F394529
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 298 | 137 | 298 | 153 |
Family's Representative Sequence
| Representative Sequence | 3300049823|Ga0501044_0232282|Ga0501044_0232282_1098_1661 |
| Length | 187 |
| Sequence | MAGLDPAIQRNKESFFARMREDWMAASRAAMTIDEMTETLFYHLERRALEDVLPKLVEKSLERGWRALIRCESAERAEAIDTLLWTYDEESFLPHAAHGDGEAERQPVLITVEPGNANAAQALFLVGAAAPLDWTGYDDFVRVVLIFDGRDAGAEETALRSLEKARSFGHEVKYYRQTPGGKFQLQG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 13 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 15 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 17 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 18 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 19 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 20 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 21 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 23 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 24 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 25 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 26 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 44 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 45 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 46 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 76 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 77 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 78 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 79 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 80 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 81 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 82 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 83 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 84 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 85 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 86 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 87 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 88 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 89 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 90 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 91 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 92 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 93 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 108 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 109 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 110 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 111 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 112 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 113 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 114 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 115 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 116 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 117 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 118 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 119 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 120 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 121 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 122 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 123 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 124 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 125 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 126 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 127 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 128 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 129 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 130 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 131 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 132 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 133 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 134 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 135 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 136 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 137 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.35 |
| Nodule | 0 |
| Rhizoplane | 0.34 |
| Rhizosphere | 95.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1000425 | 3300003214 | Bacteria | 43589 |
| 2 | Ga0070658_10086366 | 3300005327 | Bacteria | 2580 |
| 3 | Ga0070658_10149498 | 3300005327 | Bacteria | 1955 |
| 4 | Ga0070658_10231740 | 3300005327 | Bacteria | 1564 |
| 5 | Ga0070690_100194418 | 3300005330 | Bacteria | 1408 |
| 6 | Ga0068869_100430244 | 3300005334 | Bacteria | 1090 |
| 7 | Ga0070680_100001355 | 3300005336 | Bacteria | 17727 |
| 8 | Ga0070680_100118191 | 3300005336 | Bacteria | 2211 |
| 9 | Ga0070660_100499214 | 3300005339 | Bacteria | 1012 |
| 10 | Ga0070660_101355176 | 3300005339 | Unclassified | 604 |
| 11 | Ga0070661_101014684 | 3300005344 | Unclassified | 689 |
| 12 | Ga0070675_100447508 | 3300005354 | Unclassified | 1158 |
| 13 | Ga0070714_100057904 | 3300005435 | Bacteria | 3318 |
| 14 | Ga0070714_100576244 | 3300005435 | Bacteria | 1079 |
| 15 | Ga0070662_100200763 | 3300005457 | Bacteria | 1582 |
| 16 | Ga0070681_10000005 | 3300005458 | Bacteria | 183053 |
| 17 | Ga0070681_10191647 | 3300005458 | Bacteria | 1964 |
| 18 | Ga0070681_10393124 | 3300005458 | Bacteria | 1297 |
| 19 | Ga0070681_10832131 | 3300005458 | Bacteria | 840 |
| 20 | Ga0068867_100003555 | 3300005459 | Bacteria | 10959 |
| 21 | Ga0070679_100001521 | 3300005530 | Bacteria | 20655 |
| 22 | Ga0070679_100070930 | 3300005530 | Bacteria | 3475 |
| 23 | Ga0070679_100143110 | 3300005530 | Bacteria | 2370 |
| 24 | Ga0070679_100375117 | 3300005530 | Bacteria | 1369 |
| 25 | Ga0068853_100122296 | 3300005539 | Bacteria | 2323 |
| 26 | Ga0068853_100158473 | 3300005539 | Bacteria | 2041 |
