F394480

General Info

Members Datasets Scaffolds Average Seq Length
298 213 596 129

Family's Representative Sequence

Representative Sequence 3300048906|Ga0496103_0324107|Ga0496103_0324107_492_953
Length 148
Sequence MRGAGDPREDRIEDRLECGFMSVTPRLGTISWQDLTVEDAEQARDFYEAVAGWRPEPLSMGGYSDFVMSDADGMNVAGICHARGSNADLPPMWLIYITVEDLDHSIAECQRLGGSLVAPPRSYAGGRYCVIKDPAGAVCALYQPPDAA

Samples

Sample ID Description Type Environment
1 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
132 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
133 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
134 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
143 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
144 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
145 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
146 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
147 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
148 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
149 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
150 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
151 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
152 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
153 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
154 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
158 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
161 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
165 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
166 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
167 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
168 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
169 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
170 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
171 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
172 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
183 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
191 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
192 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
193 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
194 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
195 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
196 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
201 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
202 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
203 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
204 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
205 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
206 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
207 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
208 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
209 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
210 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
211 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
212 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
213 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.72
Nodule 0
Rhizoplane 7.05
Rhizosphere 83.56
Stem 0
Stem Tuber 0
Unclassified 18.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496103_0324107 3300048906 Bacteria 991
2 Ga0065715_10010371 3300005293 Bacteria 2487
3 Ga0065715_10629382 3300005293 Unclassified 679
4 Ga0065707_10002411 3300005295 Bacteria 5467
5 Ga0070676_10139954 3300005328 Bacteria 1539
6 Ga0070683_100029584 3300005329 Bacteria 4961
