F394497

General Info

Members Datasets Scaffolds Average Seq Length
298 217 596 453

Family's Representative Sequence

Representative Sequence 3300048927|Ga0496124_0163316|Ga0496124_0163316_146_1612
Length 488
Sequence LLSASQSIILRTVFCIEGRRVHTAIPCKKAAILSGDERMRTLADLAATLSGGTASRPLVDECLSRIANPEGEGSRVFLKVHDKQARAAADFHDAMRGNGAQVSRFAGIPVSIKDLFDMAGDVTTAGSAALRDSEPATRDAPVVARLRAAGFIPVGRTNMTEFAFSGLGINPHYGTPLNPYDRAAGRIPGGSSSGAAVSVTDGMAYAALGTDTGGSCRIPAALCGLVGFKPTARRVPLAGAVPLSTSLDSIGPIAASVQCCATIDAVLAGEEPYELQPMPLSGLRLAVPQSYVFEGIEKEVGQAFERTLTAFGEAGVQISELPLRELSELPGINTKGGFAAPEGYVYHRRLIETKGGLYDPRILTRILRGREQDAADYIALQQARADFIARMDKITAPYDALIMPTVPLTAPRIEDLASEENYNRINLLLLRNPAIANFLDRCAISIPCHLAGDAPVGAMLIGASGADHRLLALAASLASLLCGRANAG

Samples

Sample ID Description Type Environment
1 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
114 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
115 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
116 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
117 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
118 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
119 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
120 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
121 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
122 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
123 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
124 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
125 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
136 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
137 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
138 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
139 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
140 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
141 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
144 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
145 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
146 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
147 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
148 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
149 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
150 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
151 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
152 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
153 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
154 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
155 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
160 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
161 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
162 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
163 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
164 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
165 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
166 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
167 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
168 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
169 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
170 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
171 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
172 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
173 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
191 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