| 27 | Ga0068853_100613121 | 3300005539 | Bacteria | 1034 |
| 28 | Ga0070665_100058811 | 3300005548 | Bacteria | 3853 |
| 29 | Ga0068855_100006736 | 3300005563 | Bacteria | 13932 |
| 30 | Ga0068855_100034186 | 3300005563 | Bacteria | 6064 |
| 31 | Ga0068855_100039866 | 3300005563 | Bacteria | 5575 |
| 32 | Ga0068855_100650804 | 3300005563 | Bacteria | 1132 |
| 33 | Ga0068857_100059950 | 3300005577 | Bacteria | 3381 |
| 34 | Ga0068857_100177864 | 3300005577 | Bacteria | 1936 |
| 35 | Ga0068857_100274910 | 3300005577 | Bacteria | 1549 |
| 36 | Ga0068856_100235108 | 3300005614 | Bacteria | 1848 |
| 37 | Ga0068852_100292817 | 3300005616 | Bacteria | 1573 |
| 38 | Ga0068864_101373559 | 3300005618 | Unclassified | 708 |
| 39 | Ga0070712_100107711 | 3300006175 | Bacteria | 2074 |
| 40 | Ga0070712_100670702 | 3300006175 | Bacteria | 882 |
| 41 | Ga0097621_100225156 | 3300006237 | Bacteria | 1635 |
| 42 | Ga0068865_100058192 | 3300006881 | Bacteria | 2699 |
| 43 | Ga0099795_10044132 | 3300007788 | Unclassified | 1598 |
| 44 | Ga0105240_10020640 | 3300009093 | Bacteria | 8781 |
| 45 | Ga0105240_10051773 | 3300009093 | Bacteria | 5165 |
| 46 | Ga0105240_10091482 | 3300009093 | Bacteria | 3717 |
| 47 | Ga0105240_10097689 | 3300009093 | Bacteria | 3578 |
| 48 | Ga0105240_10510645 | 3300009093 | Unclassified | 1335 |
| 49 | Ga0105240_10621964 | 3300009093 | Unclassified | 1187 |
| 50 | Ga0105240_10648063 | 3300009093 | Bacteria | 1158 |
| 51 | Ga0105240_10920820 | 3300009093 | Bacteria | 939 |
| 52 | Ga0105245_10835704 | 3300009098 | Unclassified | 960 |
| 53 | Ga0105243_10001995 | 3300009148 | Bacteria | 17370 |
| 54 | Ga0105241_10082541 | 3300009174 | Bacteria | 2519 |
| 55 | Ga0105241_10343966 | 3300009174 | Unclassified | 1293 |
| 56 | Ga0105241_10346822 | 3300009174 | Bacteria | 1288 |
| 57 | Ga0105242_10005119 | 3300009176 | Bacteria | 10111 |
| 58 | Ga0105248_10000001 | 3300009177 | Bacteria | 1881304 |
| 59 | Ga0105248_13328628 | 3300009177 | Bacteria | 511 |
| 60 | Ga0105237_10009725 | 3300009545 | Bacteria | 10288 |
| 61 | Ga0105237_10060450 | 3300009545 | Bacteria | 3791 |
| 62 | Ga0105237_10076531 | 3300009545 | Bacteria | 3337 |
| 63 | Ga0105237_10548351 | 3300009545 | Bacteria | 1163 |
| 64 | Ga0105237_10786874 | 3300009545 | Unclassified | 958 |
| 65 | Ga0105238_10076122 | 3300009551 | Bacteria | 3347 |
| 66 | Ga0105238_10090912 | 3300009551 | Bacteria | 3040 |
| 67 | Ga0105238_10165465 | 3300009551 | Bacteria | 2187 |
| 68 | Ga0105238_10211596 | 3300009551 | Bacteria | 1915 |
| 69 | Ga0105238_10235849 | 3300009551 | Bacteria | 1807 |
| 70 | Ga0105238_10285080 | 3300009551 | Bacteria | 1633 |
| 71 | Ga0105238_11620901 | 3300009551 | Unclassified | 677 |
| 72 | Ga0105238_11780110 | 3300009551 | Bacteria | 648 |
| 73 | Ga0105239_10001205 | 3300010375 | Bacteria | 35322 |
| 74 | Ga0105239_10007247 | 3300010375 | Bacteria | 12738 |
| 75 | Ga0105239_10028624 | 3300010375 | Bacteria | 6126 |
| 76 | Ga0105239_10059716 | 3300010375 | Bacteria | 4185 |
| 77 | Ga0105239_10129598 | 3300010375 | Bacteria | 2805 |
| 78 | Ga0105239_10557107 | 3300010375 | Bacteria | 1306 |
| 79 | Ga0105239_10620183 | 3300010375 | Bacteria | 1234 |
| 80 | Ga0105239_10786906 | 3300010375 | Bacteria | 1090 |
| 81 | Ga0105239_11743092 | 3300010375 | Unclassified | 721 |
| 82 | Ga0157370_10208258 | 3300013104 | Bacteria | 1813 |
| 83 | Ga0157370_10609790 | 3300013104 | Bacteria | 999 |
| 84 | Ga0157369_10084863 | 3300013105 | Bacteria | 3384 |
| 85 | Ga0157369_10114041 | 3300013105 | Unclassified | 2871 |
| 86 | Ga0157369_10178107 | 3300013105 | Bacteria | 2238 |
| 87 | Ga0157369_10736280 | 3300013105 | Unclassified | 1015 |
| 88 | Ga0157374_10759273 | 3300013296 | Bacteria | 985 |
| 89 | Ga0157378_10205773 | 3300013297 | Bacteria | 1864 |
| 90 | Ga0163162_11008041 | 3300013306 | Unclassified | 942 |
| 91 | Ga0157372_10029344 | 3300013307 | Bacteria | 6005 |
| 92 | Ga0157379_10001491 | 3300014968 | Bacteria | 19265 |
| 93 | Ga0157376_10156867 | 3300014969 | Bacteria | 2059 |
| 94 | Ga0163161_10783627 | 3300017792 | Unclassified | 800 |
| 95 | Ga0213876_10000180 | 3300021384 | Bacteria | 65389 |
| 96 | Ga0207427_108995 | 3300025231 | Bacteria | 1089 |
| 97 | Ga0209233_1000013 | 3300025261 | Bacteria | 1013785 |
| 98 | Ga0207688_10046842 | 3300025901 | Bacteria | 2414 |
| 99 | Ga0207645_10252398 | 3300025907 | Bacteria | 1167 |
| 100 | Ga0207643_10032728 | 3300025908 | Bacteria | 2905 |
| 101 | Ga0207705_10021616 | 3300025909 | Bacteria | 4592 |
| 102 | Ga0207705_10202204 | 3300025909 | Bacteria | 1505 |
| 103 | Ga0207707_10000005 | 3300025912 | Bacteria | 382024 |
| 104 | Ga0207707_10189304 | 3300025912 | Bacteria | 1795 |
| 105 | Ga0207707_10225575 | 3300025912 | Bacteria | 1631 |
| 106 | Ga0207695_10005412 | 3300025913 | Bacteria | 16939 |
| 107 | Ga0207695_10035209 | 3300025913 | Bacteria | 5433 |
| 108 | Ga0207695_10157622 | 3300025913 | Bacteria | 2204 |
| 109 | Ga0207695_10159565 | 3300025913 | Bacteria | 2188 |
| 110 | Ga0207695_10159887 | 3300025913 | Unclassified | 2185 |
| 111 | Ga0207695_10439511 | 3300025913 | Bacteria | 1188 |
| 112 | Ga0207671_10008389 | 3300025914 | Bacteria | 8770 |
| 113 | Ga0207671_10024795 | 3300025914 | Bacteria | 4507 |
| 114 | Ga0207671_10249444 | 3300025914 | Bacteria | 1395 |
| 115 | Ga0207671_10442926 | 3300025914 | Bacteria | 1034 |
| 116 | Ga0207693_10121571 | 3300025915 | Bacteria | 2051 |
| 117 | Ga0207660_10000540 | 3300025917 | Bacteria | 25362 |
| 118 | Ga0207660_10018036 | 3300025917 | Bacteria | 4700 |
| 119 | Ga0207657_10141642 | 3300025919 | Bacteria | 1964 |
| 120 | Ga0207649_10016755 | 3300025920 | Bacteria | 4142 |
| 121 | Ga0207652_10114524 | 3300025921 | Unclassified | 2394 |
