F394513

General Info

Members Datasets Scaffolds Average Seq Length
298 159 596 138

Family's Representative Sequence

Representative Sequence 3300049575|Ga0501039_1196523|Ga0501039_1196523_78_500
Length 140
Sequence MKQPKVSKAAEAIDELQNLFKALADKTRLRILALLGNNEVCVCHIHDSLGLPQPTVSRHLAYLRKSGLVAARRDGVWMHYQVSRSLNPVIQGVVAAAVDALQPATTQDRKQFQRSFGQLYVLDSAAGGACCAPRAQESQP

Samples

Sample ID Description Type Environment
1 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
124 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
125 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
126 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
127 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
128 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
129 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
130 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
131 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
132 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
133 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
134 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
135 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
136 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
137 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
138 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
141 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
142 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
143 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
144 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
145 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
146 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
147 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
150 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
151 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
152 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
153 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
154 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
155 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
156 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
157 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
158 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
159 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.67
Nodule 0
Rhizoplane 0.67
Rhizosphere 98.66
Stem 0
Stem Tuber 0
Unclassified 22.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501039_1196523 3300049575 Unclassified 588
2 JGI24751J29686_10073078 3300002459 Bacteria 708
3 JGI25406J46586_10080786 3300003203 Unclassified 997
4 Ga0065714_10147722 3300005288 Bacteria 1126
5 Ga0065714_10243092 3300005288 Unclassified 791
6 Ga0065712_10017924 3300005290 Bacteria 1630
7 Ga0065712_10044704 3300005290 Bacteria 977
8 Ga0065712_10067868 3300005290 Bacteria 24325
9 Ga0065712_10327137 3300005290 Unclassified 819
10 Ga0065712_10510716 3300005290 Unclassified 642
11 Ga0065715_10110400 3300005293 Bacteria 2622
12 Ga0065715_10309149 3300005293 Bacteria 1024
13 Ga0065715_10330936 3300005293 Unclassified 984
14 Ga0065715_10818078 3300005293 Unclassified 603
15 Ga0065707_10100165 3300005295 Bacteria 2951
16 Ga0065707_10123476 3300005295 Bacteria 2058
17 Ga0070690_100102624 3300005330 Bacteria 1898
18 Ga0070690_100420963 3300005330 Bacteria 985
19 Ga0070670_100000414 3300005331 Bacteria 35226
20 Ga0070670_100032814 3300005331 Bacteria 4473
