F394529

General Info

Members Datasets Scaffolds Average Seq Length
298 137 298 153

Family's Representative Sequence

Representative Sequence 3300049823|Ga0501044_0232282|Ga0501044_0232282_1098_1661
Length 187
Sequence MAGLDPAIQRNKESFFARMREDWMAASRAAMTIDEMTETLFYHLERRALEDVLPKLVEKSLERGWRALIRCESAERAEAIDTLLWTYDEESFLPHAAHGDGEAERQPVLITVEPGNANAAQALFLVGAAAPLDWTGYDDFVRVVLIFDGRDAGAEETALRSLEKARSFGHEVKYYRQTPGGKFQLQG

Samples

Sample ID Description Type Environment
1 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
22 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
24 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
29 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
41 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
42 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
43 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
44 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
45 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
46 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
78 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
79 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
80 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
81 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
82 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
83 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
84 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
85 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
86 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
91 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
92 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
93 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
94 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
95 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
96 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
97 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
98 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
99 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
100 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
101 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
102 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
103 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
104 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
105 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
106 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
107 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
108 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
121 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
122 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
123 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
124 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
125 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
126 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
127 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
128 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
129 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
132 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
133 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
134 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
135 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
136 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
137 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.35
Nodule 0
Rhizoplane 0.34
Rhizosphere 95.97
Stem 0
Stem Tuber 0
Unclassified 1.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000425 3300003214 Bacteria 43589
2 Ga0070658_10086366 3300005327 Bacteria 2580
3 Ga0070658_10149498 3300005327 Bacteria 1955
4 Ga0070658_10231740 3300005327 Bacteria 1564
5 Ga0070690_100194418 3300005330 Bacteria 1408
6 Ga0068869_100430244 3300005334 Bacteria 1090
7 Ga0070680_100001355 3300005336 Bacteria 17727
8 Ga0070680_100118191 3300005336 Bacteria 2211
9 Ga0070660_100499214 3300005339 Bacteria 1012
10 Ga0070660_101355176 3300005339 Unclassified 604
11 Ga0070661_101014684 3300005344 Unclassified 689
12 Ga0070675_100447508 3300005354 Unclassified 1158
13 Ga0070714_100057904 3300005435 Bacteria 3318
14 Ga0070714_100576244 3300005435 Bacteria 1079
15 Ga0070662_100200763 3300005457 Bacteria 1582
16 Ga0070681_10000005 3300005458 Bacteria 183053
17 Ga0070681_10191647 3300005458 Bacteria 1964
18 Ga0070681_10393124 3300005458 Bacteria 1297
19 Ga0070681_10832131 3300005458 Bacteria 840
20 Ga0068867_100003555 3300005459 Bacteria 10959
21 Ga0070679_100001521 3300005530 Bacteria 20655
22 Ga0070679_100070930 3300005530 Bacteria 3475
23 Ga0070679_100143110 3300005530 Bacteria 2370
24 Ga0070679_100375117 3300005530 Bacteria 1369
25 Ga0068853_100122296 3300005539 Bacteria 2323
26 Ga0068853_100158473 3300005539 Bacteria 2041
27 Ga0068853_100613121 3300005539 Bacteria 1034
28 Ga0070665_100058811 3300005548 Bacteria 3853
29 Ga0068855_100006736 3300005563 Bacteria 13932
30 Ga0068855_100034186 3300005563 Bacteria 6064
31 Ga0068855_100039866 3300005563 Bacteria 5575
32 Ga0068855_100650804 3300005563 Bacteria 1132
33 Ga0068857_100059950 3300005577 Bacteria 3381
34 Ga0068857_100177864 3300005577 Bacteria 1936
35 Ga0068857_100274910 3300005577 Bacteria 1549
36 Ga0068856_100235108 3300005614 Bacteria 1848
37 Ga0068852_100292817 3300005616 Bacteria 1573
38 Ga0068864_101373559 3300005618 Unclassified 708
39 Ga0070712_100107711 3300006175 Bacteria 2074
40 Ga0070712_100670702 3300006175 Bacteria 882
41 Ga0097621_100225156 3300006237 Bacteria 1635
42 Ga0068865_100058192 3300006881 Bacteria 2699
43 Ga0099795_10044132 3300007788 Unclassified 1598
44 Ga0105240_10020640 3300009093 Bacteria 8781
45 Ga0105240_10051773 3300009093 Bacteria 5165
46 Ga0105240_10091482 3300009093 Bacteria 3717
47 Ga0105240_10097689 3300009093 Bacteria 3578
48 Ga0105240_10510645 3300009093 Unclassified 1335
49 Ga0105240_10621964 3300009093 Unclassified 1187