7 Ga0070690_100132878 3300005330 Bacteria 1682
8 Ga0070670_100151933 3300005331 Bacteria 2004
9 Ga0070670_100256531 3300005331 Bacteria 1524
10 Ga0068869_100040829 3300005334 Bacteria 3319
11 Ga0068869_100049597 3300005334 Bacteria 3040
12 Ga0070666_10091462 3300005335 Bacteria 2090
13 Ga0070680_101418013 3300005336 Bacteria 601
14 Ga0068868_100143536 3300005338 Bacteria 1962
15 Ga0070660_100243233 3300005339 Unclassified 1466
16 Ga0070660_101558305 3300005339 Unclassified 562
17 Ga0070689_100165693 3300005340 Bacteria 1788
18 Ga0070661_100310853 3300005344 Bacteria 1229
19 Ga0070661_100540021 3300005344 Bacteria 937
20 Ga0070692_10014911 3300005345 Bacteria 3663
21 Ga0070668_100175089 3300005347 Bacteria 1749
22 Ga0070669_100231979 3300005353 Bacteria 1463
23 Ga0070675_100422986 3300005354 Bacteria 1191
24 Ga0070675_100659832 3300005354 Bacteria 951
25 Ga0070674_100250317 3300005356 Bacteria 1391
26 Ga0070673_101121426 3300005364 Bacteria 735
27 Ga0070673_101922316 3300005364 Unclassified 561
28 Ga0070688_100627691 3300005365 Bacteria 825
29 Ga0070659_100046835 3300005366 Unclassified 3390
30 Ga0070667_100374929 3300005367 Unclassified 1292
31 Ga0070709_10105746 3300005434 Bacteria 1883
32 Ga0070713_100007155 3300005436 Bacteria 7806
33 Ga0070705_100010798 3300005440 Bacteria 4583
34 Ga0070700_100010974 3300005441 Bacteria 5009
35 Ga0070694_101021220 3300005444 Bacteria 687
36 Ga0070708_100509705 3300005445 Bacteria 1135
37 Ga0070663_100411657 3300005455 Unclassified 1107
38 Ga0070678_100396354 3300005456 Unclassified 1198
39 Ga0070662_100416754 3300005457 Bacteria 1110
40 Ga0070681_10167711 3300005458 Bacteria 2118
41 Ga0070681_11417786 3300005458 Unclassified 618
42 Ga0068867_100008224 3300005459 Bacteria 7370
43 Ga0070698_101735340 3300005471 Unclassified 577
44 Ga0070679_100494763 3300005530 Bacteria 1167
45 Ga0070672_100020760 3300005543 Bacteria 4795
46 Ga0070695_100118823 3300005545 Bacteria 1805
47 Ga0070696_100366369 3300005546 Bacteria 1120
48 Ga0070693_100009185 3300005547 Bacteria 4911
49 Ga0070693_100072447 3300005547 Unclassified 2032
50 Ga0070665_100849453 3300005548 Bacteria 926
51 Ga0070704_100320475 3300005549 Bacteria 1298
52 Ga0070704_101189617 3300005549 Unclassified 695
53 Ga0070664_100116048 3300005564 Bacteria 2341
54 Ga0070664_100152028 3300005564 Bacteria 2044
55 Ga0070664_100298983 3300005564 Bacteria 1454
56 Ga0068854_100235110 3300005578 Bacteria 1456
57 Ga0068854_100532105 3300005578 Unclassified 994
58 Ga0070702_100049519 3300005615 Bacteria 2396
59 Ga0068852_100156927 3300005616 Bacteria 2121
60 Ga0068859_100118401 3300005617 Bacteria 2714
61 Ga0068859_100690180 3300005617 Bacteria 1112
62 Ga0068859_101443397 3300005617 Unclassified 759
63 Ga0068864_100781689 3300005618 Bacteria 937
64 Ga0068864_101932232 3300005618 Unclassified 596
65 Ga0068866_11371949 3300005718 Unclassified 516
66 Ga0068861_101282145 3300005719 Bacteria 712
67 Ga0068863_100240605 3300005841 Bacteria 1747
68 Ga0068860_100159321 3300005843 Bacteria 2176
69 Ga0068862_100073431 3300005844 Bacteria 2956
70 Ga0068862_101125155 3300005844 Bacteria 781
71 Ga0081539_10013105 3300005985 Bacteria 6286
72 Ga0070717_11545095 3300006028 Bacteria 602
73 Ga0075365_10072868 3300006038 Bacteria 2314
74 Ga0075365_10536091 3300006038 Bacteria 828
75 Ga0075365_10627557 3300006038 Bacteria 760
76 Ga0075368_10153412 3300006042 Unclassified 963
77 Ga0075364_10001341 3300006051 Bacteria 13271
78 Ga0075364_10063691 3300006051 Bacteria 2421
79 Ga0075364_10673090 3300006051 Unclassified 706