| 122 | Ga0207652_10511556 | 3300025921 | Bacteria | 1080 |
| 123 | Ga0207652_10593565 | 3300025921 | Bacteria | 993 |
| 124 | Ga0207694_10101336 | 3300025924 | Bacteria | 2282 |
| 125 | Ga0207694_10533734 | 3300025924 | Bacteria | 984 |
| 126 | Ga0207694_10537833 | 3300025924 | Unclassified | 980 |
| 127 | Ga0207694_11105616 | 3300025924 | Bacteria | 671 |
| 128 | Ga0207659_10189389 | 3300025926 | Unclassified | 1636 |
| 129 | Ga0207664_10071796 | 3300025929 | Bacteria | 2790 |
| 130 | Ga0207664_10481337 | 3300025929 | Bacteria | 1110 |
| 131 | Ga0207706_10240726 | 3300025933 | Bacteria | 1582 |
| 132 | Ga0207709_10004305 | 3300025935 | Bacteria | 8247 |
| 133 | Ga0207704_10551132 | 3300025938 | Bacteria | 937 |
| 134 | Ga0207711_10000002 | 3300025941 | Bacteria | 1228676 |
| 135 | Ga0207689_10022240 | 3300025942 | Bacteria | 5331 |
| 136 | Ga0207689_10081556 | 3300025942 | Bacteria | 2659 |
| 137 | Ga0207667_10010491 | 3300025949 | Bacteria | 10830 |
| 138 | Ga0207667_10379105 | 3300025949 | Bacteria | 1441 |
| 139 | Ga0207667_10649812 | 3300025949 | Bacteria | 1060 |
| 140 | Ga0207703_11774989 | 3300026035 | Unclassified | 593 |
| 141 | Ga0207639_10033222 | 3300026041 | Bacteria | 3804 |
| 142 | Ga0207639_10254994 | 3300026041 | Bacteria | 1531 |
| 143 | Ga0207639_10504658 | 3300026041 | Bacteria | 1106 |
| 144 | Ga0207678_10362349 | 3300026067 | Bacteria | 1251 |
| 145 | Ga0207648_10004006 | 3300026089 | Bacteria | 15291 |
| 146 | Ga0207648_10131069 | 3300026089 | Bacteria | 2207 |
| 147 | Ga0207648_11149692 | 3300026089 | Unclassified | 728 |
| 148 | Ga0207674_10028224 | 3300026116 | Bacteria | 5926 |
| 149 | Ga0207674_10086040 | 3300026116 | Bacteria | 3138 |
| 150 | Ga0207674_10981698 | 3300026116 | Unclassified | 813 |
| 151 | Ga0207675_100543459 | 3300026118 | Bacteria | 1160 |
| 152 | Ga0207698_10080851 | 3300026142 | Bacteria | 2620 |
| 153 | Ga0207698_11099639 | 3300026142 | Bacteria | 808 |
| 154 | Ga0268266_11046642 | 3300028379 | Unclassified | 790 |
| 155 | Ga0265337_1000513 | 3300028556 | Bacteria | 20652 |
| 156 | Ga0265338_10030321 | 3300028800 | Bacteria | 5331 |
| 157 | Ga0265338_10125184 | 3300028800 | Bacteria | 2040 |
| 158 | Ga0265338_10253983 | 3300028800 | Bacteria | 1296 |
| 159 | Ga0265325_10001516 | 3300031241 | Bacteria | 16323 |
| 160 | Ga0265340_10000215 | 3300031247 | Bacteria | 29446 |
| 161 | Ga0265340_10073381 | 3300031247 | Bacteria | 1619 |
| 162 | Ga0265340_10197652 | 3300031247 | Bacteria | 905 |
| 163 | Ga0265340_10303075 | 3300031247 | Bacteria | 708 |
| 164 | Ga0265339_10038915 | 3300031249 | Bacteria | 2650 |
| 165 | Ga0265339_10049735 | 3300031249 | Bacteria | 2294 |
| 166 | Ga0265339_10220671 | 3300031249 | Bacteria | 927 |
| 167 | Ga0265316_10053000 | 3300031344 | Bacteria | 3180 |
| 168 | Ga0265316_10500296 | 3300031344 | Bacteria | 868 |
| 169 | Ga0265316_10809650 | 3300031344 | Unclassified | 657 |
| 170 | Ga0265313_10051268 | 3300031595 | Bacteria | 1975 |
| 171 | Ga0265313_10077084 | 3300031595 | Bacteria | 1522 |
| 172 | Ga0265314_10043072 | 3300031711 | Bacteria | 3213 |
| 173 | Ga0265314_10177500 | 3300031711 | Bacteria | 1280 |
| 174 | Ga0265314_10373234 | 3300031711 | Bacteria | 778 |
| 175 | Ga0265314_10448642 | 3300031711 | Bacteria | 687 |
| 176 | Ga0265342_10133248 | 3300031712 | Bacteria | 1391 |
| 177 | Ga0373927_0070243 | 3300035695 | Bacteria | 2267 |
| 178 | Ga0373927_0408421 | 3300035695 | Unclassified | 896 |
| 179 | Ga0373947_0286337 | 3300035725 | Bacteria | 1096 |
| 180 | Ga0373925_0379913 | 3300037068 | Bacteria | 1150 |
| 181 | Ga0395899_0069585 | 3300037312 | Bacteria | 2577 |
| 182 | Ga0395900_0253559 | 3300037418 | Bacteria | 1760 |
| 183 | Ga0395898_0052836 | 3300037466 | Bacteria | 3969 |
| 184 | Ga0395901_0165876 | 3300038443 | Bacteria | 2319 |
| 185 | Ga0436365_0104999 | 3300039437 | Bacteria | 1222 |
| 186 | Ga0436365_0508484 | 3300039437 | Bacteria | 190091 |
| 187 | Ga0436365_1793097 | 3300039437 | Bacteria | 641 |
| 188 | Ga0436362_0439111 | 3300039453 | Bacteria | 519 |
| 189 | Ga0495592_0185887 | 3300046454 | Bacteria | 1412 |
| 190 | Ga0495662_0127152 | 3300046476 | Bacteria | 1252 |
| 191 | Ga0495664_0365424 | 3300046477 | Bacteria | 868 |
| 192 | Ga0495664_0483774 | 3300046477 | Unclassified | 740 |
| 193 | Ga0495664_0770605 | 3300046477 | Unclassified | 566 |
| 194 | Ga0495628_0242851 | 3300046516 | Bacteria | 1347 |
| 195 | Ga0495630_0905890 | 3300046517 | Unclassified | 672 |
| 196 | Ga0495652_0228415 | 3300046529 | Bacteria | 1394 |
| 197 | Ga0495587_0023844 | 3300046536 | Bacteria | 3757 |
| 198 | Ga0495645_0245208 | 3300046543 | Bacteria | 1193 |
| 199 | Ga0495599_0294086 | 3300046678 | Unclassified | 981 |
| 200 | Ga0495624_0236022 | 3300046690 | Bacteria | 1107 |
| 201 | Ga0495670_0374626 | 3300046691 | Unclassified | 768 |
| 202 | Ga0495675_0043451 | 3300047444 | Unclassified | 2863 |
| 203 | Ga0495593_0546291 | 3300047673 | Unclassified | 581 |
| 204 | Ga0495602_0026069 | 3300048088 | Bacteria | 5646 |
| 205 | Ga0496100_1410887 | 3300048903 | Unclassified | 550 |
| 206 | Ga0501032_0053015 | 3300049569 | Bacteria | 2732 |
| 207 | Ga0501032_0392620 | 3300049569 | Bacteria | 892 |
| 208 | Ga0501032_0432547 | 3300049569 | Bacteria | 844 |
| 209 | Ga0501033_0023697 | 3300049570 | Bacteria | 4629 |
| 210 | Ga0501033_0045319 | 3300049570 | Bacteria | 3273 |
| 211 | Ga0501033_0087782 | 3300049570 | Bacteria | 2276 |
| 212 | Ga0501033_0104985 | 3300049570 | Bacteria | 2059 |
| 213 | Ga0501033_0203274 | 3300049570 | Bacteria | 1414 |
| 214 | Ga0501034_0042033 | 3300049571 | Bacteria | 4626 |
| 215 | Ga0501034_0098899 | 3300049571 | Bacteria | 2912 |