21 Ga0070677_10043658 3300005333 Bacteria 1781
22 Ga0068869_100254001 3300005334 Bacteria 1405
23 Ga0068869_101189273 3300005334 Unclassified 670
24 Ga0070666_10015787 3300005335 Unclassified 4823
25 Ga0068868_101577377 3300005338 Bacteria 616
26 Ga0070660_101109071 3300005339 Unclassified 670
27 Ga0070689_100069919 3300005340 Bacteria 2740
28 Ga0070689_100193559 3300005340 Bacteria 1656
29 Ga0070692_10281912 3300005345 Bacteria 1007
30 Ga0070668_100176323 3300005347 Bacteria 1743
31 Ga0070668_100841480 3300005347 Bacteria 817
32 Ga0070669_101080481 3300005353 Unclassified 690
33 Ga0070669_101951336 3300005353 Unclassified 513
34 Ga0070675_100008740 3300005354 Bacteria 7868
35 Ga0070675_100012483 3300005354 Bacteria 6658
36 Ga0070675_100144529 3300005354 Bacteria 2035
37 Ga0070671_100383667 3300005355 Bacteria 1201
38 Ga0070674_100100358 3300005356 Unclassified 2107
39 Ga0070674_100505724 3300005356 Bacteria 1007
40 Ga0070674_100592510 3300005356 Bacteria 935
41 Ga0070674_100900508 3300005356 Unclassified 770
42 Ga0070673_100591233 3300005364 Bacteria 1012
43 Ga0070673_101077410 3300005364 Bacteria 750
44 Ga0070688_100159980 3300005365 Bacteria 1546
45 Ga0070667_100120499 3300005367 Bacteria 2282
46 Ga0070709_10121966 3300005434 Bacteria 1768
47 Ga0070700_100149197 3300005441 Bacteria 1597
48 Ga0070700_100188608 3300005441 Bacteria 1440
49 Ga0070700_100339634 3300005441 Bacteria 1110
50 Ga0070700_100945526 3300005441 Unclassified 705
51 Ga0070694_100474755 3300005444 Bacteria 991
52 Ga0070663_100121844 3300005455 Bacteria 1971
53 Ga0070678_100958491 3300005456 Unclassified 785
54 Ga0070662_100134952 3300005457 Bacteria 1907
55 Ga0070662_100222293 3300005457 Bacteria 1507
56 Ga0070662_100314183 3300005457 Bacteria 1276
57 Ga0070662_101300543 3300005457 Unclassified 626
58 Ga0068867_100025032 3300005459 Bacteria 4280
59 Ga0068867_101614387 3300005459 Unclassified 606
60 Ga0070685_10047284 3300005466 Bacteria 2474
61 Ga0070685_10278794 3300005466 Bacteria 1118
62 Ga0070698_100258961 3300005471 Bacteria 1672
63 Ga0070699_100854434 3300005518 Bacteria 833
64 Ga0070699_101138422 3300005518 Bacteria 716
65 Ga0070672_100096162 3300005543 Bacteria 2396
66 Ga0070672_100312349 3300005543 Bacteria 1335
67 Ga0070686_100562264 3300005544 Bacteria 894
68 Ga0070686_101040527 3300005544 Unclassified 673
69 Ga0070695_100909885 3300005545 Bacteria 711
70 Ga0070696_100117443 3300005546 Bacteria 1922
71 Ga0070665_100568884 3300005548 Bacteria 1146
72 Ga0070704_100288354 3300005549 Bacteria 1363
73 Ga0070664_100328226 3300005564 Bacteria 1388
74 Ga0070664_100563495 3300005564 Bacteria 1054
75 Ga0070664_101346076 3300005564 Bacteria 675
76 Ga0068857_100999423 3300005577 Bacteria 805
77 Ga0068857_102209110 3300005577 Unclassified 540
78 Ga0070702_100449797 3300005615 Bacteria 934
79 Ga0070702_100938449 3300005615 Unclassified 680
80 Ga0068859_100174245 3300005617 Bacteria 2233
81 Ga0068859_101219586 3300005617 Unclassified 829
82 Ga0068864_100036824 3300005618 Bacteria 4172
83 Ga0068864_100835007 3300005618 Unclassified 907
84 Ga0068861_100089171 3300005719 Bacteria 2430
85 Ga0068861_100641058 3300005719 Unclassified 980
86 Ga0068861_101120813 3300005719 Unclassified 757
87 Ga0068861_102464814 3300005719 Bacteria 523
88 Ga0068870_10003188 3300005840 Bacteria 6918
89 Ga0068863_100215031 3300005841 Bacteria 1851
90 Ga0068858_101668349 3300005842 Unclassified 629
91 Ga0068860_101601933 3300005843 Bacteria 673
