923 Bacteria 3117
119 Ga0207687_10003249 3300025927 Bacteria 11009
120 Ga0207644_10148063 3300025931 Bacteria 1815
121 Ga0207706_10058499 3300025933 Bacteria 3395
122 Ga0207709_10001302 3300025935 Bacteria 17772
123 Ga0207670_10001617 3300025936 Bacteria 11751
124 Ga0207670_10113181 3300025936 Bacteria 1959
125 Ga0207670_10114892 3300025936 Bacteria 1946
126 Ga0207704_10001570 3300025938 Bacteria 10245
127 Ga0207711_10086817 3300025941 Bacteria 2744
128 Ga0207689_10000082 3300025942 Bacteria 76708
129 Ga0207689_10010692 3300025942 Bacteria 7895
130 Ga0207651_10076516 3300025960 Bacteria 2393
131 Ga0207677_10005887 3300026023 Bacteria 6671
132 Ga0207708_10000936 3300026075 Bacteria 21857
133 Ga0207708_10091694 3300026075 Bacteria 2343
134 Ga0207702_10014977 3300026078 Bacteria 6433
135 Ga0207648_10000316 3300026089 Bacteria 52941
136 Ga0207648_10007668 3300026089 Bacteria 10564
137 Ga0207674_10105562 3300026116 Bacteria 2795
138 Ga0207675_100000064 3300026118 Bacteria 79279
139 Ga0207698_10386749 3300026142 Bacteria 1333
140 Ga0207698_10437698 3300026142 Bacteria 1259
141 Ga0207428_10000179 3300027907 Bacteria 88854
142 Ga0207428_10002474 3300027907 Bacteria 18446
143 Ga0207428_10093386 3300027907 Bacteria 2334
144 Ga0207428_10206473 3300027907 Bacteria 1477
145 Ga0268266_10152120 3300028379 Bacteria 2087
146 Ga0268265_10006971 3300028380 Bacteria 7644
147 Ga0268265_10194377 3300028380 Bacteria 1755
148 Ga0268264_10001394 3300028381 Bacteria 22601
149 Ga0307416_100055010 3300032002 Bacteria 3202
150 Ga0307416_100087670 3300032002 Bacteria 2658
151 Ga0373928_0009916 3300035084 Bacteria 1865
152 Ga0373944_0001341 3300035089 Bacteria 6197
153 Ga0373949_0012075 3300035090 Bacteria 1908
154 Ga0373952_0045540 3300035092 Bacteria 1028
155 Ga0373932_0022312 3300035112 Bacteria 1680
156 Ga0373936_0017525 3300035113 Unclassified 2759
157 Ga0373945_0131610 3300035116 Bacteria 1002
158 Ga0373954_0000020 3300035118 Bacteria 60211
159 Ga0373960_0026711 3300035121 Unclassified 1579
160 Ga0373943_0008956 3300035170 Bacteria 4485
161 Ga0373924_0011512 3300035410 Bacteria 3287
162 Ga0373931_0008696 3300035691 Bacteria 4829
163 Ga0373935_0036176 3300035692 Bacteria 3085
164 Ga0373935_0151814 3300035692 Bacteria 1572
165 Ga0373933_0010314 3300035724 Bacteria 5120
166 Ga0373947_0058989 3300035725 Bacteria 2326
167 Ga0373937_0005040 3300036401 Bacteria 11244
168 Ga0395899_0008336 3300037312 Bacteria 7980
169 Ga0395905_0015055 3300037471 Bacteria 7369
170 Ga0436365_0116235 3300039437 Bacteria 1965
171 Ga0436361_0603703 3300039447 Unclassified 3614
172 Ga0436361_1035107 3300039447 Unclassified 1957
173 Ga0436363_1682763 3300039450 Bacteria 4267
174 Ga0450893_0001123 3300042532 Bacteria 4022
175 Ga0451577_0085560 3300042876 Bacteria 2813
176 Ga0466963_0017883 3300044694 Bacteria 4423
177 Ga0466957_0127854 3300044842 Bacteria 1625
178 Ga0466957_0161098 3300044842 Bacteria 1457