| 216 | Ga0501034_0232698 | 3300049571 | Bacteria | 1791 |
| 217 | Ga0501034_0243456 | 3300049571 | Bacteria | 1744 |
| 218 | Ga0501034_0465722 | 3300049571 | Bacteria | 1180 |
| 219 | Ga0501034_0589692 | 3300049571 | Bacteria | 1018 |
| 220 | Ga0501036_0171580 | 3300049572 | Bacteria | 1827 |
| 221 | Ga0501036_0359249 | 3300049572 | Bacteria | 1216 |
| 222 | Ga0501036_0725312 | 3300049572 | Bacteria | 821 |
| 223 | Ga0501037_0031335 | 3300049573 | Bacteria | 3925 |
| 224 | Ga0501038_0102140 | 3300049574 | Bacteria | 2386 |
| 225 | Ga0501039_0042977 | 3300049575 | Bacteria | 3491 |
| 226 | Ga0501039_0691032 | 3300049575 | Unclassified | 798 |
| 227 | Ga0501042_0004549 | 3300049578 | Bacteria | 8850 |
| 228 | Ga0501043_0024278 | 3300049579 | Bacteria | 4757 |
| 229 | Ga0501043_0252840 | 3300049579 | Bacteria | 1357 |
| 230 | Ga0501043_0478650 | 3300049579 | Bacteria | 932 |
| 231 | Ga0501043_0812080 | 3300049579 | Bacteria | 676 |
| 232 | Ga0501046_0014609 | 3300049580 | Bacteria | 6616 |
| 233 | Ga0501046_0025719 | 3300049580 | Bacteria | 4814 |
| 234 | Ga0501046_0131324 | 3300049580 | Bacteria | 1900 |
| 235 | Ga0501046_0302592 | 3300049580 | Bacteria | 1168 |
| 236 | Ga0501047_0002210 | 3300049581 | Bacteria | 18637 |
| 237 | Ga0501047_0005989 | 3300049581 | Bacteria | 11427 |
| 238 | Ga0501047_0006743 | 3300049581 | Bacteria | 10794 |
| 239 | Ga0501047_0040198 | 3300049581 | Bacteria | 4524 |
| 240 | Ga0501047_0048151 | 3300049581 | Bacteria | 4116 |
| 241 | Ga0501047_0063299 | 3300049581 | Bacteria | 3568 |
| 242 | Ga0501047_0166791 | 3300049581 | Bacteria | 2072 |
| 243 | Ga0501047_0278875 | 3300049581 | Bacteria | 1516 |
| 244 | Ga0501047_0339539 | 3300049581 | Bacteria | 1340 |
| 245 | Ga0501047_0541956 | 3300049581 | Unclassified | 988 |
| 246 | Ga0501047_1013721 | 3300049581 | Unclassified | 643 |
| 247 | Ga0501048_0074300 | 3300049582 | Bacteria | 2398 |
| 248 | Ga0501067_0008182 | 3300049583 | Bacteria | 5808 |
| 249 | Ga0501067_0121253 | 3300049583 | Bacteria | 1455 |
| 250 | Ga0501068_0086806 | 3300049584 | Bacteria | 1926 |
| 251 | Ga0501070_0059594 | 3300049586 | Bacteria | 3164 |
| 252 | Ga0501070_0141120 | 3300049586 | Bacteria | 1989 |
| 253 | Ga0501070_0155299 | 3300049586 | Bacteria | 1887 |
| 254 | Ga0501070_0234676 | 3300049586 | Bacteria | 1502 |
| 255 | Ga0501072_0001422 | 3300049588 | Bacteria | 17958 |
| 256 | Ga0501073_0005612 | 3300049589 | Bacteria | 9387 |
| 257 | Ga0501073_0076010 | 3300049589 | Bacteria | 2337 |
| 258 | Ga0501073_0224318 | 3300049589 | Unclassified | 1298 |
| 259 | Ga0501074_0073632 | 3300049590 | Bacteria | 2453 |
| 260 | Ga0501074_0100368 | 3300049590 | Bacteria | 2072 |
| 261 | Ga0501074_0146172 | 3300049590 | Bacteria | 1690 |
| 262 | Ga0501079_0253164 | 3300049741 | Unclassified | 1376 |
| 263 | Ga0501079_0313159 | 3300049741 | Bacteria | 1228 |
| 264 | Ga0501080_0017229 | 3300049742 | Bacteria | 6675 |
| 265 | Ga0501080_0018541 | 3300049742 | Bacteria | 6438 |
| 266 | Ga0501080_0125277 | 3300049742 | Bacteria | 2379 |
| 267 | Ga0501080_0403147 | 3300049742 | Bacteria | 1230 |
| 268 | Ga0501080_0565771 | 3300049742 | Bacteria | 1011 |
| 269 | Ga0501080_0605286 | 3300049742 | Bacteria | 972 |
| 270 | Ga0501080_0609500 | 3300049742 | Bacteria | 969 |
| 271 | Ga0501080_0621090 | 3300049742 | Unclassified | 958 |
| 272 | Ga0501080_1259477 | 3300049742 | Unclassified | 634 |
| 273 | Ga0501083_0444345 | 3300049744 | Bacteria | 844 |
| 274 | Ga0501035_0006183 | 3300049822 | Bacteria | 11269 |
| 275 | Ga0501035_0129469 | 3300049822 | Bacteria | 2201 |
| 276 | Ga0501035_0574307 | 3300049822 | Unclassified | 921 |
| 277 | Ga0501044_0005565 | 3300049823 | Bacteria | 13985 |
| 278 | Ga0501044_0010411 | 3300049823 | Bacteria | 10091 |
| 279 | Ga0501044_0026121 | 3300049823 | Bacteria | 6184 |
| 280 | Ga0501044_0052538 | 3300049823 | Bacteria | 4198 |
| 281 | Ga0501044_0100829 | 3300049823 | Bacteria | 2905 |
| 282 | Ga0501044_0189793 | 3300049823 | Bacteria | 2018 |
| 283 | Ga0501044_0225307 | 3300049823 | Unclassified | 1824 |
| 284 | Ga0501044_0227314 | 3300049823 | Unclassified | 1815 |
| 285 | Ga0501044_0232282 | 3300049823 | Bacteria | 1791 |
| 286 | Ga0501044_0270416 | 3300049823 | Bacteria | 1635 |
| 287 | Ga0501044_0340278 | 3300049823 | Bacteria | 1421 |
| 288 | Ga0501044_0879799 | 3300049823 | Bacteria | 771 |
| 289 | Ga0501045_0075181 | 3300049824 | Bacteria | 2488 |
| 290 | Ga0500595_000303 | 3300053119 | Bacteria | 32415 |
| 291 | Ga0500559_0036390 | 3300053136 | Bacteria | 2129 |
| 292 | Ga0500573_0000003 | 3300053140 | Bacteria | 355643 |
| 293 | Ga0500619_000410 | 3300053154 | Bacteria | 7784 |
| 294 | Ga0501084_0038494 | 3300054114 | Bacteria | 3998 |
| 295 | Ga0501084_0157917 | 3300054114 | Bacteria | 1913 |
| 296 | Ga0501084_0163785 | 3300054114 | Bacteria | 1876 |
| 297 | Ga0501082_0009272 | 3300060353 | Bacteria | 8482 |
| 298 | Ga0501082_0482037 | 3300060353 | Bacteria | 1084 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031247 | Ga0265340_10073381 | Ga0265340_100733812 | 135 |
| 2 | 3300047673 | Ga0495593_0546291 | Ga0495593_0546291_22_438 | 136 |
| 3 | 3300005539 | Ga0068853_100613121 | Ga0068853_1006131212 | 137 |
| 4 | 3300005563 | Ga0068855_100650804 | Ga0068855_1006508041 | 137 |
| 5 | 3300009551 | Ga0105238_10235849 | Ga0105238_102358492 | 137 |
| 6 | 3300025924 | Ga0207694_10533734 | Ga0207694_105337342 | 137 |
| 7 | 3300025949 | Ga0207667_10379105 | Ga0207667_103791052 | 137 |
| 8 | 3300026041 | Ga0207639_10504658 | Ga0207639_105046582 | 137 |
| 9 | 3300005435 | Ga0070714_100576244 | Ga0070714_1005762442 | 151 |
| 10 | 3300021384 | Ga0213876_10000180 | Ga0213876_1000018048 | 151 |