50 Ga0105240_10648063 3300009093 Bacteria 1158
51 Ga0105240_10920820 3300009093 Bacteria 939
52 Ga0105245_10835704 3300009098 Unclassified 960
53 Ga0105243_10001995 3300009148 Bacteria 17370
54 Ga0105241_10082541 3300009174 Bacteria 2519
55 Ga0105241_10343966 3300009174 Unclassified 1293
56 Ga0105241_10346822 3300009174 Bacteria 1288
57 Ga0105242_10005119 3300009176 Bacteria 10111
58 Ga0105248_10000001 3300009177 Bacteria 1881304
59 Ga0105248_13328628 3300009177 Bacteria 511
60 Ga0105237_10009725 3300009545 Bacteria 10288
61 Ga0105237_10060450 3300009545 Bacteria 3791
62 Ga0105237_10076531 3300009545 Bacteria 3337
63 Ga0105237_10548351 3300009545 Bacteria 1163
64 Ga0105237_10786874 3300009545 Unclassified 958
65 Ga0105238_10076122 3300009551 Bacteria 3347
66 Ga0105238_10090912 3300009551 Bacteria 3040
67 Ga0105238_10165465 3300009551 Bacteria 2187
68 Ga0105238_10211596 3300009551 Bacteria 1915
69 Ga0105238_10235849 3300009551 Bacteria 1807
70 Ga0105238_10285080 3300009551 Bacteria 1633
71 Ga0105238_11620901 3300009551 Unclassified 677
72 Ga0105238_11780110 3300009551 Bacteria 648
73 Ga0105239_10001205 3300010375 Bacteria 35322
74 Ga0105239_10007247 3300010375 Bacteria 12738
75 Ga0105239_10028624 3300010375 Bacteria 6126
76 Ga0105239_10059716 3300010375 Bacteria 4185
77 Ga0105239_10129598 3300010375 Bacteria 2805
78 Ga0105239_10557107 3300010375 Bacteria 1306
79 Ga0105239_10620183 3300010375 Bacteria 1234
80 Ga0105239_10786906 3300010375 Bacteria 1090
81 Ga0105239_11743092 3300010375 Unclassified 721
82 Ga0157370_10208258 3300013104 Bacteria 1813
83 Ga0157370_10609790 3300013104 Bacteria 999
84 Ga0157369_10084863 3300013105 Bacteria 3384
85 Ga0157369_10114041 3300013105 Unclassified 2871
86 Ga0157369_10178107 3300013105 Bacteria 2238
87 Ga0157369_10736280 3300013105 Unclassified 1015
88 Ga0157374_10759273 3300013296 Bacteria 985
89 Ga0157378_10205773 3300013297 Bacteria 1864
90 Ga0163162_11008041 3300013306 Unclassified 942
91 Ga0157372_10029344 3300013307 Bacteria 6005
92 Ga0157379_10001491 3300014968 Bacteria 19265
93 Ga0157376_10156867 3300014969 Bacteria 2059
94 Ga0163161_10783627 3300017792 Unclassified 800
95 Ga0213876_10000180 3300021384 Bacteria 65389
96 Ga0207427_108995 3300025231 Bacteria 1089
97 Ga0209233_1000013 3300025261 Bacteria 1013785
98 Ga0207688_10046842 3300025901 Bacteria 2414
99 Ga0207645_10252398 3300025907 Bacteria 1167
100 Ga0207643_10032728 3300025908 Bacteria 2905
101 Ga0207705_10021616 3300025909 Bacteria 4592
102 Ga0207705_10202204 3300025909 Bacteria 1505
103 Ga0207707_10000005 3300025912 Bacteria 382024
104 Ga0207707_10189304 3300025912 Bacteria 1795
105 Ga0207707_10225575 3300025912 Bacteria 1631
106 Ga0207695_10005412 3300025913 Bacteria 16939
107 Ga0207695_10035209 3300025913 Bacteria 5433
108 Ga0207695_10157622 3300025913 Bacteria 2204
109 Ga0207695_10159565 3300025913 Bacteria 2188
110 Ga0207695_10159887 3300025913 Unclassified 2185
111 Ga0207695_10439511 3300025913 Bacteria 1188
112 Ga0207671_10008389 3300025914 Bacteria 8770
113 Ga0207671_10024795 3300025914 Bacteria 4507
114 Ga0207671_10249444 3300025914 Bacteria 1395
115 Ga0207671_10442926 3300025914 Bacteria 1034
116 Ga0207693_10121571 3300025915 Bacteria 2051
117 Ga0207660_10000540 3300025917 Bacteria 25362
118 Ga0207660_10018036 3300025917 Bacteria 4700
119 Ga0207657_10141642 3300025919 Bacteria 1964
120 Ga0207649_10016755 3300025920 Bacteria 4142
121 Ga0207652_10114524 3300025921 Unclassified 2394
122 Ga0207652_10511556 3300025921 Bacteria 1080
123 Ga0207652_10593565 3300025921 Bacteria 993
124 Ga0207694_10101336 3300025924 Bacteria 2282
125 Ga0207694_10533734 3300025924 Bacteria 984
126 Ga0207694_10537833 3300025924 Unclassified 980
127 Ga0207694_11105616 3300025924 Bacteria 671
128 Ga0207659_10189389 3300025926 Unclassified 1636
129 Ga0207664_10071796 3300025929 Bacteria 2790
130 Ga0207664_10481337 3300025929 Bacteria 1110
131 Ga0207706_10240726 3300025933 Bacteria 1582
132 Ga0207709_10004305 3300025935 Bacteria 8247
133 Ga0207704_10551132 3300025938 Bacteria 937
134 Ga0207711_10000002 3300025941 Bacteria 1228676
135 Ga0207689_10022240 3300025942 Bacteria 5331
136 Ga0207689_10081556 3300025942 Bacteria 2659
137 Ga0207667_10010491 3300025949 Bacteria 10830
138 Ga0207667_10379105 3300025949 Bacteria 1441
139 Ga0207667_10649812 3300025949 Bacteria 1060
140 Ga0207703_11774989 3300026035 Unclassified 593
141 Ga0207639_10033222 3300026041 Bacteria 3804
142 Ga0207639_10254994 3300026041 Bacteria 1531
143 Ga0207639_10504658 3300026041 Bacteria 1106
144 Ga0207678_10362349 3300026067 Bacteria 1251
145 Ga0207648_10004006 3300026089 Bacteria 15291
146 Ga0207648_10131069 3300026089 Bacteria 2207
147 Ga0207648_11149692 3300026089 Unclassified 728
148 Ga0207674_10028224 3300026116 Bacteria 5926
149 Ga0207674_10086040 3300026116 Bacteria 3138
150 Ga0207674_10981698 3300026116 Unclassified 813
151 Ga0207675_100543459 3300026118 Bacteria 1160
152 Ga0207698_10080851 3300026142 Bacteria 2620
153 Ga0207698_11099639 3300026142 Bacteria 808
154 Ga0268266_11046642 3300028379 Unclassified 790
155 Ga0265337_1000513 3300028556 Bacteria 20652
156 Ga0265338_10030321 3300028800 Bacteria 5331
157 Ga0265338_10125184 3300028800 Bacteria 2040
158 Ga0265338_10253983 3300028800 Bacteria 1296
159 Ga0265325_10001516 3300031241 Bacteria 16323
160 Ga0265340_10000215 3300031247 Bacteria 29446
161 Ga0265340_10073381 3300031247 Bacteria 1619
162 Ga0265340_10197652 3300031247 Bacteria 905
163 Ga0265340_10303075 3300031247 Bacteria 708
164 Ga0265339_10038915 3300031249 Bacteria 2650
165 Ga0265339_10049735 3300031249 Bacteria 2294
166 Ga0265339_10220671 3300031249 Bacteria 927
167 Ga0265316_10053000 3300031344 Bacteria 3180
168 Ga0265316_10500296 3300031344 Bacteria 868
169 Ga0265316_10809650 3300031344 Unclassified 657
170 Ga0265313_10051268 3300031595 Bacteria 1975
171 Ga0265313_10077084 3300031595 Bacteria 1522
172 Ga0265314_10043072 3300031711 Bacteria 3213
173 Ga0265314_10177500 3300031711 Bacteria 1280