92 Ga0068862_100297750 3300005844 Bacteria 1483
93 Ga0068862_100556226 3300005844 Bacteria 1096
94 Ga0068862_101395739 3300005844 Unclassified 704
95 Ga0081538_10041769 3300005981 Bacteria 2904
96 Ga0081539_10002277 3300005985 Bacteria 27822
97 Ga0075427_10096309 3300006194 Unclassified 547
98 Ga0075366_10225676 3300006195 Bacteria 1141
99 Ga0097621_100071695 3300006237 Bacteria 2864
100 Ga0068871_100092134 3300006358 Bacteria 2527
101 Ga0075428_100025258 3300006844 Bacteria 6574
102 Ga0075430_100017988 3300006846 Bacteria 6017
103 Ga0075430_100221437 3300006846 Bacteria 1570
104 Ga0075431_100008017 3300006847 Bacteria 10538
105 Ga0075431_100012908 3300006847 Bacteria 8433
106 Ga0075431_100703015 3300006847 Bacteria 988
107 Ga0075433_10037478 3300006852 Bacteria 4183
108 Ga0075433_10358596 3300006852 Bacteria 1288
109 Ga0075433_10781856 3300006852 Unclassified 834
110 Ga0075433_10835357 3300006852 Bacteria 804
111 Ga0075434_100000098 3300006871 Bacteria 48574
112 Ga0075434_100097428 3300006871 Bacteria 2946
113 Ga0075429_100020919 3300006880 Bacteria 5677
114 Ga0075429_100290226 3300006880 Bacteria 1432
115 Ga0075429_101225546 3300006880 Unclassified 655
116 Ga0068865_100718742 3300006881 Bacteria 855
117 Ga0075436_100000037 3300006914 Bacteria 83376
118 Ga0097620_100174247 3300006931 Bacteria 2233
119 Ga0097620_101219628 3300006931 Unclassified 829
120 Ga0075435_100000020 3300007076 Bacteria 91240
121 Ga0075435_100678511 3300007076 Bacteria 895
122 Ga0111539_10004703 3300009094 Bacteria 17848
123 Ga0111539_10014210 3300009094 Bacteria 9942
124 Ga0111539_10034476 3300009094 Bacteria 6137
125 Ga0111539_10040955 3300009094 Bacteria 5573
126 Ga0111539_10081309 3300009094 Bacteria 3811
127 Ga0111539_10362489 3300009094 Bacteria 1687
128 Ga0111539_10814888 3300009094 Bacteria 1086
129 Ga0111539_11942250 3300009094 Unclassified 682
130 Ga0105247_10544493 3300009101 Bacteria 852
131 Ga0114129_10008904 3300009147 Bacteria 14311
132 Ga0114129_10176250 3300009147 Bacteria 2912
133 Ga0114129_10327313 3300009147 Bacteria 2036
134 Ga0114129_12034649 3300009147 Unclassified 694
135 Ga0105242_10725680 3300009176 Bacteria 975
136 Ga0105242_12404028 3300009176 Unclassified 574
137 Ga0105249_10739010 3300009553 Bacteria 1046
138 Ga0157373_11173084 3300013100 Unclassified 578
139 Ga0157371_10855069 3300013102 Bacteria 688
140 Ga0157378_10324297 3300013297 Bacteria 1497
141 Ga0163162_10324229 3300013306 Bacteria 1673
142 Ga0163162_10384092 3300013306 Bacteria 1537
143 Ga0163162_10453133 3300013306 Bacteria 1415
144 Ga0163163_10138696 3300014325 Bacteria 2473
145 Ga0163163_10142335 3300014325 Bacteria 2441
146 Ga0163163_10388324 3300014325 Bacteria 1454
147 Ga0157380_10115501 3300014326 Bacteria 2264
148 Ga0157380_10396046 3300014326 Unclassified 1308
149 Ga0157380_11058295 3300014326 Unclassified 848
150 Ga0157380_11925496 3300014326 Bacteria 652
151 Ga0157380_12466715 3300014326 Bacteria 586
152 Ga0157377_10035979 3300014745 Bacteria 2720
153 Ga0157377_10050207 3300014745 Bacteria 2348
154 Ga0157377_10083499 3300014745 Bacteria 1872
155 Ga0157376_10044762 3300014969 Bacteria 3640
156 Ga0157376_10800739 3300014969 Unclassified 955
157 Ga0157376_11059631 3300014969 Bacteria 835
158 Ga0163161_10078817 3300017792 Bacteria 2421
159 Ga0207682_10015911 3300025893 Bacteria 2931
160 Ga0207688_10177112 3300025901 Bacteria 1270
161 Ga0207688_10179495 3300025901 Unclassified 1262
162 Ga0207688_10278074 3300025901 Unclassified 1019