179 Ga0451576_0000822 3300045051 Bacteria 60600
180 Ga0495592_0032564 3300046454 Bacteria 3932
181 Ga0495603_0027911 3300046455 Bacteria 3404
182 Ga0495580_0006345 3300046472 Bacteria 9645
183 Ga0495580_0036583 3300046472 Bacteria 3523
184 Ga0495582_0088373 3300046473 Bacteria 1726
185 Ga0495639_0014295 3300046475 Bacteria 3436
186 Ga0495662_0065342 3300046476 Bacteria 1758
187 Ga0495608_0074354 3300046511 Bacteria 2215
188 Ga0495618_0084073 3300046514 Bacteria 2033
189 Ga0495628_0093496 3300046516 Bacteria 2325
190 Ga0495630_0061608 3300046517 Bacteria 2817
191 Ga0495630_0329877 3300046517 Bacteria 1167
192 Ga0495640_0015695 3300046533 Bacteria 5689
193 Ga0495586_0029197 3300046535 Bacteria 2951
194 Ga0495586_0074213 3300046535 Bacteria 1861
195 Ga0495667_0232020 3300046559 Bacteria 1177
196 Ga0495635_0014382 3300046663 Bacteria 5536
197 Ga0495635_0075762 3300046663 Bacteria 2305
198 Ga0495635_0092168 3300046663 Bacteria 2072
199 Ga0495657_0034527 3300046675 Bacteria 3512
200 Ga0495599_0031900 3300046678 Bacteria 3307
201 Ga0495647_0014461 3300046681 Bacteria 2750
202 Ga0495669_0101650 3300046684 Bacteria 1336
203 Ga0495613_0020868 3300046689 Bacteria 4883
204 Ga0495624_0018663 3300046690 Bacteria 4638
205 Ga0495581_0133724 3300047315 Bacteria 1445
206 Ga0495636_0002166 3300047318 Bacteria 7532
207 Ga0495676_0096834 3300047321 Unclassified 2193
208 Ga0495680_0011171 3300047322 Bacteria 7973
209 Ga0495675_0106550 3300047444 Bacteria 1752
210 Ga0495602_0209505 3300048088 Bacteria 1481
211 Ga0495602_0497750 3300048088 Bacteria 852
212 Ga0496100_0027048 3300048903 Bacteria 3523
213 Ga0496101_0063870 3300048904 Bacteria 2681
214 Ga0496101_0262587 3300048904 Unclassified 1347
215 Ga0496104_0023670 3300048907 Bacteria 5648
216 Ga0496104_0032457 3300048907 Bacteria 4860
217 Ga0496104_0114441 3300048907 Bacteria 2587
218 Ga0496105_0033081 3300048908 Bacteria 4245
219 Ga0496106_0142583 3300048909 Bacteria 1885
220 Ga0496108_0051936 3300048911 Bacteria 3434
221 Ga0496109_0073585 3300048912 Bacteria 3140
222 Ga0496109_0126678 3300048912 Bacteria 2381
223 Ga0501033_0024251 3300049570 Bacteria 4577
224 Ga0501036_0019015 3300049572 Bacteria 5763
225 Ga0501037_0243728 3300049573 Bacteria 1259
226 Ga0501037_0243956 3300049573 Bacteria 1259
227 Ga0501038_0001055 3300049574 Bacteria 24857
228 Ga0501039_0023886 3300049575 Bacteria 4694
229 Ga0501039_0089980 3300049575 Bacteria 2392
230 Ga0501039_0169009 3300049575 Bacteria 1719
231 Ga0501039_0217107 3300049575 Unclassified 1504
232 Ga0501039_0320639 3300049575 Bacteria 1218
233 Ga0501040_0000430 3300049576 Bacteria 24912
234 Ga0501041_0001076 3300049577 Bacteria 14951
235 Ga0501042_0004555 3300049578 Bacteria 8843
236 Ga0501042_0033357 3300049578 Unclassified 3650
237 Ga0501046_0002338 3300049580 Bacteria 17881
238 Ga0501046_0039509 3300049580 Bacteria 3778
239 Ga0501046_0245589 3300049580 Bacteria 1319