174 Ga0265314_10373234 3300031711 Bacteria 778
175 Ga0265314_10448642 3300031711 Bacteria 687
176 Ga0265342_10133248 3300031712 Bacteria 1391
177 Ga0373927_0070243 3300035695 Bacteria 2267
178 Ga0373927_0408421 3300035695 Unclassified 896
179 Ga0373947_0286337 3300035725 Bacteria 1096
180 Ga0373925_0379913 3300037068 Bacteria 1150
181 Ga0395899_0069585 3300037312 Bacteria 2577
182 Ga0395900_0253559 3300037418 Bacteria 1760
183 Ga0395898_0052836 3300037466 Bacteria 3969
184 Ga0395901_0165876 3300038443 Bacteria 2319
185 Ga0436365_0104999 3300039437 Bacteria 1222
186 Ga0436365_0508484 3300039437 Bacteria 190091
187 Ga0436365_1793097 3300039437 Bacteria 641
188 Ga0436362_0439111 3300039453 Bacteria 519
189 Ga0495592_0185887 3300046454 Bacteria 1412
190 Ga0495662_0127152 3300046476 Bacteria 1252
191 Ga0495664_0365424 3300046477 Bacteria 868
192 Ga0495664_0483774 3300046477 Unclassified 740
193 Ga0495664_0770605 3300046477 Unclassified 566
194 Ga0495628_0242851 3300046516 Bacteria 1347
195 Ga0495630_0905890 3300046517 Unclassified 672
196 Ga0495652_0228415 3300046529 Bacteria 1394
197 Ga0495587_0023844 3300046536 Bacteria 3757
198 Ga0495645_0245208 3300046543 Bacteria 1193
199 Ga0495599_0294086 3300046678 Unclassified 981
200 Ga0495624_0236022 3300046690 Bacteria 1107
201 Ga0495670_0374626 3300046691 Unclassified 768
202 Ga0495675_0043451 3300047444 Unclassified 2863
203 Ga0495593_0546291 3300047673 Unclassified 581
204 Ga0495602_0026069 3300048088 Bacteria 5646
205 Ga0496100_1410887 3300048903 Unclassified 550
206 Ga0501032_0053015 3300049569 Bacteria 2732
207 Ga0501032_0392620 3300049569 Bacteria 892
208 Ga0501032_0432547 3300049569 Bacteria 844
209 Ga0501033_0023697 3300049570 Bacteria 4629
210 Ga0501033_0045319 3300049570 Bacteria 3273
211 Ga0501033_0087782 3300049570 Bacteria 2276
212 Ga0501033_0104985 3300049570 Bacteria 2059
213 Ga0501033_0203274 3300049570 Bacteria 1414
214 Ga0501034_0042033 3300049571 Bacteria 4626
215 Ga0501034_0098899 3300049571 Bacteria 2912
216 Ga0501034_0232698 3300049571 Bacteria 1791
217 Ga0501034_0243456 3300049571 Bacteria 1744
218 Ga0501034_0465722 3300049571 Bacteria 1180
219 Ga0501034_0589692 3300049571 Bacteria 1018
220 Ga0501036_0171580 3300049572 Bacteria 1827
221 Ga0501036_0359249 3300049572 Bacteria 1216
222 Ga0501036_0725312 3300049572 Bacteria 821
223 Ga0501037_0031335 3300049573 Bacteria 3925
224 Ga0501038_0102140 3300049574 Bacteria 2386
225 Ga0501039_0042977 3300049575 Bacteria 3491
226 Ga0501039_0691032 3300049575 Unclassified 798
227 Ga0501042_0004549 3300049578 Bacteria 8850
228 Ga0501043_0024278 3300049579 Bacteria 4757
229 Ga0501043_0252840 3300049579 Bacteria 1357
230 Ga0501043_0478650 3300049579 Bacteria 932
231 Ga0501043_0812080 3300049579 Bacteria 676
232 Ga0501046_0014609 3300049580 Bacteria 6616
233 Ga0501046_0025719 3300049580 Bacteria 4814
234 Ga0501046_0131324 3300049580 Bacteria 1900
235 Ga0501046_0302592 3300049580 Bacteria 1168
236 Ga0501047_0002210 3300049581 Bacteria 18637
237 Ga0501047_0005989 3300049581 Bacteria 11427
238 Ga0501047_0006743 3300049581 Bacteria 10794
239 Ga0501047_0040198 3300049581 Bacteria 4524
240 Ga0501047_0048151 3300049581 Bacteria 4116
241 Ga0501047_0063299 3300049581 Bacteria 3568
242 Ga0501047_0166791 3300049581 Bacteria 2072
243 Ga0501047_0278875 3300049581 Bacteria 1516
244 Ga0501047_0339539 3300049581 Bacteria 1340
245 Ga0501047_0541956 3300049581 Unclassified 988
246 Ga0501047_1013721 3300049581 Unclassified 643
247 Ga0501048_0074300 3300049582 Bacteria 2398
248 Ga0501067_0008182 3300049583 Bacteria 5808
249 Ga0501067_0121253 3300049583 Bacteria 1455
250 Ga0501068_0086806 3300049584 Bacteria 1926
251 Ga0501070_0059594 3300049586 Bacteria 3164
252 Ga0501070_0141120 3300049586 Bacteria 1989
253 Ga0501070_0155299 3300049586 Bacteria 1887
254 Ga0501070_0234676 3300049586 Bacteria 1502
255 Ga0501072_0001422 3300049588 Bacteria 17958
256 Ga0501073_0005612 3300049589 Bacteria 9387
257 Ga0501073_0076010 3300049589 Bacteria 2337
258 Ga0501073_0224318 3300049589 Unclassified 1298
259 Ga0501074_0073632 3300049590 Bacteria 2453
260 Ga0501074_0100368 3300049590 Bacteria 2072
261 Ga0501074_0146172 3300049590 Bacteria 1690
262 Ga0501079_0253164 3300049741 Unclassified 1376
263 Ga0501079_0313159 3300049741 Bacteria 1228
264 Ga0501080_0017229 3300049742 Bacteria 6675
265 Ga0501080_0018541 3300049742 Bacteria 6438
266 Ga0501080_0125277 3300049742 Bacteria 2379
267 Ga0501080_0403147 3300049742 Bacteria 1230
268 Ga0501080_0565771 3300049742 Bacteria 1011
269 Ga0501080_0605286 3300049742 Bacteria 972
270 Ga0501080_0609500 3300049742 Bacteria 969
271 Ga0501080_0621090 3300049742 Unclassified 958
272 Ga0501080_1259477 3300049742 Unclassified 634
273 Ga0501083_0444345 3300049744 Bacteria 844
274 Ga0501035_0006183 3300049822 Bacteria 11269
275 Ga0501035_0129469 3300049822 Bacteria 2201
276 Ga0501035_0574307 3300049822 Unclassified 921
277 Ga0501044_0005565 3300049823 Bacteria 13985
278 Ga0501044_0010411 3300049823 Bacteria 10091
279 Ga0501044_0026121 3300049823 Bacteria 6184
280 Ga0501044_0052538 3300049823 Bacteria 4198
281 Ga0501044_0100829 3300049823 Bacteria 2905
282 Ga0501044_0189793 3300049823 Bacteria 2018
283 Ga0501044_0225307 3300049823 Unclassified 1824
284 Ga0501044_0227314 3300049823 Unclassified 1815
285 Ga0501044_0232282 3300049823 Bacteria 1791
286 Ga0501044_0270416 3300049823 Bacteria 1635
287 Ga0501044_0340278 3300049823 Bacteria 1421
288 Ga0501044_0879799 3300049823 Bacteria 771
289 Ga0501045_0075181 3300049824 Bacteria 2488
290 Ga0500595_000303 3300053119 Bacteria 32415
291 Ga0500559_0036390 3300053136 Bacteria 2129
292 Ga0500573_0000003 3300053140 Bacteria 355643
293 Ga0500619_000410 3300053154 Bacteria 7784
294 Ga0501084_0038494 3300054114 Bacteria 3998
295 Ga0501084_0157917 3300054114 Bacteria 1913
296 Ga0501084_0163785 3300054114 Bacteria 1876
297 Ga0501082_0009272 3300060353 Bacteria 8482
298 Ga0501082_0482037 3300060353 Bacteria 1084