163 Ga0207699_10228598 3300025906 Bacteria 1273
164 Ga0207645_10292674 3300025907 Bacteria 1083
165 Ga0207643_10008572 3300025908 Bacteria 5484
166 Ga0207643_10023307 3300025908 Bacteria 3413
167 Ga0207660_10330450 3300025917 Bacteria 1219
168 Ga0207646_10747672 3300025922 Bacteria 873
169 Ga0207681_10216837 3300025923 Bacteria 1478
170 Ga0207681_11026332 3300025923 Unclassified 692
171 Ga0207681_11236332 3300025923 Bacteria 627
172 Ga0207650_10029238 3300025925 Bacteria 3960
173 Ga0207659_10003582 3300025926 Bacteria 9349
174 Ga0207659_10244379 3300025926 Bacteria 1453
175 Ga0207659_11451838 3300025926 Unclassified 587
176 Ga0207644_10321171 3300025931 Bacteria 1252
177 Ga0207706_10037563 3300025933 Bacteria 4299
178 Ga0207706_10089285 3300025933 Bacteria 2710
179 Ga0207706_10130061 3300025933 Bacteria 2214
180 Ga0207670_10012229 3300025936 Bacteria 5014
181 Ga0207670_10070561 3300025936 Bacteria 2414
182 Ga0207669_10139943 3300025937 Bacteria 1678
183 Ga0207669_10741945 3300025937 Unclassified 810
184 Ga0207704_10939793 3300025938 Unclassified 729
185 Ga0207704_11328862 3300025938 Unclassified 615
186 Ga0207691_10072865 3300025940 Bacteria 3098
187 Ga0207691_10119032 3300025940 Bacteria 2342
188 Ga0207691_11100863 3300025940 Bacteria 661
189 Ga0207689_10150427 3300025942 Bacteria 1919
190 Ga0207689_10170903 3300025942 Bacteria 1792
191 Ga0207679_10104960 3300025945 Bacteria 2218
192 Ga0207679_10471789 3300025945 Bacteria 1116
193 Ga0207679_10890643 3300025945 Unclassified 814
194 Ga0207651_10132195 3300025960 Bacteria 1912
195 Ga0207651_10877237 3300025960 Bacteria 798
196 Ga0207668_10354354 3300025972 Bacteria 1228
197 Ga0207668_10732229 3300025972 Unclassified 871
198 Ga0207658_10159653 3300025986 Bacteria 1847
199 Ga0207677_11305027 3300026023 Bacteria 667
200 Ga0207678_10035559 3300026067 Bacteria 4337
201 Ga0207708_10077793 3300026075 Bacteria 2546
202 Ga0207708_10143907 3300026075 Bacteria 1872
203 Ga0207708_10174933 3300026075 Bacteria 1702
204 Ga0207708_10312220 3300026075 Bacteria 1281
205 Ga0207641_10195133 3300026088 Bacteria 1863
206 Ga0207648_10068641 3300026089 Bacteria 3089
207 Ga0207648_11245181 3300026089 Bacteria 699
208 Ga0207648_11836398 3300026089 Bacteria 568
209 Ga0207676_10032474 3300026095 Bacteria 3934
210 Ga0207676_10060743 3300026095 Bacteria 2991
211 Ga0207676_10453193 3300026095 Unclassified 1210
212 Ga0207674_10091722 3300026116 Bacteria 3028
213 Ga0207674_11290165 3300026116 Bacteria 700
214 Ga0207675_100079224 3300026118 Bacteria 3078
215 Ga0207675_101080361 3300026118 Unclassified 822
216 Ga0207675_101899986 3300026118 Bacteria 614
217 Ga0207675_102079890 3300026118 Unclassified 584
218 Ga0207683_10320966 3300026121 Bacteria 1419
219 Ga0207683_11092492 3300026121 Bacteria 740
220 Ga0207683_11330415 3300026121 Unclassified 665
221 Ga0209970_1010316 3300027614 Bacteria 1527
222 Ga0209971_1029442 3300027682 Bacteria 1315
223 Ga0209974_10208119 3300027876 Unclassified 724
224 Ga0207428_10005748 3300027907 Bacteria 11519
225 Ga0207428_10071730 3300027907 Bacteria 2719
226 Ga0207428_10128083 3300027907 Bacteria 1943
227 Ga0207428_10549694 3300027907 Bacteria 835
228 Ga0268266_10263913 3300028379 Bacteria 1597
229 Ga0268266_11271874 3300028379 Unclassified 711
230 Ga0268266_11315001 3300028379 Bacteria 698
231 Ga0268265_10086081 3300028380 Bacteria 2497
232 Ga0268265_10159068 3300028380 Bacteria 1916