240 Ga0501046_0284443 3300049580 Bacteria 1211
241 Ga0501048_0000190 3300049582 Bacteria 39467
242 Ga0501048_0233746 3300049582 Bacteria 1304
243 Ga0501068_0136198 3300049584 Bacteria 1538
244 Ga0501071_0001593 3300049587 Bacteria 13294
245 Ga0501072_0000900 3300049588 Bacteria 21814
246 Ga0501072_0056116 3300049588 Bacteria 3104
247 Ga0501072_0146941 3300049588 Bacteria 1880
248 Ga0501073_0503408 3300049589 Bacteria 837
249 Ga0501075_0003935 3300049591 Bacteria 10005
250 Ga0501075_0119385 3300049591 Bacteria 2006
251 Ga0501075_0158893 3300049591 Bacteria 1724
252 Ga0501075_0518410 3300049591 Bacteria 910
253 Ga0501076_0000440 3300049592 Bacteria 26295
254 Ga0501076_0096782 3300049592 Bacteria 2378
255 Ga0501076_0202459 3300049592 Bacteria 1621
256 Ga0501077_0000660 3300049593 Bacteria 20858
257 Ga0501077_0019198 3300049593 Bacteria 4323
258 Ga0501077_0237528 3300049593 Bacteria 1158
259 Ga0501079_0086651 3300049741 Bacteria 2424
260 Ga0501079_0151113 3300049741 Bacteria 1810
261 Ga0501080_0048468 3300049742 Bacteria 3954
262 Ga0501081_0000902 3300049743 Bacteria 17624
263 Ga0501081_0032471 3300049743 Bacteria 3542
264 Ga0501081_0039240 3300049743 Bacteria 3240
265 Ga0501083_0035399 3300049744 Bacteria 3411
266 Ga0501035_0008500 3300049822 Bacteria 9560
267 Ga0501045_0004976 3300049824 Bacteria 9207
268 Ga0501045_0035773 3300049824 Bacteria 3606
269 Ga0501045_0194440 3300049824 Bacteria 1512
270 nmdc:mga05p37_1692_c1 3300050507 Bacteria 25679
271 nmdc:mga05p37_243364_c1 3300050507 Unclassified 2161
272 nmdc:mga05p37_2808_c2 3300050507 Bacteria 3156
273 nmdc:mga05p37_886_c1 3300050507 Bacteria 33754
274 nmdc:mga09592_58434_c1 3300050508 Bacteria 3261
275 nmdc:mga09592_59474_c1 3300050508 Bacteria 3230
276 nmdc:mga0qj67_34679_c2 3300050509 Bacteria 2139
277 nmdc:mga0qj67_368884_c1 3300050509 Bacteria 1160
278 nmdc:mga06r32_954_c1 3300050510 Bacteria 25807
279 nmdc:mga08y16_103280_c1 3300050511 Bacteria 2968
280 nmdc:mga08y16_137816_c1 3300050511 Bacteria 2537
281 nmdc:mga08y16_204905_c1 3300050511 Bacteria 2044
282 nmdc:mga08y16_277_c1 3300050511 Bacteria 46585
283 nmdc:mga08y16_33457_c1 3300050511 Bacteria 5399
284 nmdc:mga0n895_117992_c1 3300050512 Bacteria 2673
285 nmdc:mga0n895_536030_c1 3300050512 Bacteria 1177
286 nmdc:mga0a205_314588_c1 3300050515 Bacteria 1437
287 Ga0500643_000177 3300053087 Bacteria 63023
288 Ga0500643_001857 3300053087 Bacteria 11522
289 Ga0500616_0000138 3300053153 Bacteria 124476
290 Ga0501084_0001663 3300054114 Bacteria 17670
291 Ga0501084_0055322 3300054114 Bacteria 3320
292 Ga0501084_0071239 3300054114 Bacteria 2911
293 Ga0501082_0000887 3300060353 Bacteria 26433
294 Ga0501082_0229612 3300060353 Bacteria 1615
295 Ga0530510_0000791 3300061734 Bacteria 20599
296 2516021478 2515154189 Bacteria 9629850
297 2883094267 2883087390 Bacteria 9532701
298 2885274612 2885270888 Bacteria 9831543