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031247 Ga0265340_10073381 Ga0265340_100733812 135
2 3300047673 Ga0495593_0546291 Ga0495593_0546291_22_438 136
3 3300005539 Ga0068853_100613121 Ga0068853_1006131212 137
4 3300005563 Ga0068855_100650804 Ga0068855_1006508041 137
5 3300009551 Ga0105238_10235849 Ga0105238_102358492 137
6 3300025924 Ga0207694_10533734 Ga0207694_105337342 137
7 3300025949 Ga0207667_10379105 Ga0207667_103791052 137
8 3300026041 Ga0207639_10504658 Ga0207639_105046582 137
9 3300005435 Ga0070714_100576244 Ga0070714_1005762442 151
10 3300021384 Ga0213876_10000180 Ga0213876_1000018048 151
11 3300025929 Ga0207664_10481337 Ga0207664_104813372 151
12 3300035695 Ga0373927_0070243 Ga0373927_0070243_1383_1844 151
13 3300039437 Ga0436365_0508484 Ga0436365_0508484_40114_40569 151
14 3300003214 JGI25165J46597_1000425 JGI25165J46597_100042513 152
15 3300005327 Ga0070658_10086366 Ga0070658_100863662 152
16 3300005327 Ga0070658_10149498 Ga0070658_101494983 152
17 3300005327 Ga0070658_10231740 Ga0070658_102317401 152
18 3300005330 Ga0070690_100194418 Ga0070690_1001944182 152
19 3300005334 Ga0068869_100430244 Ga0068869_1004302442 152
20 3300005336 Ga0070680_100001355 Ga0070680_10000135510 152
21 3300005336 Ga0070680_100118191 Ga0070680_1001181912 152
22 3300005339 Ga0070660_100499214 Ga0070660_1004992142 152
23 3300005339 Ga0070660_101355176 Ga0070660_1013551761 152
24 3300005344 Ga0070661_101014684 Ga0070661_1010146842 152
25 3300005354 Ga0070675_100447508 Ga0070675_1004475081 152
26 3300005435 Ga0070714_100057904 Ga0070714_1000579043 152
27 3300005457 Ga0070662_100200763 Ga0070662_1002007632 152
28 3300005458 Ga0070681_10000005 Ga0070681_1000000571 152
29 3300005458 Ga0070681_10191647 Ga0070681_101916473 152
30 3300005458 Ga0070681_10393124 Ga0070681_103931242 152
31 3300005458 Ga0070681_10832131 Ga0070681_108321312 152
32 3300005459 Ga0068867_100003555 Ga0068867_1000035558 152
33 3300005530 Ga0070679_100001521 Ga0070679_10000152110 152
34 3300005530 Ga0070679_100070930 Ga0070679_1000709303 152
35 3300005530 Ga0070679_100143110 Ga0070679_1001431103 152
36 3300005530 Ga0070679_100375117 Ga0070679_1003751172 152
37 3300005539 Ga0068853_100122296 Ga0068853_1001222963 152
38 3300005539 Ga0068853_100158473 Ga0068853_1001584732 152
39 3300005548 Ga0070665_100058811 Ga0070665_1000588114 152
40 3300005563 Ga0068855_100006736 Ga0068855_10000673611 152
41 3300005563 Ga0068855_100034186 Ga0068855_1000341863 152
42 3300005563 Ga0068855_100039866 Ga0068855_1000398664 152
43 3300005577 Ga0068857_100059950 Ga0068857_1000599504 152
44 3300005577 Ga0068857_100177864 Ga0068857_1001778642 152
45 3300005577 Ga0068857_100274910 Ga0068857_1002749102 152
46 3300005614 Ga0068856_100235108 Ga0068856_1002351082 152
47 3300005616 Ga0068852_100292817 Ga0068852_1002928173 152
48 3300005618 Ga0068864_101373559 Ga0068864_1013735591 152
49 3300006175 Ga0070712_100107711 Ga0070712_1001077112 152
50 3300006175 Ga0070712_100670702 Ga0070712_1006707022 152
51 3300006237 Ga0097621_100225156 Ga0097621_1002251563 152
52 3300006881 Ga0068865_100058192 Ga0068865_1000581923 152
53 3300007788 Ga0099795_10044132 Ga0099795_100441323 152
54 3300009093 Ga0105240_10020640 Ga0105240_100206403 152
55 3300009093 Ga0105240_10051773 Ga0105240_100517734 152
56 3300009093 Ga0105240_10091482 Ga0105240_100914824 152
57 3300009093 Ga0105240_10097689 Ga0105240_100976893 152
58 3300009093 Ga0105240_10510645 Ga0105240_105106452 152
59 3300009093 Ga0105240_10621964 Ga0105240_106219642 152
60 3300009093 Ga0105240_10648063 Ga0105240_106480632 152
61 3300009093 Ga0105240_10920820 Ga0105240_109208202 152
62 3300009098 Ga0105245_10835704 Ga0105245_108357043 152
63 3300009148 Ga0105243_10001995 Ga0105243_1000199511 152
64 3300009174 Ga0105241_10082541 Ga0105241_100825413 152
65 3300009174 Ga0105241_10343966 Ga0105241_103439662 152
66 3300009174 Ga0105241_10346822 Ga0105241_103468222 152
67 3300009176 Ga0105242_10005119 Ga0105242_100051192 152
68 3300009177 Ga0105248_10000001 Ga0105248_10000001170 152
69 3300009177 Ga0105248_13328628 Ga0105248_133286281 152
70 3300009545 Ga0105237_10009725 Ga0105237_100097253 152
71 3300009545 Ga0105237_10060450 Ga0105237_100604504 152
72 3300009545 Ga0105237_10076531 Ga0105237_100765312 152
73 3300009545 Ga0105237_10548351 Ga0105237_105483513 152
74 3300009545 Ga0105237_10786874 Ga0105237_107868742 152
75 3300009551 Ga0105238_10076122 Ga0105238_100761224 152
76 3300009551 Ga0105238_10090912 Ga0105238_100909122 152
77 3300009551 Ga0105238_10165465 Ga0105238_101654651 152