233 Ga0268265_10421661 3300028380 Bacteria 1239
234 Ga0268265_10720138 3300028380 Bacteria 966
235 Ga0307408_100072470 3300031548 Bacteria 2550
236 Ga0307408_101478039 3300031548 Unclassified 642
237 Ga0307405_10052448 3300031731 Bacteria 2536
238 Ga0307406_10069205 3300031901 Bacteria 2307
239 Ga0307412_10494881 3300031911 Bacteria 1017
240 Ga0307416_100420751 3300032002 Bacteria 1380
241 Ga0307416_100970055 3300032002 Bacteria 952
242 Ga0307416_101733419 3300032002 Unclassified 729
243 Ga0307411_11935037 3300032005 Unclassified 549
244 Ga0307415_100819184 3300032126 Bacteria 851
245 Ga0439444_0175254 3300042437 Unclassified 530
246 Ga0439464_0143164 3300042439 Bacteria 745
247 Ga0439460_0018699 3300042461 Bacteria 1869
248 Ga0439440_0002607 3300042993 Bacteria 3416
249 Ga0451576_1541645 3300045051 Bacteria 690
250 Ga0495594_0365147 3300046499 Unclassified 822
251 Ga0495643_0005137 3300046522 Bacteria 8941
252 Ga0495633_0068159 3300046558 Bacteria 1661
253 Ga0495656_0275459 3300046615 Unclassified 856
254 Ga0495659_0185416 3300046664 Bacteria 849
255 Ga0495647_0205346 3300046681 Bacteria 865
256 Ga0496100_0724709 3300048903 Bacteria 777
257 Ga0496113_0056720 3300048916 Bacteria 2942
258 Ga0501041_0198618 3300049577 Bacteria 1257
259 Ga0501041_0243219 3300049577 Unclassified 1131
260 Ga0501042_0330296 3300049578 Bacteria 1102
261 Ga0501072_0782570 3300049588 Bacteria 748
262 Ga0501076_1455235 3300049592 Unclassified 563
263 Ga0501077_0700294 3300049593 Unclassified 651
264 Ga0501221_114823 3300049704 Bacteria 682
265 Ga0501225_0050171 3300049705 Bacteria 1161
266 Ga0501225_0069704 3300049705 Bacteria 999
267 Ga0501081_0427263 3300049743 Bacteria 983
268 Ga0501045_1160282 3300049824 Unclassified 564
269 nmdc:mga07m45_658162_c1 3300050496 Bacteria 603
270 nmdc:mga05p37_131977_c1 3300050507 Bacteria 3065
271 nmdc:mga05p37_367_c1 3300050507 Bacteria 48570
272 nmdc:mga05p37_54944_c1 3300050507 Bacteria 4898
273 nmdc:mga05p37_766358_c1 3300050507 Unclassified 1061
274 nmdc:mga09592_15370_c1 3300050508 Bacteria 6251
275 nmdc:mga09592_842668_c1 3300050508 Unclassified 773
276 nmdc:mga0qj67_10220_c1 3300050509 Bacteria 7007
277 nmdc:mga0qj67_14749_c1 3300050509 Bacteria 5907
278 nmdc:mga0qj67_389550_c1 3300050509 Bacteria 1125
279 nmdc:mga06r32_268055_c1 3300050510 Bacteria 1695
280 nmdc:mga06r32_41689_c1 3300050510 Bacteria 4363
281 nmdc:mga06r32_74424_c1 3300050510 Bacteria 3293
282 nmdc:mga08y16_1727_c1 3300050511 Bacteria 22179
283 nmdc:mga08y16_340645_c1 3300050511 Bacteria 1541
284 nmdc:mga08y16_810134_c1 3300050511 Bacteria 929
285 nmdc:mga08y16_9425_c1 3300050511 Bacteria 10239
286 nmdc:mga08y16_97167_c1 3300050511 Bacteria 3067
287 nmdc:mga0n895_157383_c1 3300050512 Bacteria 2303
288 nmdc:mga0n895_80_c1 3300050512 Bacteria 54788
289 nmdc:mga0rr50_35_c1 3300050513 Bacteria 91254
290 nmdc:mga0rr50_407516_c1 3300050513 Bacteria 1149
291 nmdc:mga08x19_64_c2 3300050514 Bacteria 86912
292 nmdc:mga0a205_1116294_c1 3300050515 Unclassified 636
293 nmdc:mga0a205_36813_c2 3300050515 Bacteria 3445
294 nmdc:mga0a205_466380_c1 3300050515 Bacteria 1122
295 Ga0501084_1553202 3300054114 Unclassified 554
296 Ga0590071_052193 3300059421 Bacteria 992
297 Ga0501082_0376449 3300060353 Bacteria 1239
298 Ga0501082_0493920 3300060353 Bacteria 1070
299 Ga0501039_1196523
300 JGI24751J29686_10073078
301 JGI25406J46586_10080786
302 Ga0065714_10147722
303 Ga0065714_10243092
304 Ga0065712_10017924
305 Ga0065712_10044704