80 Ga0075362_10000195 3300006177 Bacteria 16768
81 Ga0075367_10023966 3300006178 Bacteria 3439
82 Ga0075367_10032002 3300006178 Bacteria 3023
83 Ga0075367_10361032 3300006178 Bacteria 917
84 Ga0075367_10378093 3300006178 Bacteria 895
85 Ga0075366_10040149 3300006195 Unclassified 2767
86 Ga0097621_100608912 3300006237 Bacteria 999
87 Ga0075370_10004905 3300006353 Bacteria 6570
88 Ga0068871_100725636 3300006358 Unclassified 912
89 Ga0075434_100204178 3300006871 Bacteria 1997
90 Ga0075434_100350646 3300006871 Bacteria 1497
91 Ga0068865_100090930 3300006881 Bacteria 2214
92 Ga0068865_100268515 3300006881 Bacteria 1354
93 Ga0068865_100615083 3300006881 Unclassified 920
94 Ga0097620_100118388 3300006931 Bacteria 2714
95 Ga0097620_100690303 3300006931 Bacteria 1112
96 Ga0097620_101443385 3300006931 Unclassified 759
97 Ga0075435_100141517 3300007076 Bacteria 2018
98 Ga0075435_100163994 3300007076 Bacteria 1873
99 Ga0105240_10101196 3300009093 Bacteria 3505
100 Ga0111539_10890955 3300009094 Bacteria 1035
101 Ga0111539_11272516 3300009094 Bacteria 854
102 Ga0114129_10047590 3300009147 Bacteria 6025
103 Ga0105243_10247026 3300009148 Bacteria 1591
104 Ga0105243_10675570 3300009148 Bacteria 1004
105 Ga0105243_10924673 3300009148 Unclassified 869
106 Ga0105241_10258620 3300009174 Bacteria 1479
107 Ga0105241_11886375 3300009174 Bacteria 585
108 Ga0105242_10024076 3300009176 Bacteria 4805
109 Ga0105248_10163458 3300009177 Bacteria 2510
110 Ga0105249_10050260 3300009553 Bacteria 3801
111 Ga0105249_10225534 3300009553 Bacteria 1846
112 Ga0105239_10385583 3300010375 Bacteria 1585
113 Ga0157369_11176634 3300013105 Unclassified 783
114 Ga0157378_10051485 3300013297 Bacteria 3664
115 Ga0163162_10619202 3300013306 Bacteria 1208
116 Ga0157372_10484371 3300013307 Unclassified 1442
117 Ga0163163_10161387 3300014325 Bacteria 2287
118 Ga0157380_10242248 3300014326 Bacteria 1627
119 Ga0182008_10422203 3300014497 Bacteria 720
120 Ga0157377_11269016 3300014745 Unclassified 574
121 Ga0207682_10111753 3300025893 Bacteria 1204
122 Ga0207688_10065533 3300025901 Bacteria 2053
123 Ga0207680_10054635 3300025903 Bacteria 2403
124 Ga0207699_10152023 3300025906 Unclassified 1532
125 Ga0207645_10012720 3300025907 Bacteria 5706
126 Ga0207695_10626588 3300025913 Bacteria 957
127 Ga0207660_10263561 3300025917 Bacteria 1363
128 Ga0207662_10004039 3300025918 Bacteria 7655
129 Ga0207657_10243067 3300025919 Unclassified 1437
130 Ga0207649_10823591 3300025920 Unclassified 725
131 Ga0207649_10916881 3300025920 Unclassified 687
132 Ga0207681_10290454 3300025923 Bacteria 1290
133 Ga0207650_10014234 3300025925 Bacteria 5526
134 Ga0207650_10519684 3300025925 Bacteria 996
135 Ga0207659_10556894 3300025926 Bacteria 975
136 Ga0207687_10750301 3300025927 Unclassified 831
137 Ga0207700_10002715 3300025928 Bacteria 10205
138 Ga0207644_10057451 3300025931 Bacteria 2809
139 Ga0207706_10332096 3300025933 Bacteria 1323
140 Ga0207686_10076758 3300025934 Bacteria 2167
141 Ga0207709_10476272 3300025935 Bacteria 970
142 Ga0207709_10505714 3300025935 Unclassified 944
143 Ga0207670_10084805 3300025936 Bacteria 2225
144 Ga0207669_10271030 3300025937 Unclassified 1275
145 Ga0207704_10123912 3300025938 Unclassified 1775
146 Ga0207704_10124011 3300025938 Bacteria 1774
147 Ga0207691_10005965 3300025940 Bacteria 11769
148 Ga0207691_10921181 3300025940 Unclassified 731
149 Ga0207711_10031535 3300025941 Bacteria 4475
150 Ga0207689_10043137 3300025942 Bacteria 3729
151 Ga0207689_10052345 3300025942 Bacteria 3364