78 3300009551 Ga0105238_10211596 Ga0105238_102115962 152
79 3300009551 Ga0105238_10285080 Ga0105238_102850802 152
80 3300009551 Ga0105238_11620901 Ga0105238_116209012 152
81 3300009551 Ga0105238_11780110 Ga0105238_117801102 152
82 3300010375 Ga0105239_10001205 Ga0105239_100012054 152
83 3300010375 Ga0105239_10007247 Ga0105239_1000724711 152
84 3300010375 Ga0105239_10028624 Ga0105239_100286243 152
85 3300010375 Ga0105239_10059716 Ga0105239_100597161 152
86 3300010375 Ga0105239_10129598 Ga0105239_101295982 152
87 3300010375 Ga0105239_10557107 Ga0105239_105571072 152
88 3300010375 Ga0105239_10620183 Ga0105239_106201832 152
89 3300010375 Ga0105239_10786906 Ga0105239_107869062 152
90 3300010375 Ga0105239_11743092 Ga0105239_117430921 152
91 3300013104 Ga0157370_10208258 Ga0157370_102082582 152
92 3300013104 Ga0157370_10609790 Ga0157370_106097902 152
93 3300013105 Ga0157369_10084863 Ga0157369_100848632 152
94 3300013105 Ga0157369_10114041 Ga0157369_101140412 152
95 3300013105 Ga0157369_10178107 Ga0157369_101781072 152
96 3300013105 Ga0157369_10736280 Ga0157369_107362802 152
97 3300013296 Ga0157374_10759273 Ga0157374_107592732 152
98 3300013297 Ga0157378_10205773 Ga0157378_102057732 152
99 3300013306 Ga0163162_11008041 Ga0163162_110080412 152
100 3300013307 Ga0157372_10029344 Ga0157372_100293445 152
101 3300014968 Ga0157379_10001491 Ga0157379_1000149114 152
102 3300014969 Ga0157376_10156867 Ga0157376_101568673 152
103 3300017792 Ga0163161_10783627 Ga0163161_107836271 152
104 3300025231 Ga0207427_108995 Ga0207427_1089951 152
105 3300025261 Ga0209233_1000013 Ga0209233_1000013224 152
106 3300025901 Ga0207688_10046842 Ga0207688_100468422 152
107 3300025907 Ga0207645_10252398 Ga0207645_102523982 152
108 3300025908 Ga0207643_10032728 Ga0207643_100327281 152
109 3300025909 Ga0207705_10021616 Ga0207705_100216162 152
110 3300025909 Ga0207705_10202204 Ga0207705_102022041 152
111 3300025912 Ga0207707_10000005 Ga0207707_10000005230 152
112 3300025912 Ga0207707_10189304 Ga0207707_101893043 152
113 3300025912 Ga0207707_10225575 Ga0207707_102255752 152
114 3300025913 Ga0207695_10005412 Ga0207695_100054122 152
115 3300025913 Ga0207695_10035209 Ga0207695_100352094 152
116 3300025913 Ga0207695_10157622 Ga0207695_101576222 152
117 3300025913 Ga0207695_10159565 Ga0207695_101595653 152
118 3300025913 Ga0207695_10159887 Ga0207695_101598873 152
119 3300025913 Ga0207695_10439511 Ga0207695_104395111 152
120 3300025914 Ga0207671_10008389 Ga0207671_100083893 152
121 3300025914 Ga0207671_10024795 Ga0207671_100247954 152
122 3300025914 Ga0207671_10249444 Ga0207671_102494442 152
123 3300025914 Ga0207671_10442926 Ga0207671_104429263 152
124 3300025915 Ga0207693_10121571 Ga0207693_101215712 152
125 3300025917 Ga0207660_10000540 Ga0207660_1000054010 152
126 3300025917 Ga0207660_10018036 Ga0207660_100180363 152
127 3300025919 Ga0207657_10141642 Ga0207657_101416422 152
128 3300025920 Ga0207649_10016755 Ga0207649_100167553 152
129 3300025921 Ga0207652_10114524 Ga0207652_101145243 152
130 3300025921 Ga0207652_10511556 Ga0207652_105115562 152
131 3300025921 Ga0207652_10593565 Ga0207652_105935651 152
132 3300025924 Ga0207694_10101336 Ga0207694_101013363 152
133 3300025924 Ga0207694_10537833 Ga0207694_105378332 152
134 3300025924 Ga0207694_11105616 Ga0207694_111056162 152
135 3300025926 Ga0207659_10189389 Ga0207659_101893892 152
136 3300025929 Ga0207664_10071796 Ga0207664_100717961 152
137 3300025933 Ga0207706_10240726 Ga0207706_102407263 152
138 3300025935 Ga0207709_10004305 Ga0207709_100043057 152
139 3300025938 Ga0207704_10551132 Ga0207704_105511322 152
140 3300025941 Ga0207711_10000002 Ga0207711_10000002871 152
141 3300025942 Ga0207689_10022240 Ga0207689_100222405 152
142 3300025942 Ga0207689_10081556 Ga0207689_100815562 152
143 3300025949 Ga0207667_10010491 Ga0207667_100104913 152
144 3300025949 Ga0207667_10649812 Ga0207667_106498122 152
145 3300026035 Ga0207703_11774989 Ga0207703_117749891 152
146 3300026041 Ga0207639_10033222 Ga0207639_100332222 152
147 3300026041 Ga0207639_10254994 Ga0207639_102549943 152
148 3300026067 Ga0207678_10362349 Ga0207678_103623492 152
149 3300026089 Ga0207648_10004006 Ga0207648_100040065 152
150 3300026089 Ga0207648_10131069 Ga0207648_101310693 152
151 3300026089 Ga0207648_11149692 Ga0207648_111496922 152
152 3300026116 Ga0207674_10028224 Ga0207674_100282246 152
153 3300026116 Ga0207674_10086040 Ga0207674_100860403 152
154 3300026116 Ga0207674_10981698 Ga0207674_109816982 152
155 3300026118 Ga0207675_100543459 Ga0207675_1005434592 152