306 Ga0065712_10067868
307 Ga0065712_10327137
308 Ga0065712_10510716
309 Ga0065715_10110400
310 Ga0065715_10309149
311 Ga0065715_10330936
312 Ga0065715_10818078
313 Ga0065707_10100165
314 Ga0065707_10123476
315 Ga0070690_100102624
316 Ga0070690_100420963
317 Ga0070670_100000414
318 Ga0070670_100032814
319 Ga0070677_10043658
320 Ga0068869_100254001
321 Ga0068869_101189273
322 Ga0070666_10015787
323 Ga0068868_101577377
324 Ga0070660_101109071
325 Ga0070689_100069919
326 Ga0070689_100193559
327 Ga0070692_10281912
328 Ga0070668_100176323
329 Ga0070668_100841480
330 Ga0070669_101080481
331 Ga0070669_101951336
332 Ga0070675_100008740
333 Ga0070675_100012483
334 Ga0070675_100144529
335 Ga0070671_100383667
336 Ga0070674_100100358
337 Ga0070674_100505724
338 Ga0070674_100592510
339 Ga0070674_100900508
340 Ga0070673_100591233
341 Ga0070673_101077410
342 Ga0070688_100159980
343 Ga0070667_100120499
344 Ga0070709_10121966
345 Ga0070700_100149197
346 Ga0070700_100188608
347 Ga0070700_100339634
348 Ga0070700_100945526
349 Ga0070694_100474755
350 Ga0070663_100121844
351 Ga0070678_100958491
352 Ga0070662_100134952
353 Ga0070662_100222293
354 Ga0070662_100314183
355 Ga0070662_101300543
356 Ga0068867_100025032
357 Ga0068867_101614387
358 Ga0070685_10047284
359 Ga0070685_10278794
360 Ga0070698_100258961
361 Ga0070699_100854434
362 Ga0070699_101138422
363 Ga0070672_100096162
364 Ga0070672_100312349
365 Ga0070686_100562264
366 Ga0070686_101040527
367 Ga0070695_100909885
368 Ga0070696_100117443
369 Ga0070665_100568884
370 Ga0070704_100288354
371 Ga0070664_100328226
372 Ga0070664_100563495
373 Ga0070664_101346076
374 Ga0068857_100999423
375 Ga0068857_102209110
376 Ga0070702_100449797
377 Ga0070702_100938449
378 Ga0068859_100174245
379 Ga0068859_101219586
380 Ga0068864_100036824
381 Ga0068864_100835007
382 Ga0068861_100089171
383 Ga0068861_100641058
384 Ga0068861_101120813
385 Ga0068861_102464814
386 Ga0068870_10003188
387 Ga0068863_100215031
388 Ga0068858_101668349
389 Ga0068860_101601933
390 Ga0068862_100297750
391 Ga0068862_100556226
392 Ga0068862_101395739
393 Ga0081538_10041769
394 Ga0081539_10002277
395 Ga0075427_10096309
396 Ga0075366_10225676
397 Ga0097621_100071695
398 Ga0068871_100092134
399 Ga0075428_100025258
400 Ga0075430_100017988
401 Ga0075430_100221437
402 Ga0075431_100008017
403 Ga0075431_100012908
404 Ga0075431_100703015
405 Ga0075433_10037478
406 Ga0075433_10358596
407 Ga0075433_10781856
408 Ga0075433_10835357
409 Ga0075434_100000098
410 Ga0075434_100097428
411 Ga0075429_100020919
412 Ga0075429_100290226
413 Ga0075429_101225546
414 Ga0068865_100718742
415 Ga0075436_100000037
416 Ga0097620_100174247
417 Ga0097620_101219628
418 Ga0075435_100000020
419 Ga0075435_100678511
420 Ga0111539_10004703
421 Ga0111539_10014210
422 Ga0111539_10034476
423 Ga0111539_10040955
424 Ga0111539_10081309
425 Ga0111539_10362489
426 Ga0111539_10814888
427 Ga0111539_11942250
428 Ga0105247_10544493
429 Ga0114129_10008904
430 Ga0114129_10176250
431 Ga0114129_10327313
432 Ga0114129_12034649
433 Ga0105242_10725680
434 Ga0105242_12404028
435 Ga0105249_10739010
436 Ga0157373_11173084
437 Ga0157371_10855069
438 Ga0157378_10324297
439 Ga0163162_10324229
440 Ga0163162_10384092
441 Ga0163162_10453133
442 Ga0163163_10138696
443 Ga0163163_10142335
444 Ga0163163_10388324
445 Ga0157380_10115501
446 Ga0157380_10396046
447 Ga0157380_11058295
448 Ga0157380_11925496
449 Ga0157380_12466715
450 Ga0157377_10035979