152 Ga0207661_10010405 3300025944 Bacteria 6695
153 Ga0207679_10043341 3300025945 Bacteria 3240
154 Ga0207679_10048284 3300025945 Bacteria 3098
155 Ga0207679_11099875 3300025945 Bacteria 729
156 Ga0207651_10012657 3300025960 Bacteria 4785
157 Ga0207651_10940277 3300025960 Bacteria 771
158 Ga0207640_10131360 3300025981 Bacteria 1811
159 Ga0207658_11022105 3300025986 Bacteria 754
160 Ga0207677_10095445 3300026023 Bacteria 2173
161 Ga0207703_10226611 3300026035 Bacteria 1673
162 Ga0207639_10658113 3300026041 Unclassified 969
163 Ga0207678_10334465 3300026067 Bacteria 1304
164 Ga0207708_10041565 3300026075 Bacteria 3505
165 Ga0207708_10944704 3300026075 Unclassified 748
166 Ga0207641_10237728 3300026088 Bacteria 1696
167 Ga0207648_10008316 3300026089 Bacteria 10072
168 Ga0207675_100018089 3300026118 Bacteria 6570
169 Ga0207683_10466020 3300026121 Bacteria 1165
170 Ga0207698_10689003 3300026142 Bacteria 1016
171 Ga0207428_10542799 3300027907 Bacteria 841
172 Ga0207428_10821508 3300027907 Bacteria 660
173 Ga0268266_11446217 3300028379 Bacteria 663
174 Ga0268265_10624342 3300028380 Bacteria 1033
175 Ga0268264_10240505 3300028381 Bacteria 1676
176 Ga0307408_100209273 3300031548 Bacteria 1584
177 Ga0307408_100604520 3300031548 Bacteria 975
178 Ga0316579_10000994 3300031691 Bacteria 9956
179 Ga0316576_10068708 3300031727 Unclassified 2611
180 Ga0316576_10116086 3300031727 Bacteria 2008
181 Ga0316576_10559234 3300031727 Unclassified 838
182 Ga0316578_10079846 3300031728 Bacteria 1946
183 Ga0316578_10544969 3300031728 Bacteria 682
184 Ga0316577_10091382 3300031733 Bacteria 1704
185 Ga0316577_10142011 3300031733 Bacteria 1352
186 Ga0307413_10257147 3300031824 Bacteria 1299
187 Ga0307406_11488827 3300031901 Bacteria 595
188 Ga0307407_10252391 3300031903 Bacteria 1209
189 Ga0307407_11369440 3300031903 Bacteria 557
190 Ga0307412_10489329 3300031911 Unclassified 1022
191 Ga0307409_100146328 3300031995 Bacteria 2044
192 Ga0307409_100557330 3300031995 Unclassified 1126
193 Ga0307416_100319740 3300032002 Bacteria 1553
194 Ga0307416_100432919 3300032002 Bacteria 1363
195 Ga0307415_100310296 3300032126 Bacteria 1311
196 Ga0307415_100749803 3300032126 Bacteria 886
197 Ga0307415_100917407 3300032126 Bacteria 808
198 Ga0316580_10036989 3300032139 Bacteria 1510
199 Ga0373934_0298750 3300035086 Bacteria 668
200 Ga0373949_0137630 3300035090 Unclassified 697
201 Ga0373951_0018443 3300035091 Bacteria 1586
202 Ga0373936_0423001 3300035113 Unclassified 613
203 Ga0373939_0083903 3300035114 Bacteria 1064
204 Ga0373941_0045349 3300035115 Bacteria 1376
205 Ga0373954_0224514 3300035118 Bacteria 924
206 Ga0373943_0025099 3300035170 Unclassified 2784
207 Ga0373943_0816639 3300035170 Bacteria 555
208 Ga0373946_0183119 3300035171 Bacteria 995
209 Ga0373955_0450767 3300035172 Bacteria 784
210 Ga0373962_0094386 3300035242 Bacteria 925
211 Ga0316574_0012171 3300035398 Bacteria 4916
212 Ga0316574_0389843 3300035398 Unclassified 878
213 Ga0373931_0107617 3300035691 Bacteria 1577
214 Ga0373935_0048427 3300035692 Bacteria 2691
215 Ga0373935_0075798 3300035692 Bacteria 2177
216 Ga0373933_0007639 3300035724 Bacteria 5903
217 Ga0373947_0029604 3300035725 Bacteria 3213
218 Ga0373937_0005391 3300036401 Bacteria 10940
219 Ga0316582_0046318 3300036647 Bacteria 2741
220 Ga0316584_0002110 3300036712 Bacteria 12441
221 Ga0395905_0752297 3300037471 Unclassified 877
222 Ga0395901_1687264 3300038443 Bacteria 585
223 Ga0436365_1614969 3300039437 Bacteria 1446
224 Ga0451853_1506982 3300041512 Unclassified 1237