193 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
194 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
195 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
196 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
199 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
200 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
201 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
202 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
203 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
204 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
205 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
206 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
207 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
208 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
209 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
210 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
211 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
212 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
213 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
214 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
215 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
216 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
217 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0
Isolates 0.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.04
Nodule 0
Rhizoplane 14.77
Rhizosphere 72.82
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496124_0163316 3300048927 Bacteria 1734
2 JGI24743J22301_10003925 3300001991 Bacteria 2384
3 JGI24750J21931_1001035 3300002070 Bacteria 3638
4 Ga0070683_100069004 3300005329 Bacteria 3294
5 Ga0070690_100035219 3300005330 Bacteria 3141
6 Ga0070670_100008147 3300005331 Bacteria 8921
7 Ga0068869_100024994 3300005334 Bacteria 4142
8 Ga0070680_100115363 3300005336 Bacteria 2238
9 Ga0070687_100017512 3300005343 Bacteria 3296
10 Ga0070692_10093893 3300005345 Bacteria 1634
11 Ga0070668_100001750 3300005347 Bacteria 15802
12 Ga0070675_100050923 3300005354 Bacteria 3401
13 Ga0070671_100008409 3300005355 Bacteria 8272
14 Ga0070673_100041385 3300005364 Bacteria 3543
15 Ga0070688_100004319 3300005365 Bacteria 7391
16 Ga0070659_100047639 3300005366 Bacteria 3363
17 Ga0070713_100076177 3300005436 Bacteria 2848
18 Ga0070713_100084253 3300005436 Bacteria 2720
19 Ga0070700_100018086 3300005441 Bacteria 4046
20 Ga0070708_100067511 3300005445 Bacteria 3211
21 Ga0070663_100002857 3300005455 Bacteria 9824
22 Ga0070681_10167141 3300005458 Bacteria 2122
23 Ga0068867_100099847 3300005459 Bacteria 2215
24 Ga0070685_10048564 3300005466 Bacteria 2444
25 Ga0070698_100038075 3300005471 Bacteria 4956
26 Ga0070698_100117919 3300005471 Bacteria 2616
27 Ga0070699_100000793 3300005518 Bacteria 29156
28 Ga0070679_100013814 3300005530 Bacteria 7738
29 Ga0070679_100042676 3300005530 Bacteria 4517
30 Ga0070684_100156789 3300005535 Bacteria 2064
31 Ga0070697_100050497 3300005536 Bacteria 3376
32 Ga0070672_100038455 3300005543 Bacteria 3656
33 Ga0070665_100080222 3300005548 Bacteria 3269
34 Ga0070664_100066045 3300005564 Bacteria 3088
35 Ga0070664_100127335 3300005564 Bacteria 2235
36 Ga0068856_100074967 3300005614 Bacteria 3351
37 Ga0070702_100035746 3300005615 Bacteria 2746
38 Ga0068852_100017819 3300005616 Bacteria 5582
39 Ga0068859_100006915 3300005617 Bacteria 11517
40 Ga0068864_100012115 3300005618 Bacteria 7124
41 Ga0068866_10016621 3300005718 Bacteria 3293