| 11 | 3300025929 | Ga0207664_10481337 | Ga0207664_104813372 | 151 |
| 12 | 3300035695 | Ga0373927_0070243 | Ga0373927_0070243_1383_1844 | 151 |
| 13 | 3300039437 | Ga0436365_0508484 | Ga0436365_0508484_40114_40569 | 151 |
| 14 | 3300003214 | JGI25165J46597_1000425 | JGI25165J46597_100042513 | 152 |
| 15 | 3300005327 | Ga0070658_10086366 | Ga0070658_100863662 | 152 |
| 16 | 3300005327 | Ga0070658_10149498 | Ga0070658_101494983 | 152 |
| 17 | 3300005327 | Ga0070658_10231740 | Ga0070658_102317401 | 152 |
| 18 | 3300005330 | Ga0070690_100194418 | Ga0070690_1001944182 | 152 |
| 19 | 3300005334 | Ga0068869_100430244 | Ga0068869_1004302442 | 152 |
| 20 | 3300005336 | Ga0070680_100001355 | Ga0070680_10000135510 | 152 |
| 21 | 3300005336 | Ga0070680_100118191 | Ga0070680_1001181912 | 152 |
| 22 | 3300005339 | Ga0070660_100499214 | Ga0070660_1004992142 | 152 |
| 23 | 3300005339 | Ga0070660_101355176 | Ga0070660_1013551761 | 152 |
| 24 | 3300005344 | Ga0070661_101014684 | Ga0070661_1010146842 | 152 |
| 25 | 3300005354 | Ga0070675_100447508 | Ga0070675_1004475081 | 152 |
| 26 | 3300005435 | Ga0070714_100057904 | Ga0070714_1000579043 | 152 |
| 27 | 3300005457 | Ga0070662_100200763 | Ga0070662_1002007632 | 152 |
| 28 | 3300005458 | Ga0070681_10000005 | Ga0070681_1000000571 | 152 |
| 29 | 3300005458 | Ga0070681_10191647 | Ga0070681_101916473 | 152 |
| 30 | 3300005458 | Ga0070681_10393124 | Ga0070681_103931242 | 152 |
| 31 | 3300005458 | Ga0070681_10832131 | Ga0070681_108321312 | 152 |
| 32 | 3300005459 | Ga0068867_100003555 | Ga0068867_1000035558 | 152 |
| 33 | 3300005530 | Ga0070679_100001521 | Ga0070679_10000152110 | 152 |
| 34 | 3300005530 | Ga0070679_100070930 | Ga0070679_1000709303 | 152 |
| 35 | 3300005530 | Ga0070679_100143110 | Ga0070679_1001431103 | 152 |
| 36 | 3300005530 | Ga0070679_100375117 | Ga0070679_1003751172 | 152 |
| 37 | 3300005539 | Ga0068853_100122296 | Ga0068853_1001222963 | 152 |
| 38 | 3300005539 | Ga0068853_100158473 | Ga0068853_1001584732 | 152 |
| 39 | 3300005548 | Ga0070665_100058811 | Ga0070665_1000588114 | 152 |
| 40 | 3300005563 | Ga0068855_100006736 | Ga0068855_10000673611 | 152 |
| 41 | 3300005563 | Ga0068855_100034186 | Ga0068855_1000341863 | 152 |
| 42 | 3300005563 | Ga0068855_100039866 | Ga0068855_1000398664 | 152 |
| 43 | 3300005577 | Ga0068857_100059950 | Ga0068857_1000599504 | 152 |
| 44 | 3300005577 | Ga0068857_100177864 | Ga0068857_1001778642 | 152 |
| 45 | 3300005577 | Ga0068857_100274910 | Ga0068857_1002749102 | 152 |
| 46 | 3300005614 | Ga0068856_100235108 | Ga0068856_1002351082 | 152 |
| 47 | 3300005616 | Ga0068852_100292817 | Ga0068852_1002928173 | 152 |
| 48 | 3300005618 | Ga0068864_101373559 | Ga0068864_1013735591 | 152 |
| 49 | 3300006175 | Ga0070712_100107711 | Ga0070712_1001077112 | 152 |
| 50 | 3300006175 | Ga0070712_100670702 | Ga0070712_1006707022 | 152 |
| 51 | 3300006237 | Ga0097621_100225156 | Ga0097621_1002251563 | 152 |
| 52 | 3300006881 | Ga0068865_100058192 | Ga0068865_1000581923 | 152 |
| 53 | 3300007788 | Ga0099795_10044132 | Ga0099795_100441323 | 152 |
| 54 | 3300009093 | Ga0105240_10020640 | Ga0105240_100206403 | 152 |
| 55 | 3300009093 | Ga0105240_10051773 | Ga0105240_100517734 | 152 |
| 56 | 3300009093 | Ga0105240_10091482 | Ga0105240_100914824 | 152 |
| 57 | 3300009093 | Ga0105240_10097689 | Ga0105240_100976893 | 152 |
| 58 | 3300009093 | Ga0105240_10510645 | Ga0105240_105106452 | 152 |
| 59 | 3300009093 | Ga0105240_10621964 | Ga0105240_106219642 | 152 |
| 60 | 3300009093 | Ga0105240_10648063 | Ga0105240_106480632 | 152 |
| 61 | 3300009093 | Ga0105240_10920820 | Ga0105240_109208202 | 152 |
| 62 | 3300009098 | Ga0105245_10835704 | Ga0105245_108357043 | 152 |
| 63 | 3300009148 | Ga0105243_10001995 | Ga0105243_1000199511 | 152 |
| 64 | 3300009174 | Ga0105241_10082541 | Ga0105241_100825413 | 152 |
| 65 | 3300009174 | Ga0105241_10343966 | Ga0105241_103439662 | 152 |
| 66 | 3300009174 | Ga0105241_10346822 | Ga0105241_103468222 | 152 |
| 67 | 3300009176 | Ga0105242_10005119 | Ga0105242_100051192 | 152 |
| 68 | 3300009177 | Ga0105248_10000001 | Ga0105248_10000001170 | 152 |
| 69 | 3300009177 | Ga0105248_13328628 | Ga0105248_133286281 | 152 |
| 70 | 3300009545 | Ga0105237_10009725 | Ga0105237_100097253 | 152 |
| 71 | 3300009545 | Ga0105237_10060450 | Ga0105237_100604504 | 152 |
| 72 | 3300009545 | Ga0105237_10076531 | Ga0105237_100765312 | 152 |
| 73 | 3300009545 | Ga0105237_10548351 | Ga0105237_105483513 | 152 |
| 74 | 3300009545 | Ga0105237_10786874 | Ga0105237_107868742 | 152 |
| 75 | 3300009551 | Ga0105238_10076122 | Ga0105238_100761224 | 152 |
| 76 | 3300009551 | Ga0105238_10090912 | Ga0105238_100909122 | 152 |
| 77 | 3300009551 | Ga0105238_10165465 | Ga0105238_101654651 | 152 |
| 78 | 3300009551 | Ga0105238_10211596 | Ga0105238_102115962 | 152 |
| 79 | 3300009551 | Ga0105238_10285080 | Ga0105238_102850802 | 152 |
| 80 | 3300009551 | Ga0105238_11620901 | Ga0105238_116209012 | 152 |
| 81 | 3300009551 | Ga0105238_11780110 | Ga0105238_117801102 | 152 |
| 82 | 3300010375 | Ga0105239_10001205 | Ga0105239_100012054 | 152 |
| 83 | 3300010375 | Ga0105239_10007247 | Ga0105239_1000724711 | 152 |
| 84 | 3300010375 | Ga0105239_10028624 | Ga0105239_100286243 | 152 |
| 85 | 3300010375 | Ga0105239_10059716 | Ga0105239_100597161 | 152 |
| 86 | 3300010375 | Ga0105239_10129598 | Ga0105239_101295982 | 152 |
| 87 | 3300010375 | Ga0105239_10557107 | Ga0105239_105571072 | 152 |
| 88 | 3300010375 | Ga0105239_10620183 | Ga0105239_106201832 | 152 |
| 89 | 3300010375 | Ga0105239_10786906 | Ga0105239_107869062 | 152 |
| 90 | 3300010375 | Ga0105239_11743092 | Ga0105239_117430921 | 152 |
| 91 | 3300013104 | Ga0157370_10208258 | Ga0157370_102082582 | 152 |