225 Ga0439431_0131753 3300041997 Bacteria 702
226 Ga0439462_0014873 3300042015 Bacteria 2003
227 Ga0439440_0140556 3300042993 Unclassified 685
228 Ga0495651_0253003 3300046462 Bacteria 1202
229 Ga0495662_0125663 3300046476 Bacteria 1260
230 Ga0495667_0650193 3300046559 Bacteria 655
231 Ga0496100_0531267 3300048903 Bacteria 909
232 Ga0496100_1206041 3300048903 Unclassified 597
233 Ga0496100_1601698 3300048903 Bacteria 515
234 Ga0496102_1327673 3300048905 Unclassified 638
235 Ga0496102_1663779 3300048905 Bacteria 556
236 Ga0496104_0338589 3300048907 Unclassified 1417
237 Ga0496104_0840640 3300048907 Bacteria 824
238 Ga0496105_0576687 3300048908 Unclassified 876
239 Ga0496106_0270732 3300048909 Bacteria 1360
240 Ga0496107_0237690 3300048910 Bacteria 1356
241 Ga0496109_0061044 3300048912 Bacteria 3446
242 Ga0496109_0225036 3300048912 Bacteria 1765
243 Ga0496109_0750753 3300048912 Bacteria 913
244 Ga0496110_0701653 3300048913 Unclassified 913
245 Ga0496111_0222644 3300048914 Unclassified 1402
246 Ga0496112_0070833 3300048915 Bacteria 3446
247 Ga0496112_0217787 3300048915 Bacteria 1866
248 Ga0496112_0717861 3300048915 Bacteria 927
249 Ga0496113_0106667 3300048916 Bacteria 2176
250 Ga0496113_0582932 3300048916 Bacteria 896
251 Ga0501036_0160526 3300049572 Bacteria 1895
252 Ga0501039_0112361 3300049575 Bacteria 2130
253 Ga0501040_0490736 3300049576 Bacteria 885
254 Ga0501041_0034196 3300049577 Bacteria 3077
255 Ga0501041_0246911 3300049577 Bacteria 1122
256 Ga0501041_1122795 3300049577 Bacteria 507
257 Ga0501042_0202103 3300049578 Bacteria 1432
258 Ga0501046_0045449 3300049580 Bacteria 3489
259 Ga0501048_0159382 3300049582 Bacteria 1597
260 Ga0501067_0873635 3300049583 Bacteria 507
261 Ga0501069_0125723 3300049585 Bacteria 1466
262 Ga0501071_0491675 3300049587 Bacteria 941
263 Ga0501071_1267497 3300049587 Bacteria 569
264 Ga0501072_0356891 3300049588 Bacteria 1160
265 Ga0501072_0559698 3300049588 Archaea 903
266 Ga0501075_0025692 3300049591 Bacteria 4327
267 Ga0501075_0266448 3300049591 Bacteria 1306
268 Ga0501076_0170518 3300049592 Bacteria 1774
269 Ga0501250_047886 3300049680 Bacteria 648
270 Ga0501080_0083224 3300049742 Bacteria 2973
271 Ga0501081_0272406 3300049743 Bacteria 1238
272 Ga0501035_0294120 3300049822 Bacteria 1370
273 nmdc:mga03683_7470_c1 3300050489 Bacteria 3795
274 nmdc:mga00v17_110853_c1 3300050491 Bacteria 1741
275 nmdc:mga00v17_294079_c1 3300050491 Bacteria 1055
276 nmdc:mga00v17_74603_c2 3300050491 Bacteria 1270
277 nmdc:mga0yw44_582578_c1 3300050492 Bacteria 760
278 nmdc:mga0yw44_62001_c1 3300050492 Bacteria 2295
279 nmdc:mga0yw44_7281_c2 3300050492 Bacteria 4116
280 nmdc:mga0k408_243142_c1 3300050493 Bacteria 1075
281 nmdc:mga06z11_167338_c1 3300050494 Unclassified 1260
282 nmdc:mga06z11_195944_c1 3300050494 Bacteria 1171
283 nmdc:mga06z11_65851_c1 3300050494 Bacteria 1902
284 nmdc:mga07m45_18044_c1 3300050496 Bacteria 3801
285 nmdc:mga05p37_321301_c1 3300050507 Bacteria 1832
286 nmdc:mga08y16_1277528_c1 3300050511 Bacteria 702
287 nmdc:mga08y16_1376331_c1 3300050511 Bacteria 670
288 nmdc:mga0n895_118151_c1 3300050512 Bacteria 2671
289 nmdc:mga0n895_221372_c1 3300050512 Bacteria 1921
290 nmdc:mga0n895_69656_c1 3300050512 Bacteria 3485
291 nmdc:mga0rr50_203576_c1 3300050513 Bacteria 1628
292 Ga0495619_0041433 3300053085 Bacteria 3012
293 Ga0495619_0863070 3300053085 Bacteria 610
294 Ga0501084_0199778 3300054114 Bacteria 1687
295 Ga0501082_0178793 3300060353 Bacteria 1845
296 Ga0501082_0777849 3300060353 Bacteria 837