299 2939636622 2939631187 Bacteria 6118131
300 Ga0065707_10000575
301 Ga0055540_1017294
302 Ga0065712_10189341
303 Ga0070658_10049034
304 Ga0070676_10028664
305 Ga0070676_10104285
306 Ga0070690_100000398
307 Ga0070690_100006533
308 Ga0068869_100001796
309 Ga0068869_100207381
310 Ga0070680_100001167
311 Ga0070680_100032528
312 Ga0070680_100087305
313 Ga0068868_100005562
314 Ga0070689_100000188
315 Ga0070689_100046035
316 Ga0070691_10001176
317 Ga0070687_100000069
318 Ga0070692_10001429
319 Ga0070668_100070286
320 Ga0070669_100059581
321 Ga0070671_100016195
322 Ga0070674_100010247
323 Ga0070673_100077430
324 Ga0070659_100163169
325 Ga0070659_100272107
326 Ga0070703_10011210
327 Ga0070701_10000603
328 Ga0070705_100001149
329 Ga0070705_100021227
330 Ga0070700_100008466
331 Ga0070700_100087590
332 Ga0070694_100001966
333 Ga0070694_100049161
334 Ga0070681_10004879
335 Ga0070681_10017563
336 Ga0068867_100000296
337 Ga0070679_100035619
338 Ga0070697_100037326
339 Ga0068853_100136533
340 Ga0070672_100024194
341 Ga0070686_100000090
342 Ga0070695_100000188
343 Ga0070696_100000719
344 Ga0070693_100000525
345 Ga0070704_100000168
346 Ga0068855_100000833
347 Ga0068854_100000657
348 Ga0068856_100003103
349 Ga0070702_100000002
350 Ga0068859_100000195
351 Ga0068866_10002071
352 Ga0068861_100000043
353 Ga0068870_10045442
354 Ga0068863_100246843
355 Ga0068858_100005138
356 Ga0068860_100002559
357 Ga0068862_100002188
358 Ga0068862_100058984
359 Ga0075362_10074053
360 Ga0097621_100000045
361 Ga0068871_100000040
362 Ga0075428_100000047
363 Ga0075428_100004780
364 Ga0075430_100019382
365 Ga0075430_100035024
366 Ga0075431_100000582
367 Ga0075431_100307623
368 Ga0075434_100047891
369 Ga0075434_100418020
370 Ga0075429_100000067
371 Ga0068865_100001956
372 Ga0097620_100000195
373 Ga0111539_10005836
374 Ga0111539_10193777
375 Ga0111539_10320706
376 Ga0111539_10580658
377 Ga0105245_10000306
378 Ga0105247_10074178
379 Ga0114129_10000040
380 Ga0114129_10002403
381 Ga0114129_10184987
382 Ga0114129_10569817
383 Ga0105243_10000035
384 Ga0105243_10002936
385 Ga0105241_10047589
386 Ga0105242_10004996
387 Ga0105242_10254787
388 Ga0105248_10168745
389 Ga0105248_10848119
390 Ga0105239_10046556
391 Ga0105239_10116528
392 Ga0157370_10024681
393 Ga0157369_10001813
394 Ga0157369_10211728
395 Ga0157374_10008199
396 Ga0157378_10001996
397 Ga0163162_10051390
398 Ga0163162_10343532
399 Ga0157372_10167539
400 Ga0163163_10386365
401 Ga0157380_10008319
402 Ga0157377_10016093
403 Ga0157379_10080837
404 Ga0157376_10000403
405 Ga0207653_10015259
406 Ga0207688_10019059
407 Ga0207680_10179880
408 Ga0207643_10056566
409 Ga0207654_10055934
410 Ga0207707_10005644
411 Ga0207707_10019758
412 Ga0207660_10006506
413 Ga0207660_10180201
414 Ga0207662_10000006
415 Ga0207652_10015854
416 Ga0207681_10023390
417 Ga0207681_10039996
418 Ga0207687_10003249
419 Ga0207644_10148063
420 Ga0207706_10058499