451 Ga0157377_10050207
452 Ga0157377_10083499
453 Ga0157376_10044762
454 Ga0157376_10800739
455 Ga0157376_11059631
456 Ga0163161_10078817
457 Ga0207682_10015911
458 Ga0207688_10177112
459 Ga0207688_10179495
460 Ga0207688_10278074
461 Ga0207699_10228598
462 Ga0207645_10292674
463 Ga0207643_10008572
464 Ga0207643_10023307
465 Ga0207660_10330450
466 Ga0207646_10747672
467 Ga0207681_10216837
468 Ga0207681_11026332
469 Ga0207681_11236332
470 Ga0207650_10029238
471 Ga0207659_10003582
472 Ga0207659_10244379
473 Ga0207659_11451838
474 Ga0207644_10321171
475 Ga0207706_10037563
476 Ga0207706_10089285
477 Ga0207706_10130061
478 Ga0207670_10012229
479 Ga0207670_10070561
480 Ga0207669_10139943
481 Ga0207669_10741945
482 Ga0207704_10939793
483 Ga0207704_11328862
484 Ga0207691_10072865
485 Ga0207691_10119032
486 Ga0207691_11100863
487 Ga0207689_10150427
488 Ga0207689_10170903
489 Ga0207679_10104960
490 Ga0207679_10471789
491 Ga0207679_10890643
492 Ga0207651_10132195
493 Ga0207651_10877237
494 Ga0207668_10354354
495 Ga0207668_10732229
496 Ga0207658_10159653
497 Ga0207677_11305027
498 Ga0207678_10035559
499 Ga0207708_10077793
500 Ga0207708_10143907
501 Ga0207708_10174933
502 Ga0207708_10312220
503 Ga0207641_10195133
504 Ga0207648_10068641
505 Ga0207648_11245181
506 Ga0207648_11836398
507 Ga0207676_10032474
508 Ga0207676_10060743
509 Ga0207676_10453193
510 Ga0207674_10091722
511 Ga0207674_11290165
512 Ga0207675_100079224
513 Ga0207675_101080361
514 Ga0207675_101899986
515 Ga0207675_102079890
516 Ga0207683_10320966
517 Ga0207683_11092492
518 Ga0207683_11330415
519 Ga0209970_1010316
520 Ga0209971_1029442
521 Ga0209974_10208119
522 Ga0207428_10005748
523 Ga0207428_10071730
524 Ga0207428_10128083
525 Ga0207428_10549694
526 Ga0268266_10263913
527 Ga0268266_11271874
528 Ga0268266_11315001
529 Ga0268265_10086081
530 Ga0268265_10159068
531 Ga0268265_10421661
532 Ga0268265_10720138
533 Ga0307408_100072470
534 Ga0307408_101478039
535 Ga0307405_10052448
536 Ga0307406_10069205
537 Ga0307412_10494881
538 Ga0307416_100420751
539 Ga0307416_100970055
540 Ga0307416_101733419
541 Ga0307411_11935037
542 Ga0307415_100819184
543 Ga0439444_0175254
544 Ga0439464_0143164
545 Ga0439460_0018699
546 Ga0439440_0002607
547 Ga0451576_1541645
548 Ga0495594_0365147
549 Ga0495643_0005137
550 Ga0495633_0068159
551 Ga0495656_0275459
552 Ga0495659_0185416
553 Ga0495647_0205346
554 Ga0496100_0724709
555 Ga0496113_0056720
556 Ga0501041_0198618
557 Ga0501041_0243219
558 Ga0501042_0330296
559 Ga0501072_0782570
560 Ga0501076_1455235
561 Ga0501077_0700294
562 Ga0501221_114823
563 Ga0501225_0050171
564 Ga0501225_0069704
565 Ga0501081_0427263
566 Ga0501045_1160282
567 nmdc:mga07m45_658162_c1
568 nmdc:mga05p37_131977_c1
569 nmdc:mga05p37_367_c1
570 nmdc:mga05p37_54944_c1
571 nmdc:mga05p37_766358_c1
572 nmdc:mga09592_15370_c1
573 nmdc:mga09592_842668_c1
574 nmdc:mga0qj67_10220_c1
575 nmdc:mga0qj67_14749_c1
576 nmdc:mga0qj67_389550_c1
577 nmdc:mga06r32_268055_c1
578 nmdc:mga06r32_41689_c1
579 nmdc:mga06r32_74424_c1
580 nmdc:mga08y16_1727_c1
581 nmdc:mga08y16_340645_c1
582 nmdc:mga08y16_810134_c1
583 nmdc:mga08y16_9425_c1
584 nmdc:mga08y16_97167_c1
585 nmdc:mga0n895_157383_c1
586 nmdc:mga0n895_80_c1
587 nmdc:mga0rr50_35_c1
588 nmdc:mga0rr50_407516_c1
589 nmdc:mga08x19_64_c2
590 nmdc:mga0a205_1116294_c1
591 nmdc:mga0a205_36813_c2
592 nmdc:mga0a205_466380_c1
593 Ga0501084_1553202
594 Ga0590071_052193
595 Ga0501082_0376449
596 Ga0501082_0493920