156 3300026142 Ga0207698_10080851 Ga0207698_100808513 152
157 3300026142 Ga0207698_11099639 Ga0207698_110996391 152
158 3300028379 Ga0268266_11046642 Ga0268266_110466422 152
159 3300028556 Ga0265337_1000513 Ga0265337_100051316 152
160 3300028800 Ga0265338_10030321 Ga0265338_100303212 152
161 3300028800 Ga0265338_10125184 Ga0265338_101251841 152
162 3300028800 Ga0265338_10253983 Ga0265338_102539832 152
163 3300031241 Ga0265325_10001516 Ga0265325_1000151613 152
164 3300031247 Ga0265340_10000215 Ga0265340_1000021510 152
165 3300031247 Ga0265340_10197652 Ga0265340_101976522 152
166 3300031247 Ga0265340_10303075 Ga0265340_103030751 152
167 3300031249 Ga0265339_10038915 Ga0265339_100389154 152
168 3300031249 Ga0265339_10049735 Ga0265339_100497353 152
169 3300031249 Ga0265339_10220671 Ga0265339_102206712 152
170 3300031344 Ga0265316_10053000 Ga0265316_100530003 152
171 3300031344 Ga0265316_10500296 Ga0265316_105002962 152
172 3300031344 Ga0265316_10809650 Ga0265316_108096501 152
173 3300031595 Ga0265313_10051268 Ga0265313_100512682 152
174 3300031595 Ga0265313_10077084 Ga0265313_100770842 152
175 3300031711 Ga0265314_10043072 Ga0265314_100430722 152
176 3300031711 Ga0265314_10177500 Ga0265314_101775001 152
177 3300031711 Ga0265314_10373234 Ga0265314_103732342 152
178 3300031711 Ga0265314_10448642 Ga0265314_104486421 152
179 3300031712 Ga0265342_10133248 Ga0265342_101332482 152
180 3300035695 Ga0373927_0408421 Ga0373927_0408421_54_518 152
181 3300035725 Ga0373947_0286337 Ga0373947_0286337_452_916 152
182 3300037068 Ga0373925_0379913 Ga0373925_0379913_219_683 152
183 3300037312 Ga0395899_0069585 Ga0395899_0069585_1145_1609 152
184 3300037418 Ga0395900_0253559 Ga0395900_0253559_824_1288 152
185 3300037466 Ga0395898_0052836 Ga0395898_0052836_2415_2879 152
186 3300038443 Ga0395901_0165876 Ga0395901_0165876_571_1035 152
187 3300039437 Ga0436365_0104999 Ga0436365_0104999_108_569 152
188 3300039437 Ga0436365_1793097 Ga0436365_1793097_158_616 152
189 3300039453 Ga0436362_0439111 Ga0436362_0439111_20_478 152
190 3300046454 Ga0495592_0185887 Ga0495592_0185887_663_1121 152
191 3300046476 Ga0495662_0127152 Ga0495662_0127152_670_1134 152
192 3300046477 Ga0495664_0365424 Ga0495664_0365424_180_644 152
193 3300046477 Ga0495664_0483774 Ga0495664_0483774_70_528 152
194 3300046477 Ga0495664_0770605 Ga0495664_0770605_35_499 152
195 3300046516 Ga0495628_0242851 Ga0495628_0242851_605_1069 152
196 3300046517 Ga0495630_0905890 Ga0495630_0905890_168_626 152
197 3300046529 Ga0495652_0228415 Ga0495652_0228415_612_1070 152
198 3300046536 Ga0495587_0023844 Ga0495587_0023844_1795_2259 152
199 3300046543 Ga0495645_0245208 Ga0495645_0245208_47_505 152
200 3300046678 Ga0495599_0294086 Ga0495599_0294086_397_861 152
201 3300046690 Ga0495624_0236022 Ga0495624_0236022_196_660 152
202 3300046691 Ga0495670_0374626 Ga0495670_0374626_13_471 152
203 3300047444 Ga0495675_0043451 Ga0495675_0043451_566_1024 152
204 3300048088 Ga0495602_0026069 Ga0495602_0026069_4060_4524 152
205 3300048903 Ga0496100_1410887 Ga0496100_1410887_18_476 152
206 3300049569 Ga0501032_0053015 Ga0501032_0053015_775_1233 152
207 3300049569 Ga0501032_0392620 Ga0501032_0392620_41_499 152
208 3300049569 Ga0501032_0432547 Ga0501032_0432547_355_828 152
209 3300049570 Ga0501033_0023697 Ga0501033_0023697_2485_2949 152
210 3300049570 Ga0501033_0045319 Ga0501033_0045319_1297_1755 152
211 3300049570 Ga0501033_0087782 Ga0501033_0087782_929_1396 152
212 3300049570 Ga0501033_0104985 Ga0501033_0104985_125_583 152
213 3300049570 Ga0501033_0203274 Ga0501033_0203274_522_980 152
214 3300049571 Ga0501034_0042033 Ga0501034_0042033_3816_4274 152
215 3300049571 Ga0501034_0098899 Ga0501034_0098899_1801_2259 152
216 3300049571 Ga0501034_0232698 Ga0501034_0232698_769_1227 152
217 3300049571 Ga0501034_0243456 Ga0501034_0243456_679_1146 152
218 3300049571 Ga0501034_0465722 Ga0501034_0465722_546_1004 152
219 3300049571 Ga0501034_0589692 Ga0501034_0589692_394_858 152
220 3300049572 Ga0501036_0171580 Ga0501036_0171580_1029_1487 152
221 3300049572 Ga0501036_0359249 Ga0501036_0359249_397_861 152
222 3300049572 Ga0501036_0725312 Ga0501036_0725312_162_620 152
223 3300049573 Ga0501037_0031335 Ga0501037_0031335_479_937 152
224 3300049574 Ga0501038_0102140 Ga0501038_0102140_1038_1496 152
225 3300049575 Ga0501039_0042977 Ga0501039_0042977_2260_2718 152
226 3300049575 Ga0501039_0691032 Ga0501039_0691032_124_582 152
227 3300049578 Ga0501042_0004549 Ga0501042_0004549_7051_7509 152
228 3300049579 Ga0501043_0024278 Ga0501043_0024278_1039_1497 152