297 Ga0530510_0177637 3300061734 Bacteria 1578
298 Ga0530510_0191985 3300061734 Bacteria 1516
299 Ga0496103_0324107
300 Ga0065715_10010371
301 Ga0065715_10629382
302 Ga0065707_10002411
303 Ga0070676_10139954
304 Ga0070683_100029584
305 Ga0070690_100132878
306 Ga0070670_100151933
307 Ga0070670_100256531
308 Ga0068869_100040829
309 Ga0068869_100049597
310 Ga0070666_10091462
311 Ga0070680_101418013
312 Ga0068868_100143536
313 Ga0070660_100243233
314 Ga0070660_101558305
315 Ga0070689_100165693
316 Ga0070661_100310853
317 Ga0070661_100540021
318 Ga0070692_10014911
319 Ga0070668_100175089
320 Ga0070669_100231979
321 Ga0070675_100422986
322 Ga0070675_100659832
323 Ga0070674_100250317
324 Ga0070673_101121426
325 Ga0070673_101922316
326 Ga0070688_100627691
327 Ga0070659_100046835
328 Ga0070667_100374929
329 Ga0070709_10105746
330 Ga0070713_100007155
331 Ga0070705_100010798
332 Ga0070700_100010974
333 Ga0070694_101021220
334 Ga0070708_100509705
335 Ga0070663_100411657
336 Ga0070678_100396354
337 Ga0070662_100416754
338 Ga0070681_10167711
339 Ga0070681_11417786
340 Ga0068867_100008224
341 Ga0070698_101735340
342 Ga0070679_100494763
343 Ga0070672_100020760
344 Ga0070695_100118823
345 Ga0070696_100366369
346 Ga0070693_100009185
347 Ga0070693_100072447
348 Ga0070665_100849453
349 Ga0070704_100320475
350 Ga0070704_101189617
351 Ga0070664_100116048
352 Ga0070664_100152028
353 Ga0070664_100298983
354 Ga0068854_100235110
355 Ga0068854_100532105
356 Ga0070702_100049519
357 Ga0068852_100156927
358 Ga0068859_100118401
359 Ga0068859_100690180
360 Ga0068859_101443397
361 Ga0068864_100781689
362 Ga0068864_101932232
363 Ga0068866_11371949
364 Ga0068861_101282145
365 Ga0068863_100240605
366 Ga0068860_100159321
367 Ga0068862_100073431
368 Ga0068862_101125155
369 Ga0081539_10013105
370 Ga0070717_11545095
371 Ga0075365_10072868
372 Ga0075365_10536091
373 Ga0075365_10627557
374 Ga0075368_10153412
375 Ga0075364_10001341
376 Ga0075364_10063691
377 Ga0075364_10673090
378 Ga0075362_10000195
379 Ga0075367_10023966
380 Ga0075367_10032002
381 Ga0075367_10361032
382 Ga0075367_10378093
383 Ga0075366_10040149
384 Ga0097621_100608912
385 Ga0075370_10004905
386 Ga0068871_100725636
387 Ga0075434_100204178
388 Ga0075434_100350646
389 Ga0068865_100090930
390 Ga0068865_100268515
391 Ga0068865_100615083
392 Ga0097620_100118388
393 Ga0097620_100690303
394 Ga0097620_101443385
395 Ga0075435_100141517
396 Ga0075435_100163994
397 Ga0105240_10101196
398 Ga0111539_10890955
399 Ga0111539_11272516
400 Ga0114129_10047590
401 Ga0105243_10247026
402 Ga0105243_10675570
403 Ga0105243_10924673
404 Ga0105241_10258620
405 Ga0105241_11886375
406 Ga0105242_10024076
407 Ga0105248_10163458
408 Ga0105249_10050260
409 Ga0105249_10225534
410 Ga0105239_10385583
411 Ga0157369_11176634
412 Ga0157378_10051485
413 Ga0163162_10619202
414 Ga0157372_10484371
415 Ga0163163_10161387
416 Ga0157380_10242248
417 Ga0182008_10422203
418 Ga0157377_11269016
419 Ga0207682_10111753
420 Ga0207688_10065533
421 Ga0207680_10054635
422 Ga0207699_10152023
423 Ga0207645_10012720
424 Ga0207695_10626588
425 Ga0207660_10263561
426 Ga0207662_10004039
427 Ga0207657_10243067
428 Ga0207649_10823591
429 Ga0207649_10916881
430 Ga0207681_10290454
431 Ga0207650_10014234
432 Ga0207650_10519684
433 Ga0207659_10556894
434 Ga0207687_10750301
435 Ga0207700_10002715
436 Ga0207644_10057451
437 Ga0207706_10332096
438 Ga0207686_10076758
439 Ga0207709_10476272
440 Ga0207709_10505714
441 Ga0207670_10084805
442 Ga0207669_10271030
443 Ga0207704_10123912
444 Ga0207704_10124011