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

25

71

0.98

PF12840

HTH_20

Helix-turn-helix domain

23

72

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9143 27 82
1wq2-assembly1.cif.gz_B neutron crystal structure of dissimilatory sulfite reductase d (dsrd) 0.9075 24 84
5zuo-assembly1.cif.gz_A crystal structure of bz junction in diverse sequence 0.9068 41 82
4lb5-assembly1.cif.gz_B crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9058 38 83
3irq-assembly1.cif.gz_D crystal structure of a z-z junction 0.9048 24 82
ID Description Score Start End Superfamily
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9448 24 80 1.10.10.10
af_Q58793_322_389_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9361 22 81 1.10.10.10
3tgnA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.923 24 82 1.10.10.10
af_P37309_5_97_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9225 15 99 1.10.10.10
af_P76066_81_136_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.915 41 81 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2S8F4A8-F1-model_v4 ArsR family transcriptional regulator 0.9804 12 82 GO:0003700
AF-A0A7C5HKN3-F1-model_v4 ArsR family transcriptional regulator 0.9648 13 115 GO:0003700
AF-A0A838DJN4-F1-model_v4 Winged helix-turn-helix transcriptional regulator 0.9647 15 83 GO:0003700
AF-A0A2V9IW51-F1-model_v4 Transcriptional regulator 0.9622 10 84 GO:0003700
AF-A0A7W1VTP7-F1-model_v4 Metalloregulator ArsR/SmtB family transcription factor 0.9603 13 115 GO:0003700

Map