42 Ga0068870_10002814 3300005840 Bacteria 7317
43 Ga0068858_100032874 3300005842 Bacteria 4817
44 Ga0068862_100007474 3300005844 Bacteria 9058
45 Ga0081455_10005458 3300005937 Bacteria 13941
46 Ga0081455_10013176 3300005937 Bacteria 8193
47 Ga0081455_10018134 3300005937 Bacteria 6718
48 Ga0081455_10045858 3300005937 Bacteria 3800
49 Ga0081538_10034434 3300005981 Bacteria 3348
50 Ga0075368_10016628 3300006042 Bacteria 2743
51 Ga0075363_100029701 3300006048 Bacteria 2824
52 Ga0075432_10012418 3300006058 Bacteria 2894
53 Ga0070715_10001174 3300006163 Bacteria 7514
54 Ga0070716_100034542 3300006173 Bacteria 2774
55 Ga0070712_100009448 3300006175 Bacteria 6145
56 Ga0075367_10005627 3300006178 Bacteria 6250
57 Ga0075367_10061570 3300006178 Bacteria 2240
58 Ga0068871_100064093 3300006358 Bacteria 3007
59 Ga0075430_100086745 3300006846 Bacteria 2620
60 Ga0075434_100032646 3300006871 Bacteria 5135
61 Ga0075436_100028394 3300006914 Bacteria 3849
62 Ga0097620_100006915 3300006931 Bacteria 11517
63 Ga0075435_100083733 3300007076 Bacteria 2623
64 Ga0105240_10115359 3300009093 Bacteria 3243
65 Ga0111539_10086216 3300009094 Bacteria 3690
66 Ga0105247_10034048 3300009101 Bacteria 3102
67 Ga0114129_10027195 3300009147 Bacteria 8099
68 Ga0114129_10040211 3300009147 Bacteria 6592
69 Ga0114129_10185723 3300009147 Bacteria 2826
70 Ga0114129_10268837 3300009147 Bacteria 2282
71 Ga0105243_10006594 3300009148 Bacteria 8966
72 Ga0105242_10243542 3300009176 Bacteria 1617
73 Ga0105248_10073514 3300009177 Bacteria 3842
74 Ga0105237_10163021 3300009545 Bacteria 2228
75 Ga0105246_10125093 3300011119 Bacteria 1911
76 Ga0157370_10097981 3300013104 Bacteria 2750
77 Ga0157374_10183258 3300013296 Bacteria 2046
78 Ga0157375_10006555 3300013308 Bacteria 10133
79 Ga0163163_10195032 3300014325 Bacteria 2073
80 Ga0157380_10015273 3300014326 Bacteria 5641
81 Ga0157377_10003494 3300014745 Bacteria 7115
82 Ga0157379_10011270 3300014968 Bacteria 7791
83 Ga0157376_10010410 3300014969 Bacteria 6803
84 Ga0213875_10011028 3300021388 Bacteria 4513
85 Ga0213875_10012851 3300021388 Bacteria 4125
86 Ga0213875_10023589 3300021388 Bacteria 2937
87 Ga0213875_10040164 3300021388 Bacteria 2203
88 Ga0207642_10013278 3300025899 Bacteria 3002
89 Ga0207710_10006973 3300025900 Bacteria 4804
90 Ga0207688_10008687 3300025901 Bacteria 5527
91 Ga0207680_10006835 3300025903 Bacteria 5538
92 Ga0207685_10002372 3300025905 Bacteria 4296
93 Ga0207699_10049188 3300025906 Bacteria 2481
94 Ga0207699_10050173 3300025906 Bacteria 2459
95 Ga0207645_10021732 3300025907 Bacteria 4181
96 Ga0207643_10001599 3300025908 Bacteria 12800
97 Ga0207684_10025528 3300025910 Bacteria 5036
98 Ga0207695_10091128 3300025913 Bacteria 3063
99 Ga0207693_10045301 3300025915 Bacteria 3456
100 Ga0207693_10097845 3300025915 Bacteria 2301
101 Ga0207662_10006002 3300025918 Bacteria 6525
102 Ga0207657_10201670 3300025919 Bacteria 1600
103 Ga0207646_10082155 3300025922 Bacteria 2881
104 Ga0207650_10048827 3300025925 Bacteria 3122
105 Ga0207650_10126737 3300025925 Bacteria 1994
106 Ga0207687_10155178 3300025927 Bacteria 1751
107 Ga0207644_10054371 3300025931 Bacteria 2883
108 Ga0207690_10129248 3300025932 Bacteria 1846
109 Ga0207670_10039922 3300025936 Bacteria 3077
110 Ga0207691_10012514 3300025940 Bacteria 8134
111 Ga0207711_10009701 3300025941 Bacteria 8019
112 Ga0207689_10006335 3300025942 Bacteria 10483
113 Ga0207661_10087355 3300025944 Bacteria 2590