421 Ga0207709_10001302
422 Ga0207670_10001617
423 Ga0207670_10113181
424 Ga0207670_10114892
425 Ga0207704_10001570
426 Ga0207711_10086817
427 Ga0207689_10000082
428 Ga0207689_10010692
429 Ga0207651_10076516
430 Ga0207677_10005887
431 Ga0207708_10000936
432 Ga0207708_10091694
433 Ga0207702_10014977
434 Ga0207648_10000316
435 Ga0207648_10007668
436 Ga0207674_10105562
437 Ga0207675_100000064
438 Ga0207698_10386749
439 Ga0207698_10437698
440 Ga0207428_10000179
441 Ga0207428_10002474
442 Ga0207428_10093386
443 Ga0207428_10206473
444 Ga0268266_10152120
445 Ga0268265_10006971
446 Ga0268265_10194377
447 Ga0268264_10001394
448 Ga0307416_100055010
449 Ga0307416_100087670
450 Ga0373928_0009916
451 Ga0373944_0001341
452 Ga0373949_0012075
453 Ga0373952_0045540
454 Ga0373932_0022312
455 Ga0373936_0017525
456 Ga0373945_0131610
457 Ga0373954_0000020
458 Ga0373960_0026711
459 Ga0373943_0008956
460 Ga0373924_0011512
461 Ga0373931_0008696
462 Ga0373935_0036176
463 Ga0373935_0151814
464 Ga0373933_0010314
465 Ga0373947_0058989
466 Ga0373937_0005040
467 Ga0395899_0008336
468 Ga0395905_0015055
469 Ga0436365_0116235
470 Ga0436361_0603703
471 Ga0436361_1035107
472 Ga0436363_1682763
473 Ga0450893_0001123
474 Ga0451577_0085560
475 Ga0466963_0017883
476 Ga0466957_0127854
477 Ga0466957_0161098
478 Ga0451576_0000822
479 Ga0495592_0032564
480 Ga0495603_0027911
481 Ga0495580_0006345
482 Ga0495580_0036583
483 Ga0495582_0088373
484 Ga0495639_0014295
485 Ga0495662_0065342
486 Ga0495608_0074354
487 Ga0495618_0084073
488 Ga0495628_0093496
489 Ga0495630_0061608
490 Ga0495630_0329877
491 Ga0495640_0015695
492 Ga0495586_0029197
493 Ga0495586_0074213
494 Ga0495667_0232020
495 Ga0495635_0014382
496 Ga0495635_0075762
497 Ga0495635_0092168
498 Ga0495657_0034527
499 Ga0495599_0031900
500 Ga0495647_0014461
501 Ga0495669_0101650
502 Ga0495613_0020868
503 Ga0495624_0018663
504 Ga0495581_0133724
505 Ga0495636_0002166
506 Ga0495676_0096834
507 Ga0495680_0011171
508 Ga0495675_0106550
509 Ga0495602_0209505
510 Ga0495602_0497750
511 Ga0496100_0027048
512 Ga0496101_0063870
513 Ga0496101_0262587
514 Ga0496104_0023670
515 Ga0496104_0032457
516 Ga0496104_0114441
517 Ga0496105_0033081
518 Ga0496106_0142583
519 Ga0496108_0051936
520 Ga0496109_0073585
521 Ga0496109_0126678
522 Ga0501033_0024251
523 Ga0501036_0019015
524 Ga0501037_0243728
525 Ga0501037_0243956
526 Ga0501038_0001055
527 Ga0501039_0023886
528 Ga0501039_0089980
529 Ga0501039_0169009
530 Ga0501039_0217107
531 Ga0501039_0320639
532 Ga0501040_0000430
533 Ga0501041_0001076
534 Ga0501042_0004555
535 Ga0501042_0033357
536 Ga0501046_0002338
537 Ga0501046_0039509
538 Ga0501046_0245589
539 Ga0501046_0284443
540 Ga0501048_0000190
541 Ga0501048_0233746
542 Ga0501068_0136198
543 Ga0501071_0001593
544 Ga0501072_0000900
545 Ga0501072_0056116
546 Ga0501072_0146941
547 Ga0501073_0503408
548 Ga0501075_0003935
549 Ga0501075_0119385
550 Ga0501075_0158893