445 Ga0207691_10005965
446 Ga0207691_10921181
447 Ga0207711_10031535
448 Ga0207689_10043137
449 Ga0207689_10052345
450 Ga0207661_10010405
451 Ga0207679_10043341
452 Ga0207679_10048284
453 Ga0207679_11099875
454 Ga0207651_10012657
455 Ga0207651_10940277
456 Ga0207640_10131360
457 Ga0207658_11022105
458 Ga0207677_10095445
459 Ga0207703_10226611
460 Ga0207639_10658113
461 Ga0207678_10334465
462 Ga0207708_10041565
463 Ga0207708_10944704
464 Ga0207641_10237728
465 Ga0207648_10008316
466 Ga0207675_100018089
467 Ga0207683_10466020
468 Ga0207698_10689003
469 Ga0207428_10542799
470 Ga0207428_10821508
471 Ga0268266_11446217
472 Ga0268265_10624342
473 Ga0268264_10240505
474 Ga0307408_100209273
475 Ga0307408_100604520
476 Ga0316579_10000994
477 Ga0316576_10068708
478 Ga0316576_10116086
479 Ga0316576_10559234
480 Ga0316578_10079846
481 Ga0316578_10544969
482 Ga0316577_10091382
483 Ga0316577_10142011
484 Ga0307413_10257147
485 Ga0307406_11488827
486 Ga0307407_10252391
487 Ga0307407_11369440
488 Ga0307412_10489329
489 Ga0307409_100146328
490 Ga0307409_100557330
491 Ga0307416_100319740
492 Ga0307416_100432919
493 Ga0307415_100310296
494 Ga0307415_100749803
495 Ga0307415_100917407
496 Ga0316580_10036989
497 Ga0373934_0298750
498 Ga0373949_0137630
499 Ga0373951_0018443
500 Ga0373936_0423001
501 Ga0373939_0083903
502 Ga0373941_0045349
503 Ga0373954_0224514
504 Ga0373943_0025099
505 Ga0373943_0816639
506 Ga0373946_0183119
507 Ga0373955_0450767
508 Ga0373962_0094386
509 Ga0316574_0012171
510 Ga0316574_0389843
511 Ga0373931_0107617
512 Ga0373935_0048427
513 Ga0373935_0075798
514 Ga0373933_0007639
515 Ga0373947_0029604
516 Ga0373937_0005391
517 Ga0316582_0046318
518 Ga0316584_0002110
519 Ga0395905_0752297
520 Ga0395901_1687264
521 Ga0436365_1614969
522 Ga0451853_1506982
523 Ga0439431_0131753
524 Ga0439462_0014873
525 Ga0439440_0140556
526 Ga0495651_0253003
527 Ga0495662_0125663
528 Ga0495667_0650193
529 Ga0496100_0531267
530 Ga0496100_1206041
531 Ga0496100_1601698
532 Ga0496102_1327673
533 Ga0496102_1663779
534 Ga0496104_0338589
535 Ga0496104_0840640
536 Ga0496105_0576687
537 Ga0496106_0270732
538 Ga0496107_0237690
539 Ga0496109_0061044
540 Ga0496109_0225036
541 Ga0496109_0750753
542 Ga0496110_0701653
543 Ga0496111_0222644
544 Ga0496112_0070833
545 Ga0496112_0217787
546 Ga0496112_0717861
547 Ga0496113_0106667
548 Ga0496113_0582932
549 Ga0501036_0160526
550 Ga0501039_0112361
551 Ga0501040_0490736
552 Ga0501041_0034196
553 Ga0501041_0246911
554 Ga0501041_1122795
555 Ga0501042_0202103
556 Ga0501046_0045449
557 Ga0501048_0159382
558 Ga0501067_0873635
559 Ga0501069_0125723
560 Ga0501071_0491675
561 Ga0501071_1267497
562 Ga0501072_0356891
563 Ga0501072_0559698
564 Ga0501075_0025692
565 Ga0501075_0266448
566 Ga0501076_0170518
567 Ga0501250_047886
568 Ga0501080_0083224
569 Ga0501081_0272406
570 Ga0501035_0294120
571 nmdc:mga03683_7470_c1
572 nmdc:mga00v17_110853_c1
573 nmdc:mga00v17_294079_c1
574 nmdc:mga00v17_74603_c2
575 nmdc:mga0yw44_582578_c1
576 nmdc:mga0yw44_62001_c1
577 nmdc:mga0yw44_7281_c2
578 nmdc:mga0k408_243142_c1
579 nmdc:mga06z11_167338_c1
580 nmdc:mga06z11_195944_c1
581 nmdc:mga06z11_65851_c1
582 nmdc:mga07m45_18044_c1
583 nmdc:mga05p37_321301_c1
584 nmdc:mga08y16_1277528_c1
585 nmdc:mga08y16_1376331_c1
586 nmdc:mga0n895_118151_c1
587 nmdc:mga0n895_221372_c1
588 nmdc:mga0n895_69656_c1
589 nmdc:mga0rr50_203576_c1
590 Ga0495619_0041433
591 Ga0495619_0863070
592 Ga0501084_0199778
593 Ga0501082_0178793
594 Ga0501082_0777849
595 Ga0530510_0177637
596 Ga0530510_0191985