| 92 | 3300013104 | Ga0157370_10609790 | Ga0157370_106097902 | 152 |
| 93 | 3300013105 | Ga0157369_10084863 | Ga0157369_100848632 | 152 |
| 94 | 3300013105 | Ga0157369_10114041 | Ga0157369_101140412 | 152 |
| 95 | 3300013105 | Ga0157369_10178107 | Ga0157369_101781072 | 152 |
| 96 | 3300013105 | Ga0157369_10736280 | Ga0157369_107362802 | 152 |
| 97 | 3300013296 | Ga0157374_10759273 | Ga0157374_107592732 | 152 |
| 98 | 3300013297 | Ga0157378_10205773 | Ga0157378_102057732 | 152 |
| 99 | 3300013306 | Ga0163162_11008041 | Ga0163162_110080412 | 152 |
| 100 | 3300013307 | Ga0157372_10029344 | Ga0157372_100293445 | 152 |
| 101 | 3300014968 | Ga0157379_10001491 | Ga0157379_1000149114 | 152 |
| 102 | 3300014969 | Ga0157376_10156867 | Ga0157376_101568673 | 152 |
| 103 | 3300017792 | Ga0163161_10783627 | Ga0163161_107836271 | 152 |
| 104 | 3300025231 | Ga0207427_108995 | Ga0207427_1089951 | 152 |
| 105 | 3300025261 | Ga0209233_1000013 | Ga0209233_1000013224 | 152 |
| 106 | 3300025901 | Ga0207688_10046842 | Ga0207688_100468422 | 152 |
| 107 | 3300025907 | Ga0207645_10252398 | Ga0207645_102523982 | 152 |
| 108 | 3300025908 | Ga0207643_10032728 | Ga0207643_100327281 | 152 |
| 109 | 3300025909 | Ga0207705_10021616 | Ga0207705_100216162 | 152 |
| 110 | 3300025909 | Ga0207705_10202204 | Ga0207705_102022041 | 152 |
| 111 | 3300025912 | Ga0207707_10000005 | Ga0207707_10000005230 | 152 |
| 112 | 3300025912 | Ga0207707_10189304 | Ga0207707_101893043 | 152 |
| 113 | 3300025912 | Ga0207707_10225575 | Ga0207707_102255752 | 152 |
| 114 | 3300025913 | Ga0207695_10005412 | Ga0207695_100054122 | 152 |
| 115 | 3300025913 | Ga0207695_10035209 | Ga0207695_100352094 | 152 |
| 116 | 3300025913 | Ga0207695_10157622 | Ga0207695_101576222 | 152 |
| 117 | 3300025913 | Ga0207695_10159565 | Ga0207695_101595653 | 152 |
| 118 | 3300025913 | Ga0207695_10159887 | Ga0207695_101598873 | 152 |
| 119 | 3300025913 | Ga0207695_10439511 | Ga0207695_104395111 | 152 |
| 120 | 3300025914 | Ga0207671_10008389 | Ga0207671_100083893 | 152 |
| 121 | 3300025914 | Ga0207671_10024795 | Ga0207671_100247954 | 152 |
| 122 | 3300025914 | Ga0207671_10249444 | Ga0207671_102494442 | 152 |
| 123 | 3300025914 | Ga0207671_10442926 | Ga0207671_104429263 | 152 |
| 124 | 3300025915 | Ga0207693_10121571 | Ga0207693_101215712 | 152 |
| 125 | 3300025917 | Ga0207660_10000540 | Ga0207660_1000054010 | 152 |
| 126 | 3300025917 | Ga0207660_10018036 | Ga0207660_100180363 | 152 |
| 127 | 3300025919 | Ga0207657_10141642 | Ga0207657_101416422 | 152 |
| 128 | 3300025920 | Ga0207649_10016755 | Ga0207649_100167553 | 152 |
| 129 | 3300025921 | Ga0207652_10114524 | Ga0207652_101145243 | 152 |
| 130 | 3300025921 | Ga0207652_10511556 | Ga0207652_105115562 | 152 |
| 131 | 3300025921 | Ga0207652_10593565 | Ga0207652_105935651 | 152 |
| 132 | 3300025924 | Ga0207694_10101336 | Ga0207694_101013363 | 152 |
| 133 | 3300025924 | Ga0207694_10537833 | Ga0207694_105378332 | 152 |
| 134 | 3300025924 | Ga0207694_11105616 | Ga0207694_111056162 | 152 |
| 135 | 3300025926 | Ga0207659_10189389 | Ga0207659_101893892 | 152 |
| 136 | 3300025929 | Ga0207664_10071796 | Ga0207664_100717961 | 152 |
| 137 | 3300025933 | Ga0207706_10240726 | Ga0207706_102407263 | 152 |
| 138 | 3300025935 | Ga0207709_10004305 | Ga0207709_100043057 | 152 |
| 139 | 3300025938 | Ga0207704_10551132 | Ga0207704_105511322 | 152 |
| 140 | 3300025941 | Ga0207711_10000002 | Ga0207711_10000002871 | 152 |
| 141 | 3300025942 | Ga0207689_10022240 | Ga0207689_100222405 | 152 |
| 142 | 3300025942 | Ga0207689_10081556 | Ga0207689_100815562 | 152 |
| 143 | 3300025949 | Ga0207667_10010491 | Ga0207667_100104913 | 152 |
| 144 | 3300025949 | Ga0207667_10649812 | Ga0207667_106498122 | 152 |
| 145 | 3300026035 | Ga0207703_11774989 | Ga0207703_117749891 | 152 |
| 146 | 3300026041 | Ga0207639_10033222 | Ga0207639_100332222 | 152 |
| 147 | 3300026041 | Ga0207639_10254994 | Ga0207639_102549943 | 152 |
| 148 | 3300026067 | Ga0207678_10362349 | Ga0207678_103623492 | 152 |
| 149 | 3300026089 | Ga0207648_10004006 | Ga0207648_100040065 | 152 |
| 150 | 3300026089 | Ga0207648_10131069 | Ga0207648_101310693 | 152 |
| 151 | 3300026089 | Ga0207648_11149692 | Ga0207648_111496922 | 152 |
| 152 | 3300026116 | Ga0207674_10028224 | Ga0207674_100282246 | 152 |
| 153 | 3300026116 | Ga0207674_10086040 | Ga0207674_100860403 | 152 |
| 154 | 3300026116 | Ga0207674_10981698 | Ga0207674_109816982 | 152 |
| 155 | 3300026118 | Ga0207675_100543459 | Ga0207675_1005434592 | 152 |
| 156 | 3300026142 | Ga0207698_10080851 | Ga0207698_100808513 | 152 |
| 157 | 3300026142 | Ga0207698_11099639 | Ga0207698_110996391 | 152 |
| 158 | 3300028379 | Ga0268266_11046642 | Ga0268266_110466422 | 152 |
| 159 | 3300028556 | Ga0265337_1000513 | Ga0265337_100051316 | 152 |
| 160 | 3300028800 | Ga0265338_10030321 | Ga0265338_100303212 | 152 |
| 161 | 3300028800 | Ga0265338_10125184 | Ga0265338_101251841 | 152 |
| 162 | 3300028800 | Ga0265338_10253983 | Ga0265338_102539832 | 152 |
| 163 | 3300031241 | Ga0265325_10001516 | Ga0265325_1000151613 | 152 |
| 164 | 3300031247 | Ga0265340_10000215 | Ga0265340_1000021510 | 152 |
| 165 | 3300031247 | Ga0265340_10197652 | Ga0265340_101976522 | 152 |
| 166 | 3300031247 | Ga0265340_10303075 | Ga0265340_103030751 | 152 |
| 167 | 3300031249 | Ga0265339_10038915 | Ga0265339_100389154 | 152 |
| 168 | 3300031249 | Ga0265339_10049735 | Ga0265339_100497353 | 152 |
| 169 | 3300031249 | Ga0265339_10220671 | Ga0265339_102206712 | 152 |
| 170 | 3300031344 | Ga0265316_10053000 | Ga0265316_100530003 | 152 |
| 171 | 3300031344 | Ga0265316_10500296 | Ga0265316_105002962 | 152 |
| 172 | 3300031344 | Ga0265316_10809650 | Ga0265316_108096501 | 152 |
| 173 | 3300031595 | Ga0265313_10051268 | Ga0265313_100512682 | 152 |