229 3300049579 Ga0501043_0252840 Ga0501043_0252840_25_483 152
230 3300049579 Ga0501043_0478650 Ga0501043_0478650_153_617 152
231 3300049579 Ga0501043_0812080 Ga0501043_0812080_29_487 152
232 3300049580 Ga0501046_0014609 Ga0501046_0014609_2536_2994 152
233 3300049580 Ga0501046_0025719 Ga0501046_0025719_1945_2403 152
234 3300049580 Ga0501046_0131324 Ga0501046_0131324_1365_1823 152
235 3300049580 Ga0501046_0302592 Ga0501046_0302592_404_868 152
236 3300049581 Ga0501047_0002210 Ga0501047_0002210_16852_17310 152
237 3300049581 Ga0501047_0005989 Ga0501047_0005989_4744_5202 152
238 3300049581 Ga0501047_0006743 Ga0501047_0006743_9277_9735 152
239 3300049581 Ga0501047_0040198 Ga0501047_0040198_3104_3568 152
240 3300049581 Ga0501047_0048151 Ga0501047_0048151_478_936 152
241 3300049581 Ga0501047_0063299 Ga0501047_0063299_1489_1947 152
242 3300049581 Ga0501047_0166791 Ga0501047_0166791_344_802 152
243 3300049581 Ga0501047_0278875 Ga0501047_0278875_1023_1481 152
244 3300049581 Ga0501047_0339539 Ga0501047_0339539_163_627 152
245 3300049581 Ga0501047_0541956 Ga0501047_0541956_132_590 152
246 3300049581 Ga0501047_1013721 Ga0501047_1013721_30_488 152
247 3300049582 Ga0501048_0074300 Ga0501048_0074300_1113_1571 152
248 3300049583 Ga0501067_0008182 Ga0501067_0008182_4386_4844 152
249 3300049583 Ga0501067_0121253 Ga0501067_0121253_591_1049 152
250 3300049584 Ga0501068_0086806 Ga0501068_0086806_783_1241 152
251 3300049586 Ga0501070_0059594 Ga0501070_0059594_1673_2131 152
252 3300049586 Ga0501070_0141120 Ga0501070_0141120_1434_1892 152
253 3300049586 Ga0501070_0155299 Ga0501070_0155299_1351_1818 152
254 3300049586 Ga0501070_0234676 Ga0501070_0234676_477_935 152
255 3300049588 Ga0501072_0001422 Ga0501072_0001422_10496_10954 152
256 3300049589 Ga0501073_0005612 Ga0501073_0005612_3299_3757 152
257 3300049589 Ga0501073_0076010 Ga0501073_0076010_998_1456 152
258 3300049589 Ga0501073_0224318 Ga0501073_0224318_437_901 152
259 3300049590 Ga0501074_0073632 Ga0501074_0073632_637_1095 152
260 3300049590 Ga0501074_0100368 Ga0501074_0100368_1539_1997 152
261 3300049590 Ga0501074_0146172 Ga0501074_0146172_428_937 152
262 3300049741 Ga0501079_0253164 Ga0501079_0253164_211_669 152
263 3300049741 Ga0501079_0313159 Ga0501079_0313159_461_919 152
264 3300049742 Ga0501080_0017229 Ga0501080_0017229_3816_4274 152
265 3300049742 Ga0501080_0018541 Ga0501080_0018541_5267_5725 152
266 3300049742 Ga0501080_0125277 Ga0501080_0125277_924_1382 152
267 3300049742 Ga0501080_0403147 Ga0501080_0403147_242_706 152
268 3300049742 Ga0501080_0565771 Ga0501080_0565771_51_560 152
269 3300049742 Ga0501080_0605286 Ga0501080_0605286_390_848 152
270 3300049742 Ga0501080_0609500 Ga0501080_0609500_457_924 152
271 3300049742 Ga0501080_0621090 Ga0501080_0621090_142_600 152
272 3300049742 Ga0501080_1259477 Ga0501080_1259477_89_553 152
273 3300049744 Ga0501083_0444345 Ga0501083_0444345_63_521 152
274 3300049822 Ga0501035_0006183 Ga0501035_0006183_1703_2161 152
275 3300049822 Ga0501035_0129469 Ga0501035_0129469_530_994 152
276 3300049822 Ga0501035_0574307 Ga0501035_0574307_56_514 152
277 3300049823 Ga0501044_0005565 Ga0501044_0005565_9503_9961 152
278 3300049823 Ga0501044_0010411 Ga0501044_0010411_5167_5625 152
279 3300049823 Ga0501044_0026121 Ga0501044_0026121_4247_4711 152
280 3300049823 Ga0501044_0052538 Ga0501044_0052538_125_583 152
281 3300049823 Ga0501044_0100829 Ga0501044_0100829_2314_2781 152
282 3300049823 Ga0501044_0189793 Ga0501044_0189793_244_702 152
283 3300049823 Ga0501044_0225307 Ga0501044_0225307_1009_1467 152
284 3300049823 Ga0501044_0227314 Ga0501044_0227314_1153_1611 152
285 3300049823 Ga0501044_0232282 Ga0501044_0232282_1098_1661 152
286 3300049823 Ga0501044_0270416 Ga0501044_0270416_1162_1620 152
287 3300049823 Ga0501044_0340278 Ga0501044_0340278_345_803 152
288 3300049823 Ga0501044_0879799 Ga0501044_0879799_297_755 152
289 3300049824 Ga0501045_0075181 Ga0501045_0075181_834_1292 152
290 3300053119 Ga0500595_000303 Ga0500595_000303_15765_16223 152
291 3300053136 Ga0500559_0036390 Ga0500559_0036390_13_471 152
292 3300053140 Ga0500573_0000003 Ga0500573_0000003_127001_127459 152
293 3300053154 Ga0500619_000410 Ga0500619_000410_2825_3283 152
294 3300054114 Ga0501084_0038494 Ga0501084_0038494_914_1372 152
295 3300054114 Ga0501084_0157917 Ga0501084_0157917_842_1300 152
296 3300054114 Ga0501084_0163785 Ga0501084_0163785_783_1241 152
297 3300060353 Ga0501082_0009272 Ga0501082_0009272_7644_8102 152
298 3300060353 Ga0501082_0482037 Ga0501082_0482037_576_1034 152