551 Ga0501075_0518410
552 Ga0501076_0000440
553 Ga0501076_0096782
554 Ga0501076_0202459
555 Ga0501077_0000660
556 Ga0501077_0019198
557 Ga0501077_0237528
558 Ga0501079_0086651
559 Ga0501079_0151113
560 Ga0501080_0048468
561 Ga0501081_0000902
562 Ga0501081_0032471
563 Ga0501081_0039240
564 Ga0501083_0035399
565 Ga0501035_0008500
566 Ga0501045_0004976
567 Ga0501045_0035773
568 Ga0501045_0194440
569 nmdc:mga05p37_1692_c1
570 nmdc:mga05p37_243364_c1
571 nmdc:mga05p37_2808_c2
572 nmdc:mga05p37_886_c1
573 nmdc:mga09592_58434_c1
574 nmdc:mga09592_59474_c1
575 nmdc:mga0qj67_34679_c2
576 nmdc:mga0qj67_368884_c1
577 nmdc:mga06r32_954_c1
578 nmdc:mga08y16_103280_c1
579 nmdc:mga08y16_137816_c1
580 nmdc:mga08y16_204905_c1
581 nmdc:mga08y16_277_c1
582 nmdc:mga08y16_33457_c1
583 nmdc:mga0n895_117992_c1
584 nmdc:mga0n895_536030_c1
585 nmdc:mga0a205_314588_c1
586 Ga0500643_000177
587 Ga0500643_001857
588 Ga0500616_0000138
589 Ga0501084_0001663
590 Ga0501084_0055322
591 Ga0501084_0071239
592 Ga0501082_0000887
593 Ga0501082_0229612
594 Ga0530510_0000791
595 2516021478
596 2883094267
597 2885274612
598 2939636622

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04909

Amidohydro_2

Amidohydrolase

55

379

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lal-assembly1.cif.gz_B crystal structure of cordyceps militaris idcase d323a mutant in complex with 5-carboxyl-uracil 0.9043 1 325
7pwy-assembly2.cif.gz_C structure of human dimeric acmsd in complex with the inhibitor tes-1025 0.9012 4 326
4lal-assembly1.cif.gz_B crystal structure of cordyceps militaris idcase d323a mutant in complex with 5-carboxyl-uracil 0.8991 1 325
4hk7-assembly1.cif.gz_C crystal structure of cordyceps militaris idcase in complex with uracil 0.8959 2 325
4ofc-assembly1.cif.gz_A 2.0 angstroms x-ray crystal structure of human 2-amino-3-carboxymuconate-6-semialdehye decarboxylase 0.8946 4 326
ID Description Score Start End Superfamily
4eraA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8929 1 325 3.20.20.140
4lalD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8927 1 325 3.20.20.140
4ofcD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8923 1 326 3.20.20.140
4ofcD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8897 1 326 3.20.20.140
4eraA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8877 1 325 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A4Q3QGY9-F1-model_v4 deleted 0.9972 1 117
AF-A0A7W8SM01-F1-model_v4 Putative TIM-barrel fold metal-dependent hydrolase 0.9925 139 322 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A4Q3QGY9-F1-model_v4 deleted 0.9888 1 117
AF-A0A4Q3N836-F1-model_v4 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase 0.9885 1 176 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A536ZBB5-F1-model_v4 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase 0.9881 1 226 GO:0005737
GO:0016787
GO:0016831
GO:0019748

Map