| 174 | 3300031595 | Ga0265313_10077084 | Ga0265313_100770842 | 152 |
| 175 | 3300031711 | Ga0265314_10043072 | Ga0265314_100430722 | 152 |
| 176 | 3300031711 | Ga0265314_10177500 | Ga0265314_101775001 | 152 |
| 177 | 3300031711 | Ga0265314_10373234 | Ga0265314_103732342 | 152 |
| 178 | 3300031711 | Ga0265314_10448642 | Ga0265314_104486421 | 152 |
| 179 | 3300031712 | Ga0265342_10133248 | Ga0265342_101332482 | 152 |
| 180 | 3300035695 | Ga0373927_0408421 | Ga0373927_0408421_54_518 | 152 |
| 181 | 3300035725 | Ga0373947_0286337 | Ga0373947_0286337_452_916 | 152 |
| 182 | 3300037068 | Ga0373925_0379913 | Ga0373925_0379913_219_683 | 152 |
| 183 | 3300037312 | Ga0395899_0069585 | Ga0395899_0069585_1145_1609 | 152 |
| 184 | 3300037418 | Ga0395900_0253559 | Ga0395900_0253559_824_1288 | 152 |
| 185 | 3300037466 | Ga0395898_0052836 | Ga0395898_0052836_2415_2879 | 152 |
| 186 | 3300038443 | Ga0395901_0165876 | Ga0395901_0165876_571_1035 | 152 |
| 187 | 3300039437 | Ga0436365_0104999 | Ga0436365_0104999_108_569 | 152 |
| 188 | 3300039437 | Ga0436365_1793097 | Ga0436365_1793097_158_616 | 152 |
| 189 | 3300039453 | Ga0436362_0439111 | Ga0436362_0439111_20_478 | 152 |
| 190 | 3300046454 | Ga0495592_0185887 | Ga0495592_0185887_663_1121 | 152 |
| 191 | 3300046476 | Ga0495662_0127152 | Ga0495662_0127152_670_1134 | 152 |
| 192 | 3300046477 | Ga0495664_0365424 | Ga0495664_0365424_180_644 | 152 |
| 193 | 3300046477 | Ga0495664_0483774 | Ga0495664_0483774_70_528 | 152 |
| 194 | 3300046477 | Ga0495664_0770605 | Ga0495664_0770605_35_499 | 152 |
| 195 | 3300046516 | Ga0495628_0242851 | Ga0495628_0242851_605_1069 | 152 |
| 196 | 3300046517 | Ga0495630_0905890 | Ga0495630_0905890_168_626 | 152 |
| 197 | 3300046529 | Ga0495652_0228415 | Ga0495652_0228415_612_1070 | 152 |
| 198 | 3300046536 | Ga0495587_0023844 | Ga0495587_0023844_1795_2259 | 152 |
| 199 | 3300046543 | Ga0495645_0245208 | Ga0495645_0245208_47_505 | 152 |
| 200 | 3300046678 | Ga0495599_0294086 | Ga0495599_0294086_397_861 | 152 |
| 201 | 3300046690 | Ga0495624_0236022 | Ga0495624_0236022_196_660 | 152 |
| 202 | 3300046691 | Ga0495670_0374626 | Ga0495670_0374626_13_471 | 152 |
| 203 | 3300047444 | Ga0495675_0043451 | Ga0495675_0043451_566_1024 | 152 |
| 204 | 3300048088 | Ga0495602_0026069 | Ga0495602_0026069_4060_4524 | 152 |
| 205 | 3300048903 | Ga0496100_1410887 | Ga0496100_1410887_18_476 | 152 |
| 206 | 3300049569 | Ga0501032_0053015 | Ga0501032_0053015_775_1233 | 152 |
| 207 | 3300049569 | Ga0501032_0392620 | Ga0501032_0392620_41_499 | 152 |
| 208 | 3300049569 | Ga0501032_0432547 | Ga0501032_0432547_355_828 | 152 |
| 209 | 3300049570 | Ga0501033_0023697 | Ga0501033_0023697_2485_2949 | 152 |
| 210 | 3300049570 | Ga0501033_0045319 | Ga0501033_0045319_1297_1755 | 152 |
| 211 | 3300049570 | Ga0501033_0087782 | Ga0501033_0087782_929_1396 | 152 |
| 212 | 3300049570 | Ga0501033_0104985 | Ga0501033_0104985_125_583 | 152 |
| 213 | 3300049570 | Ga0501033_0203274 | Ga0501033_0203274_522_980 | 152 |
| 214 | 3300049571 | Ga0501034_0042033 | Ga0501034_0042033_3816_4274 | 152 |
| 215 | 3300049571 | Ga0501034_0098899 | Ga0501034_0098899_1801_2259 | 152 |
| 216 | 3300049571 | Ga0501034_0232698 | Ga0501034_0232698_769_1227 | 152 |
| 217 | 3300049571 | Ga0501034_0243456 | Ga0501034_0243456_679_1146 | 152 |
| 218 | 3300049571 | Ga0501034_0465722 | Ga0501034_0465722_546_1004 | 152 |
| 219 | 3300049571 | Ga0501034_0589692 | Ga0501034_0589692_394_858 | 152 |
| 220 | 3300049572 | Ga0501036_0171580 | Ga0501036_0171580_1029_1487 | 152 |
| 221 | 3300049572 | Ga0501036_0359249 | Ga0501036_0359249_397_861 | 152 |
| 222 | 3300049572 | Ga0501036_0725312 | Ga0501036_0725312_162_620 | 152 |
| 223 | 3300049573 | Ga0501037_0031335 | Ga0501037_0031335_479_937 | 152 |
| 224 | 3300049574 | Ga0501038_0102140 | Ga0501038_0102140_1038_1496 | 152 |
| 225 | 3300049575 | Ga0501039_0042977 | Ga0501039_0042977_2260_2718 | 152 |
| 226 | 3300049575 | Ga0501039_0691032 | Ga0501039_0691032_124_582 | 152 |
| 227 | 3300049578 | Ga0501042_0004549 | Ga0501042_0004549_7051_7509 | 152 |
| 228 | 3300049579 | Ga0501043_0024278 | Ga0501043_0024278_1039_1497 | 152 |
| 229 | 3300049579 | Ga0501043_0252840 | Ga0501043_0252840_25_483 | 152 |
| 230 | 3300049579 | Ga0501043_0478650 | Ga0501043_0478650_153_617 | 152 |
| 231 | 3300049579 | Ga0501043_0812080 | Ga0501043_0812080_29_487 | 152 |
| 232 | 3300049580 | Ga0501046_0014609 | Ga0501046_0014609_2536_2994 | 152 |
| 233 | 3300049580 | Ga0501046_0025719 | Ga0501046_0025719_1945_2403 | 152 |
| 234 | 3300049580 | Ga0501046_0131324 | Ga0501046_0131324_1365_1823 | 152 |
| 235 | 3300049580 | Ga0501046_0302592 | Ga0501046_0302592_404_868 | 152 |
| 236 | 3300049581 | Ga0501047_0002210 | Ga0501047_0002210_16852_17310 | 152 |
| 237 | 3300049581 | Ga0501047_0005989 | Ga0501047_0005989_4744_5202 | 152 |
| 238 | 3300049581 | Ga0501047_0006743 | Ga0501047_0006743_9277_9735 | 152 |
| 239 | 3300049581 | Ga0501047_0040198 | Ga0501047_0040198_3104_3568 | 152 |
| 240 | 3300049581 | Ga0501047_0048151 | Ga0501047_0048151_478_936 | 152 |
| 241 | 3300049581 | Ga0501047_0063299 | Ga0501047_0063299_1489_1947 | 152 |
| 242 | 3300049581 | Ga0501047_0166791 | Ga0501047_0166791_344_802 | 152 |
| 243 | 3300049581 | Ga0501047_0278875 | Ga0501047_0278875_1023_1481 | 152 |
| 244 | 3300049581 | Ga0501047_0339539 | Ga0501047_0339539_163_627 | 152 |
| 245 | 3300049581 | Ga0501047_0541956 | Ga0501047_0541956_132_590 | 152 |
| 246 | 3300049581 | Ga0501047_1013721 | Ga0501047_1013721_30_488 | 152 |
| 247 | 3300049582 | Ga0501048_0074300 | Ga0501048_0074300_1113_1571 | 152 |
| 248 | 3300049583 | Ga0501067_0008182 | Ga0501067_0008182_4386_4844 | 152 |