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

26

141

0.92

PF18029

Glyoxalase_6

Glyoxalase-like domain

33

142

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g12-assembly1.cif.gz_A crystal structure of a putative lactoylglutathione lyase from bdellovibrio bacteriovorus 0.7852 9 121
1fa5-assembly1.cif.gz_B crystal structure of the zn(ii)-bound glyoxalase i of escherichia coli 0.7693 9 123
2i4e-assembly2.cif.gz_B structural studies of protein tyrosine phosphatase beta catalytic domain in complex with inhibitors 0.7674 94 124
2i5x-assembly1.cif.gz_A engineering the ptpbeta catalytic domain with improved crystallization properties 0.7635 94 124
2i5x-assembly2.cif.gz_B engineering the ptpbeta catalytic domain with improved crystallization properties 0.7633 94 124
ID Description Score Start End Superfamily
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8333 70 124 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8056 74 122 3.30.720.110
3g12A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7852 9 121 3.10.180.10
af_C6T374_10_137_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7771 11 123 3.10.180.10
af_Q5VMX8_15_124_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7756 14 124 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A200PUL5-F1-model_v4 Glyoxalase-like domain 0.8576 7 124
AF-A0A4R6LAS9-F1-model_v4 Putative glyoxalase superfamily protein PhnB 0.8443 9 126
AF-A0A200PUL5-F1-model_v4 Glyoxalase-like domain 0.8432 7 124
AF-A0A535R664-F1-model_v4 VOC domain-containing protein 0.8416 19 124
AF-A0A1G0NGP3-F1-model_v4 VOC domain-containing protein 0.8402 5 124

Map