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04364

DNA_pol3_chi

DNA polymerase III chi subunit, HolC

36

173

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3sxu-assembly1.cif.gz_A structure of the e. coli ssb-dna polymerase iii interface 0.8537 2 139
3sxu-assembly1.cif.gz_A structure of the e. coli ssb-dna polymerase iii interface 0.8054 2 139
2wzq-assembly1.cif.gz_A insertion mutant e173gp174 of the ns3 protease-helicase from dengue virus 0.7323 3 111
5vi7-assembly1.cif.gz_A crystal structure of the zika virus ns3 helicase 0.7224 4 111
5yvw-assembly1.cif.gz_B crystal structure of full length ns3 protein (ed4ns2bns3) from denv4 in closed conformation 0.7217 3 111
ID Description Score Start End Superfamily
1em8C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;DNA polymerase III subunit chi 0.8441 1 139 3.40.50.10110
1em8C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;DNA polymerase III subunit chi 0.7971 1 139 3.40.50.10110
af_C0H5F0_492_697_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7602 9 48 3.40.50.300
af_A0A140LFS6_48_320_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7373 8 76 3.40.50.300
af_K7M6B0_421_558_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7224 3 115 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1M3ABW7-F1-model_v4 deleted 0.9776 1 152
AF-A0A0Q8IMN7-F1-model_v4 DNA polymerase III subunit chi 0.9732 1 152 GO:0003677
GO:0003887
GO:0006260
GO:0032298
AF-A0A0C6F973-F1-model_v4 DNA polymerase III subunit chi 0.9723 2 152 GO:0003677
GO:0003887
GO:0006260
GO:0032298
AF-A0A353YD97-F1-model_v4 DNA polymerase III subunit chi 0.9723 1 79 GO:0003677
GO:0003887
GO:0006260
GO:0032298
AF-A0A368A2Q3-F1-model_v4 DNA polymerase III subunit chi 0.9712 1 152 GO:0003677
GO:0003887
GO:0006260
GO:0032298

Feature Viewer

pLDDT pTM Quality
93.45 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map