114 Ga0207679_10111531 3300025945 Bacteria 2160
115 Ga0207679_10127207 3300025945 Bacteria 2038
116 Ga0207651_10148636 3300025960 Bacteria 1820
117 Ga0207712_10007409 3300025961 Bacteria 6929
118 Ga0207703_10008193 3300026035 Bacteria 8256
119 Ga0207639_10016269 3300026041 Bacteria 5258
120 Ga0207678_10041885 3300026067 Bacteria 3969
121 Ga0207708_10006854 3300026075 Bacteria 8426
122 Ga0207702_10298755 3300026078 Bacteria 1528
123 Ga0207648_10001635 3300026089 Bacteria 24554
124 Ga0207676_10033227 3300026095 Bacteria 3896
125 Ga0207674_10041427 3300026116 Bacteria 4763
126 Ga0207675_100012423 3300026118 Bacteria 7956
127 Ga0207683_10026488 3300026121 Bacteria 5003
128 Ga0268266_10054986 3300028379 Bacteria 3421
129 Ga0268265_10100538 3300028380 Bacteria 2334
130 Ga0268264_10005936 3300028381 Bacteria 10336
131 Ga0307515_10024153 3300028794 Bacteria 10607
132 Ga0265338_10008645 3300028800 Bacteria 12317
133 Ga0265325_10016427 3300031241 Bacteria 4137
134 Ga0265340_10033263 3300031247 Bacteria 2567
135 Ga0373923_0005969 3300035111 Bacteria 4172
136 Ga0373936_0001692 3300035113 Bacteria 8090
137 Ga0373936_0025387 3300035113 Bacteria 2317
138 Ga0373936_0032646 3300035113 Bacteria 2060
139 Ga0373943_0005937 3300035170 Bacteria 5479
140 Ga0373943_0037278 3300035170 Bacteria 2333
141 Ga0373946_0008298 3300035171 Bacteria 3812
142 Ga0373946_0012850 3300035171 Bacteria 3140
143 Ga0373955_0007707 3300035172 Bacteria 4958
144 Ga0373924_0015325 3300035410 Bacteria 2913
145 Ga0373931_0113103 3300035691 Bacteria 1543
146 Ga0373935_0000337 3300035692 Bacteria 23756
147 Ga0373935_0013973 3300035692 Bacteria 4849
148 Ga0373927_0016043 3300035695 Bacteria 4944
149 Ga0373927_0018306 3300035695 Bacteria 4604
150 Ga0373927_0070824 3300035695 Bacteria 2257
151 Ga0373927_0101181 3300035695 Bacteria 1874
152 Ga0373947_0008467 3300035725 Bacteria 5925
153 Ga0373947_0050038 3300035725 Bacteria 2512
154 Ga0373937_0000597 3300036401 Bacteria 31969
155 Ga0373925_0000741 3300037068 Bacteria 29997
156 Ga0373925_0011744 3300037068 Bacteria 6336
157 Ga0373925_0035479 3300037068 Bacteria 3679
158 Ga0395900_0053246 3300037418 Bacteria 4165
159 Ga0395898_0005999 3300037466 Bacteria 13045
160 Ga0395898_0008387 3300037466 Bacteria 10928
161 Ga0395898_0010233 3300037466 Bacteria 9820
162 Ga0395898_0023501 3300037466 Bacteria 6227
163 Ga0436364_0075874 3300037853 Bacteria 2570
164 Ga0436364_0361138 3300037853 Bacteria 33327
165 Ga0436364_0520095 3300037853 Bacteria 2864
166 Ga0436364_0739359 3300037853 Bacteria 35473
167 Ga0436364_0766119 3300037853 Bacteria 23923
168 Ga0395901_0029781 3300038443 Bacteria 5622
169 Ga0400483_084832 3300039062 Bacteria 1803
170 Ga0400483_108354 3300039062 Bacteria 11953
171 Ga0400483_175669 3300039062 Bacteria 4224
172 Ga0436365_0040034 3300039437 Bacteria 3733
173 Ga0436365_1840274 3300039437 Bacteria 7880
174 Ga0436360_0470370 3300039438 Bacteria 1927
175 Ga0436363_1443898 3300039450 Bacteria 2388
176 Ga0466959_0151057 3300045049 Bacteria 1637
177 Ga0495592_0000188 3300046454 Bacteria 54485
178 Ga0495641_0044647 3300046461 Bacteria 2043
179 Ga0495651_0012463 3300046462 Bacteria 6557
180 Ga0495653_0000198 3300046463 Bacteria 49009
181 Ga0495582_0006423 3300046473 Bacteria 6530
182 Ga0495582_0050788 3300046473 Bacteria 2286
183 Ga0495662_0011703 3300046476 Bacteria 4288
184 Ga0495662_0016612 3300046476 Bacteria 3567
185 Ga0495664_0000002 3300046477 Bacteria 625183
186 Ga0495607_0044824 3300046501 Bacteria 2605
187 Ga0495608_0000009 3300046511 Bacteria 266614
188 Ga0495610_0076809 3300046512 Bacteria 1544
189 Ga0495618_0000005 3300046514 Bacteria 230421
190 Ga0495628_0000002 3300046516 Bacteria 589399
191 Ga0495630_0027306 3300046517 Bacteria 4233
192 Ga0495630_0028200 3300046517 Bacteria 4171
193 Ga0495666_0039748 3300046526 Bacteria 2282
194 Ga0495652_0000004 3300046529 Bacteria 588877
195 Ga0495640_0000005 3300046533 Bacteria 318271
196 Ga0495640_0011271 3300046533 Bacteria 6883
197 Ga0495587_0000007 3300046536 Bacteria 290788
198 Ga0495598_0001110 3300046537 Bacteria 5172
199 Ga0495645_0000003 3300046543 Bacteria 570133
200 Ga0495667_0000002 3300046559 Bacteria 437535
201 Ga0495634_0000129 3300046642 Bacteria 65082
202 Ga0495635_0000289 3300046663 Bacteria 32189
203 Ga0495657_0000781 3300046675 Bacteria 28299
204 Ga0495599_0000001 3300046678 Bacteria 537563
205 Ga0495623_0000001 3300046679 Bacteria 313861
206 Ga0495646_0000013 3300046680 Bacteria 159700
207 Ga0495658_0053541 3300046683 Bacteria 2292
208 Ga0495670_0026760 3300046691 Bacteria 2856
209 Ga0495670_0043110 3300046691 Bacteria 2252
210 Ga0495600_0000233 3300046809 Bacteria 30755
211 Ga0495581_0028771 3300047315 Bacteria 3222
212 Ga0495604_0000005 3300047317 Bacteria 424516
213 Ga0495604_0114264 3300047317 Bacteria 1964
214 Ga0495674_0000003 3300047319 Bacteria 562126
215 Ga0495674_0283436 3300047319 Bacteria 1357
216 Ga0495680_0033411 3300047322 Bacteria 4165
217 Ga0495684_0000020 3300047471 Bacteria 148507
218 Ga0495593_0012658 3300047673 Bacteria 4819
219 Ga0495602_0000027 3300048088 Bacteria 145010
220 Ga0496100_0045109 3300048903 Bacteria 2827
221 Ga0496100_0084934 3300048903 Bacteria 2147
222 Ga0496101_0227395 3300048904 Bacteria 1449
223 Ga0496102_0041000 3300048905 Bacteria 4190
224 Ga0496102_0138235 3300048905 Bacteria 2283
225 Ga0496103_0002953 3300048906 Bacteria 10541
226 Ga0496103_0008883 3300048906 Bacteria 5961
227 Ga0496104_0000808 3300048907 Bacteria 26910
228 Ga0496104_0010104 3300048907 Bacteria 8428
229 Ga0496104_0024684 3300048907 Bacteria 5532
230 Ga0496105_0029123 3300048908 Bacteria 4519
231 Ga0496105_0041062 3300048908 Bacteria 3813
232 Ga0496105_0125967 3300048908 Bacteria 2111
233 Ga0496106_0007355 3300048909 Bacteria 8139
234 Ga0496106_0090006 3300048909 Bacteria 2367
235 Ga0496106_0103274 3300048909 Bacteria 2212
236 Ga0496107_0000467 3300048910 Bacteria 22147
237 Ga0496107_0052731 3300048910 Bacteria 2933
238 Ga0496107_0114284 3300048910 Bacteria 1986
239 Ga0496108_0001417 3300048911 Bacteria 18904
240 Ga0496108_0065024 3300048911 Bacteria 3073
241 Ga0496108_0087558 3300048911 Bacteria 2645
242 Ga0496109_0002724 3300048912 Bacteria 14813
243 Ga0496109_0074520 3300048912 Bacteria 3120
244 Ga0496110_0008099 3300048913 Bacteria 8441
245 Ga0496110_0016147 3300048913 Bacteria 6226
246 Ga0496110_0076257 3300048913 Bacteria 2981
247 Ga0496110_0108663 3300048913 Bacteria 2490
248 Ga0496111_0006122 3300048914 Bacteria 7780
249 Ga0496111_0010413 3300048914 Bacteria 6239
250 Ga0496111_0164951 3300048914 Bacteria 1645
251 Ga0496112_0000513 3300048915 Bacteria 26303
252 Ga0496112_0145121 3300048915 Bacteria 2341
253 Ga0496112_0251217 3300048915 Bacteria 1719
254 Ga0496113_0000632 3300048916 Bacteria 17711
255 Ga0496113_0000667 3300048916 Bacteria 17419
256 Ga0496114_0050156 3300048917 Bacteria 3474
257 Ga0496114_0072638 3300048917 Bacteria 2894
258 Ga0496114_0082529 3300048917 Bacteria 2717
259 Ga0496114_0125341 3300048917 Bacteria 2213
260 Ga0496115_0011998 3300048918 Bacteria 6513
261 Ga0496115_0020169 3300048918 Bacteria 5138
262 Ga0496115_0026992 3300048918 Bacteria 4488
263 Ga0496115_0052840 3300048918 Bacteria 3260
264 Ga0496119_0000563 3300048922 Bacteria 49970
265 Ga0501039_0164952 3300049575 Bacteria 1742
266 Ga0501072_0162471 3300049588 Bacteria 1782
267 Ga0501075_0065685 3300049591 Bacteria 2738
268 nmdc:mga06z11_30144_c1 3300050494 Bacteria 2622
269 nmdc:mga06z11_38177_c1 3300050494 Bacteria 2383
270 nmdc:mga05p37_34737_c1 3300050507 Bacteria 6176
271 nmdc:mga06r32_34966_c1 3300050510 Bacteria 4740
272 nmdc:mga08y16_131414_c1 3300050511 Bacteria 2603
273 nmdc:mga08y16_160042_c1 3300050511 Bacteria 2339
274 nmdc:mga0n895_13066_c1 3300050512 Bacteria 7469
275 nmdc:mga0n895_203384_c1 3300050512 Bacteria 2011
276 nmdc:mga0n895_57988_c1 3300050512 Bacteria 3817
277 nmdc:mga0n895_59605_c1 3300050512 Bacteria 3765
278 nmdc:mga0n895_66557_c1 3300050512 Bacteria 3568
279 nmdc:mga0rr50_38903_c1 3300050513 Bacteria 3446
280 nmdc:mga0a205_128777_c1 3300050515 Bacteria 2431
281 Ga0495601_0000010 3300053077 Bacteria 266222
282 Ga0495612_0000002 3300053078 Bacteria 310466
283 Ga0495595_0000184 3300053084 Bacteria 25097
284 Ga0495619_0000002 3300053085 Bacteria 530226
285 Ga0500643_004511 3300053087 Bacteria 6263
286 Ga0500644_0000856 3300053088 Bacteria 9989
287 Ga0500583_0055042 3300053092 Bacteria 1859
288 Ga0500593_002140 3300053117 Bacteria 7179
289 Ga0500595_000002 3300053119 Bacteria 1074388
290 Ga0500652_002659 3300053131 Bacteria 5398
291 Ga0500655_003660 3300053133 Bacteria 2769
292 Ga0500616_0000001 3300053153 Bacteria 1986011
293 Ga0500616_0055586 3300053153 Bacteria 2069
294 Ga0500622_0003454 3300053156 Bacteria 10539
295 Ga0500636_0010736 3300053177 Bacteria 5350
296 Ga0500645_000291 3300053730 Bacteria 35819
297 Ga0530510_0081423 3300061734 Bacteria 2357
298 8001846570 8001845381 Bacteria 5804942
299 Ga0496124_0163316
300 JGI24743J22301_10003925
301 JGI24750J21931_1001035
302 Ga0070683_100069004
303 Ga0070690_100035219
304 Ga0070670_100008147
305 Ga0068869_100024994
306 Ga0070680_100115363
307 Ga0070687_100017512
308 Ga0070692_10093893
309 Ga0070668_100001750
310 Ga0070675_100050923
311 Ga0070671_100008409
312 Ga0070673_100041385
313 Ga0070688_100004319
314 Ga0070659_100047639
315 Ga0070713_100076177
316 Ga0070713_100084253
317 Ga0070700_100018086
318 Ga0070708_100067511
319 Ga0070663_100002857
320 Ga0070681_10167141
321 Ga0068867_100099847
322 Ga0070685_10048564
323 Ga0070698_100038075
324 Ga0070698_100117919
325 Ga0070699_100000793
326 Ga0070679_100013814
327 Ga0070679_100042676
328 Ga0070684_100156789
329 Ga0070697_100050497
330 Ga0070672_100038455
331 Ga0070665_100080222
332 Ga0070664_100066045
333 Ga0070664_100127335
334 Ga0068856_100074967
335 Ga0070702_100035746
336 Ga0068852_100017819
337 Ga0068859_100006915
338 Ga0068864_100012115
339 Ga0068866_10016621
340 Ga0068870_10002814
341 Ga0068858_100032874
342 Ga0068862_100007474
343 Ga0081455_10005458
344 Ga0081455_10013176
345 Ga0081455_10018134
346 Ga0081455_10045858
347 Ga0081538_10034434
348 Ga0075368_10016628
349 Ga0075363_100029701
350 Ga0075432_10012418
351 Ga0070715_10001174
352 Ga0070716_100034542
353 Ga0070712_100009448
354 Ga0075367_10005627
355 Ga0075367_10061570
356 Ga0068871_100064093
357 Ga0075430_100086745
358 Ga0075434_100032646
359 Ga0075436_100028394
360 Ga0097620_100006915
361 Ga0075435_100083733
362 Ga0105240_10115359
363 Ga0111539_10086216
364 Ga0105247_10034048
365 Ga0114129_10027195
366 Ga0114129_10040211
367 Ga0114129_10185723
368 Ga0114129_10268837
369 Ga0105243_10006594
370 Ga0105242_10243542
371 Ga0105248_10073514
372 Ga0105237_10163021
373 Ga0105246_10125093
374 Ga0157370_10097981
375 Ga0157374_10183258
376 Ga0157375_10006555
377 Ga0163163_10195032
378 Ga0157380_10015273
379 Ga0157377_10003494
380 Ga0157379_10011270
381 Ga0157376_10010410
382 Ga0213875_10011028
383 Ga0213875_10012851
384 Ga0213875_10023589
385 Ga0213875_10040164
386 Ga0207642_10013278
387 Ga0207710_10006973
388 Ga0207688_10008687
389 Ga0207680_10006835
390 Ga0207685_10002372
391 Ga0207699_10049188
392 Ga0207699_10050173
393 Ga0207645_10021732
394 Ga0207643_10001599
395 Ga0207684_10025528
396 Ga0207695_10091128
397 Ga0207693_10045301
398 Ga0207693_10097845
399 Ga0207662_10006002
400 Ga0207657_10201670
401 Ga0207646_10082155
402 Ga0207650_10048827
403 Ga0207650_10126737
404 Ga0207687_10155178
405 Ga0207644_10054371
406 Ga0207690_10129248
407 Ga0207670_10039922
408 Ga0207691_10012514
409 Ga0207711_10009701
410 Ga0207689_10006335
411 Ga0207661_10087355
412 Ga0207679_10111531
413 Ga0207679_10127207
414 Ga0207651_10148636
415 Ga0207712_10007409
416 Ga0207703_10008193
417 Ga0207639_10016269
418 Ga0207678_10041885
419 Ga0207708_10006854
420 Ga0207702_10298755
421 Ga0207648_10001635
422 Ga0207676_10033227
423 Ga0207674_10041427
424 Ga0207675_100012423
425 Ga0207683_10026488
426 Ga0268266_10054986
427 Ga0268265_10100538
428 Ga0268264_10005936
429 Ga0307515_10024153
430 Ga0265338_10008645
431 Ga0265325_10016427
432 Ga0265340_10033263
433 Ga0373923_0005969
434 Ga0373936_0001692
435 Ga0373936_0025387
436 Ga0373936_0032646
437 Ga0373943_0005937
438 Ga0373943_0037278
439 Ga0373946_0008298
440 Ga0373946_0012850
441 Ga0373955_0007707
442 Ga0373924_0015325
443 Ga0373931_0113103
444 Ga0373935_0000337
445 Ga0373935_0013973
446 Ga0373927_0016043
447 Ga0373927_0018306
448 Ga0373927_0070824
449 Ga0373927_0101181
450 Ga0373947_0008467
451 Ga0373947_0050038
452 Ga0373937_0000597
453 Ga0373925_0000741
454 Ga0373925_0011744
455 Ga0373925_0035479
456 Ga0395900_0053246
457 Ga0395898_0005999
458 Ga0395898_0008387
459 Ga0395898_0010233
460 Ga0395898_0023501
461 Ga0436364_0075874
462 Ga0436364_0361138
463 Ga0436364_0520095
464 Ga0436364_0739359
465 Ga0436364_0766119
466 Ga0395901_0029781
467 Ga0400483_084832
468 Ga0400483_108354
469 Ga0400483_175669
470 Ga0436365_0040034
471 Ga0436365_1840274
472 Ga0436360_0470370
473 Ga0436363_1443898
474 Ga0466959_0151057
475 Ga0495592_0000188
476 Ga0495641_0044647
477 Ga0495651_0012463
478 Ga0495653_0000198
479 Ga0495582_0006423
480 Ga0495582_0050788
481 Ga0495662_0011703
482 Ga0495662_0016612
483 Ga0495664_0000002
484 Ga0495607_0044824
485 Ga0495608_0000009
486 Ga0495610_0076809
487 Ga0495618_0000005
488 Ga0495628_0000002
489 Ga0495630_0027306
490 Ga0495630_0028200
491 Ga0495666_0039748
492 Ga0495652_0000004
493 Ga0495640_0000005
494 Ga0495640_0011271
495 Ga0495587_0000007
496 Ga0495598_0001110
497 Ga0495645_0000003
498 Ga0495667_0000002
499 Ga0495634_0000129
500 Ga0495635_0000289
501 Ga0495657_0000781
502 Ga0495599_0000001
503 Ga0495623_0000001
504 Ga0495646_0000013
505 Ga0495658_0053541
506 Ga0495670_0026760
507 Ga0495670_0043110
508 Ga0495600_0000233
509 Ga0495581_0028771
510 Ga0495604_0000005
511 Ga0495604_0114264
512 Ga0495674_0000003
513 Ga0495674_0283436
514 Ga0495680_0033411
515 Ga0495684_0000020
516 Ga0495593_0012658
517 Ga0495602_0000027
518 Ga0496100_0045109
519 Ga0496100_0084934
520 Ga0496101_0227395
521 Ga0496102_0041000
522 Ga0496102_0138235
523 Ga0496103_0002953
524 Ga0496103_0008883
525 Ga0496104_0000808
526 Ga0496104_0010104
527 Ga0496104_0024684
528 Ga0496105_0029123
529 Ga0496105_0041062
530 Ga0496105_0125967
531 Ga0496106_0007355
532 Ga0496106_0090006
533 Ga0496106_0103274
534 Ga0496107_0000467
535 Ga0496107_0052731
536 Ga0496107_0114284
537 Ga0496108_0001417
538 Ga0496108_0065024
539 Ga0496108_0087558
540 Ga0496109_0002724
541 Ga0496109_0074520
542 Ga0496110_0008099
543 Ga0496110_0016147
544 Ga0496110_0076257
545 Ga0496110_0108663
546 Ga0496111_0006122
547 Ga0496111_0010413
548 Ga0496111_0164951
549 Ga0496112_0000513
550 Ga0496112_0145121
551 Ga0496112_0251217
552 Ga0496113_0000632
553 Ga0496113_0000667
554 Ga0496114_0050156
555 Ga0496114_0072638
556 Ga0496114_0082529
557 Ga0496114_0125341
558 Ga0496115_0011998
559 Ga0496115_0020169
560 Ga0496115_0026992
561 Ga0496115_0052840
562 Ga0496119_0000563
563 Ga0501039_0164952
564 Ga0501072_0162471
565 Ga0501075_0065685
566 nmdc:mga06z11_30144_c1
567 nmdc:mga06z11_38177_c1
568 nmdc:mga05p37_34737_c1
569 nmdc:mga06r32_34966_c1
570 nmdc:mga08y16_131414_c1
571 nmdc:mga08y16_160042_c1
572 nmdc:mga0n895_13066_c1
573 nmdc:mga0n895_203384_c1
574 nmdc:mga0n895_57988_c1
575 nmdc:mga0n895_59605_c1
576 nmdc:mga0n895_66557_c1
577 nmdc:mga0rr50_38903_c1
578 nmdc:mga0a205_128777_c1
579 Ga0495601_0000010
580 Ga0495612_0000002
581 Ga0495595_0000184
582 Ga0495619_0000002
583 Ga0500643_004511
584 Ga0500644_0000856
585 Ga0500583_0055042
586 Ga0500593_002140
587 Ga0500595_000002
588 Ga0500652_002659
589 Ga0500655_003660
590 Ga0500616_0000001
591 Ga0500616_0055586
592 Ga0500622_0003454
593 Ga0500636_0010736
594 Ga0500645_000291
595 Ga0530510_0081423
596 8001846570

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01425

Amidase

Amidase

58

471

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dc0-assembly1.cif.gz_B crystal structure of amidase 0.9158 2 443
2dc0-assembly1.cif.gz_B crystal structure of amidase 0.9117 2 443
1ocl-assembly1.cif.gz_A the crystal structure of malonamidase e2 complexed with malonate from bradyrhizobium japonicum 0.9113 1 442
1o9p-assembly1.cif.gz_B crystal structure of the s131a mutant of malonamidase e2 complexed with malonate from bradyrhizobium japonicum 0.9082 1 443
1o9q-assembly1.cif.gz_A crystal structure of the s155c mutant of malonamidase e2 from bradyrhizobium japonicum 0.905 1 442
ID Description Score Start End Superfamily
2dc0A00 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.9154 2 443 3.90.1300.10
2dc0A00 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.9113 2 443 3.90.1300.10
af_A0A0P0XRM7_54_372_3.90.1300.10 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.9075 2 229 3.90.1300.10
1o9qA00 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.9013 1 446 3.90.1300.10
af_Q5FWT5_3_499_3.90.1300.10 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.9004 1 447 3.90.1300.10
ID Description Score Start End GO Terms
AF-A0A3B4CG65-F1-model_v4 deleted 0.9956 1 244
AF-A0A1Q3V418-F1-model_v4 Amidase 0.9944 1 443 GO:0003824
AF-A0A258CSI5-F1-model_v4 Amidase 0.994 1 442 GO:0003824
AF-A0A1M5NDL2-F1-model_v4 Aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A 0.9929 1 443 GO:0016740
AF-A0A1Q3V418-F1-model_v4 Amidase 0.9899 1 443 GO:0003824

Map