| 249 | 3300049583 | Ga0501067_0121253 | Ga0501067_0121253_591_1049 | 152 |
| 250 | 3300049584 | Ga0501068_0086806 | Ga0501068_0086806_783_1241 | 152 |
| 251 | 3300049586 | Ga0501070_0059594 | Ga0501070_0059594_1673_2131 | 152 |
| 252 | 3300049586 | Ga0501070_0141120 | Ga0501070_0141120_1434_1892 | 152 |
| 253 | 3300049586 | Ga0501070_0155299 | Ga0501070_0155299_1351_1818 | 152 |
| 254 | 3300049586 | Ga0501070_0234676 | Ga0501070_0234676_477_935 | 152 |
| 255 | 3300049588 | Ga0501072_0001422 | Ga0501072_0001422_10496_10954 | 152 |
| 256 | 3300049589 | Ga0501073_0005612 | Ga0501073_0005612_3299_3757 | 152 |
| 257 | 3300049589 | Ga0501073_0076010 | Ga0501073_0076010_998_1456 | 152 |
| 258 | 3300049589 | Ga0501073_0224318 | Ga0501073_0224318_437_901 | 152 |
| 259 | 3300049590 | Ga0501074_0073632 | Ga0501074_0073632_637_1095 | 152 |
| 260 | 3300049590 | Ga0501074_0100368 | Ga0501074_0100368_1539_1997 | 152 |
| 261 | 3300049590 | Ga0501074_0146172 | Ga0501074_0146172_428_937 | 152 |
| 262 | 3300049741 | Ga0501079_0253164 | Ga0501079_0253164_211_669 | 152 |
| 263 | 3300049741 | Ga0501079_0313159 | Ga0501079_0313159_461_919 | 152 |
| 264 | 3300049742 | Ga0501080_0017229 | Ga0501080_0017229_3816_4274 | 152 |
| 265 | 3300049742 | Ga0501080_0018541 | Ga0501080_0018541_5267_5725 | 152 |
| 266 | 3300049742 | Ga0501080_0125277 | Ga0501080_0125277_924_1382 | 152 |
| 267 | 3300049742 | Ga0501080_0403147 | Ga0501080_0403147_242_706 | 152 |
| 268 | 3300049742 | Ga0501080_0565771 | Ga0501080_0565771_51_560 | 152 |
| 269 | 3300049742 | Ga0501080_0605286 | Ga0501080_0605286_390_848 | 152 |
| 270 | 3300049742 | Ga0501080_0609500 | Ga0501080_0609500_457_924 | 152 |
| 271 | 3300049742 | Ga0501080_0621090 | Ga0501080_0621090_142_600 | 152 |
| 272 | 3300049742 | Ga0501080_1259477 | Ga0501080_1259477_89_553 | 152 |
| 273 | 3300049744 | Ga0501083_0444345 | Ga0501083_0444345_63_521 | 152 |
| 274 | 3300049822 | Ga0501035_0006183 | Ga0501035_0006183_1703_2161 | 152 |
| 275 | 3300049822 | Ga0501035_0129469 | Ga0501035_0129469_530_994 | 152 |
| 276 | 3300049822 | Ga0501035_0574307 | Ga0501035_0574307_56_514 | 152 |
| 277 | 3300049823 | Ga0501044_0005565 | Ga0501044_0005565_9503_9961 | 152 |
| 278 | 3300049823 | Ga0501044_0010411 | Ga0501044_0010411_5167_5625 | 152 |
| 279 | 3300049823 | Ga0501044_0026121 | Ga0501044_0026121_4247_4711 | 152 |
| 280 | 3300049823 | Ga0501044_0052538 | Ga0501044_0052538_125_583 | 152 |
| 281 | 3300049823 | Ga0501044_0100829 | Ga0501044_0100829_2314_2781 | 152 |
| 282 | 3300049823 | Ga0501044_0189793 | Ga0501044_0189793_244_702 | 152 |
| 283 | 3300049823 | Ga0501044_0225307 | Ga0501044_0225307_1009_1467 | 152 |
| 284 | 3300049823 | Ga0501044_0227314 | Ga0501044_0227314_1153_1611 | 152 |
| 285 | 3300049823 | Ga0501044_0232282 | Ga0501044_0232282_1098_1661 | 152 |
| 286 | 3300049823 | Ga0501044_0270416 | Ga0501044_0270416_1162_1620 | 152 |
| 287 | 3300049823 | Ga0501044_0340278 | Ga0501044_0340278_345_803 | 152 |
| 288 | 3300049823 | Ga0501044_0879799 | Ga0501044_0879799_297_755 | 152 |
| 289 | 3300049824 | Ga0501045_0075181 | Ga0501045_0075181_834_1292 | 152 |
| 290 | 3300053119 | Ga0500595_000303 | Ga0500595_000303_15765_16223 | 152 |
| 291 | 3300053136 | Ga0500559_0036390 | Ga0500559_0036390_13_471 | 152 |
| 292 | 3300053140 | Ga0500573_0000003 | Ga0500573_0000003_127001_127459 | 152 |
| 293 | 3300053154 | Ga0500619_000410 | Ga0500619_000410_2825_3283 | 152 |
| 294 | 3300054114 | Ga0501084_0038494 | Ga0501084_0038494_914_1372 | 152 |
| 295 | 3300054114 | Ga0501084_0157917 | Ga0501084_0157917_842_1300 | 152 |
| 296 | 3300054114 | Ga0501084_0163785 | Ga0501084_0163785_783_1241 | 152 |
| 297 | 3300060353 | Ga0501082_0009272 | Ga0501082_0009272_7644_8102 | 152 |
| 298 | 3300060353 | Ga0501082_0482037 | Ga0501082_0482037_576_1034 | 152 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3sxu-assembly1.cif.gz_A | structure of the e. coli ssb-dna polymerase iii interface | 0.8537 | 2 | 139 |
| 3sxu-assembly1.cif.gz_A | structure of the e. coli ssb-dna polymerase iii interface | 0.8054 | 2 | 139 |
| 2wzq-assembly1.cif.gz_A | insertion mutant e173gp174 of the ns3 protease-helicase from dengue virus | 0.7323 | 3 | 111 |
| 5vi7-assembly1.cif.gz_A | crystal structure of the zika virus ns3 helicase | 0.7224 | 4 | 111 |
| 5yvw-assembly1.cif.gz_B | crystal structure of full length ns3 protein (ed4ns2bns3) from denv4 in closed conformation | 0.7217 | 3 | 111 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1em8C00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;DNA polymerase III subunit chi | 0.8441 | 1 | 139 | 3.40.50.10110 |
| 1em8C00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;DNA polymerase III subunit chi | 0.7971 | 1 | 139 | 3.40.50.10110 |
| af_C0H5F0_492_697_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.7602 | 9 | 48 | 3.40.50.300 |
| af_A0A140LFS6_48_320_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.7373 | 8 | 76 | 3.40.50.300 |
| af_K7M6B0_421_558_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.7224 | 3 | 115 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1M3ABW7-F1-model_v4 | deleted | 0.9776 | 1 | 152 |
|
| AF-A0A0Q8IMN7-F1-model_v4 | DNA polymerase III subunit chi | 0.9732 | 1 | 152 |
GO:0003677
GO:0003887 GO:0006260 GO:0032298 |
| AF-A0A0C6F973-F1-model_v4 | DNA polymerase III subunit chi | 0.9723 | 2 | 152 |
GO:0003677
GO:0003887 GO:0006260 GO:0032298 |
| AF-A0A353YD97-F1-model_v4 | DNA polymerase III subunit chi | 0.9723 | 1 | 79 |
GO:0003677
GO:0003887 GO:0006260 GO:0032298 |
| AF-A0A368A2Q3-F1-model_v4 | DNA polymerase III subunit chi | 0.9712 | 1 | 152 |
GO:0003677
GO:0003887 GO:0006260 GO:0032298 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar