F394411

General Info

Members Datasets Scaffolds Average Seq Length
298 211 596 76

Family's Representative Sequence

Representative Sequence 3300042122|Ga0450920_092442|Ga0450920_092442_228_500
Length 90
Sequence LVAVNGQAPAVYTGSMSPLDRIVVDAQVRFGKPCIRGTRISVGDVLGFLAGGMSEDQILQDFPQLVKDDIRACLAYAAERERRTFGIPAA

Samples

Sample ID Description Type Environment
1 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
136 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
139 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
140 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
141 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
142 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
143 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
144 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
145 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
146 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
147 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
148 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
149 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
150 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
151 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
152 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
153 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
156 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
157 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
158 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
159 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
160 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
161 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
162 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
163 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
184 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
185 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
186 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
187 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
188 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
189 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
190 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
191 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
194 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
195 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
208 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
209 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
211 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.34
Nodule 0
Rhizoplane 3.36
Rhizosphere 93.96
Stem 0
Stem Tuber 0
Unclassified 38.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0450920_092442 3300042122 Bacteria 625
2 JGI24749J21850_1082962 3300002076 Unclassified 505
3 JGI24034J26672_10082931 3300002239 Bacteria 587
4 rootL2_10009529 3300003322 Bacteria 24087
5 Ga0065712_10286255 3300005290 Bacteria 882
6 Ga0065715_10094919 3300005293 Bacteria 4212
7 Ga0070683_100817084 3300005329 Bacteria 894
8 Ga0070690_100009229 3300005330 Bacteria 5708
9 Ga0070690_101195287 3300005330 Bacteria 606
10 Ga0070677_10037052 3300005333 Bacteria 1901
11 Ga0068869_100175980 3300005334 Bacteria 1675
12 Ga0068869_101022761 3300005334 Unclassified 720
13 Ga0070666_10029016 3300005335 Bacteria 3635
14 Ga0070660_100013094 3300005339 Bacteria 5939
15 Ga0070660_100985420 3300005339 Unclassified 712
16 Ga0070689_100008950 3300005340 Bacteria 7083
17 Ga0070687_100136595 3300005343 Unclassified 1422
18 Ga0070669_100211090 3300005353 Bacteria 1531
19 Ga0070675_100004704 3300005354 Bacteria 10419
20 Ga0070671_100227890 3300005355 Bacteria 1581
21 Ga0070671_100506264 3300005355 Unclassified 1039
22 Ga0070671_101149817 3300005355 Unclassified 682
23 Ga0070673_100133377 3300005364 Bacteria 2087
24 Ga0070688_100006224 3300005365 Bacteria 6359
25 Ga0070659_100280157 3300005366 Bacteria 1387
26 Ga0070667_100029386 3300005367 Bacteria 4579
27 Ga0070713_100903258 3300005436 Bacteria 849
28 Ga0070701_10302607 3300005438 Bacteria 983
29 Ga0070705_101561718 3300005440 Unclassified 554
30 Ga0070700_100302332 3300005441 Unclassified 1168
31 Ga0070708_100262144 3300005445 Bacteria 1625
32 Ga0070708_100362745 3300005445 Bacteria 1365
33 Ga0070708_101217036 3300005445 Bacteria 704
34 Ga0070662_100038947 3300005457 Bacteria 3380
35 Ga0068867_100300984 3300005459 Unclassified 1322
36 Ga0070685_10184025 3300005466 Unclassified 1347
37 Ga0070706_100094058 3300005467 Bacteria 2781
38 Ga0070706_101578136 3300005467 Unclassified 599
39 Ga0070707_100028039 3300005468 Bacteria 5357
40 Ga0070707_100153659 3300005468 Bacteria 2241
41 Ga0070707_100620563 3300005468 Bacteria 1044
42 Ga0070698_100191529 3300005471 Bacteria 1982
43 Ga0070698_100379213 3300005471 Bacteria 1347
44 Ga0070698_100683377 3300005471 Unclassified 968
45 Ga0070699_100005675 3300005518 Bacteria 10932
46 Ga0070684_100779577 3300005535 Unclassified 893
47 Ga0070697_100047833 3300005536 Bacteria 3468
48 Ga0070697_100191255 3300005536 Bacteria 1737
49 Ga0070697_100774825 3300005536 Bacteria 848
50 Ga0070697_101048117 3300005536 Bacteria 725
51 Ga0070697_101798512 3300005536 Unclassified 548
52 Ga0068853_100732827 3300005539 Unclassified 944
53 Ga0070672_100076405 3300005543 Bacteria 2675
54 Ga0070665_100351463 3300005548 Bacteria 1479
55 Ga0070665_101301053 3300005548 Unclassified 737
56 Ga0068855_100126055 3300005563 Bacteria 2927
57 Ga0070664_100009130 3300005564 Bacteria 8048
58 Ga0068854_101048259 3300005578 Unclassified 724
59 Ga0070702_100710867 3300005615 Bacteria 767
60 Ga0068852_101013750 3300005616 Unclassified 849
61 Ga0068859_100175549 3300005617 Bacteria 2224
62 Ga0068864_101087170 3300005618 Unclassified 796
63 Ga0068864_101104434 3300005618 Unclassified 789
64 Ga0068861_100169243 3300005719 Bacteria 1810
65 Ga0068861_100176653 3300005719 Bacteria 1774
66 Ga0068870_10156186 3300005840 Bacteria 1348
67 Ga0068863_100022952 3300005841 Bacteria 5964
68 Ga0068863_100730568 3300005841 Bacteria 985
69 Ga0068863_101042555 3300005841 Bacteria 821
70 Ga0068858_100001993 3300005842 Bacteria 20883
71 Ga0068858_100226774 3300005842 Bacteria 1770
72 Ga0068860_100185975 3300005843 Unclassified 2009
73 Ga0068860_100235316 3300005843 Bacteria 1780
74 Ga0068860_100385651 3300005843 Unclassified 1384
75 Ga0068860_100626914 3300005843 Bacteria 1082
76 Ga0068860_102010668 3300005843 Bacteria 599
77 Ga0068862_101731243 3300005844 Bacteria 634
78 Ga0068862_102435680 3300005844 Unclassified 535
79 Ga0081539_10047238 3300005985 Unclassified 2460
80 Ga0075364_10647968 3300006051 Unclassified 721
81 Ga0097621_102057501 3300006237 Unclassified 546
82 Ga0068871_100256759 3300006358 Bacteria 1524
83 Ga0068871_101776483 3300006358 Bacteria 585
84 Ga0075430_100071278 3300006846 Unclassified 2915
85 Ga0075431_100924385 3300006847 Unclassified 841
86 Ga0075433_10170298 3300006852 Bacteria 1938
87 Ga0075434_100389957 3300006871 Unclassified 1414
88 Ga0075434_100393257 3300006871 Bacteria 1407
89 Ga0075429_100309212 3300006880 Bacteria 1384
90 Ga0068865_100317678 3300006881 Bacteria 1252
91 Ga0068865_100707750 3300006881 Unclassified 861
92 Ga0075436_100028487 3300006914 Unclassified 3842
93 Ga0097620_100175539 3300006931 Bacteria 2224
94 Ga0099794_10117218 3300007265 Bacteria 1337
95 Ga0105240_10108093 3300009093 Bacteria 3370
96 Ga0111539_10219651 3300009094 Bacteria 2214
97 Ga0105247_10145694 3300009101 Bacteria 1556
98 Ga0114129_10019018 3300009147 Bacteria 9785
99 Ga0114129_10102528 3300009147 Unclassified 3957
100 Ga0114129_10145874 3300009147 Bacteria 3242
101 Ga0114129_11691116 3300009147 Unclassified 772
102 Ga0114129_13320478 3300009147 Unclassified 520
103 Ga0105241_12567122 3300009174 Bacteria 511
104 Ga0105248_10286401 3300009177 Bacteria 1855
105 Ga0105248_11881747 3300009177 Bacteria 679
106 Ga0105248_11918724 3300009177 Unclassified 672
107 Ga0105248_13248768 3300009177 Unclassified 517
108 Ga0105249_10399346 3300009553 Bacteria 1405
109 Ga0105249_10828730 3300009553 Bacteria 990
110 Ga0105249_10947559 3300009553 Bacteria 929
111 Ga0105246_10234488 3300011119 Bacteria 1447
112 Ga0105246_11597035 3300011119 Unclassified 616
113 Ga0163162_10727858 3300013306 Bacteria 1112
114 Ga0163162_10947285 3300013306 Unclassified 972
115 Ga0157375_10021290 3300013308 Bacteria 5941
116 Ga0163163_10471895 3300014325 Unclassified 1315
117 Ga0163163_10482647 3300014325 Unclassified 1300
118 Ga0157380_10017386 3300014326 Bacteria 5322
119 Ga0157380_10062137 3300014326 Bacteria 2991
120 Ga0157380_10596863 3300014326 Unclassified 1092
121 Ga0182008_10641696 3300014497 Bacteria 600
122 Ga0157377_10010835 3300014745 Bacteria 4527
123 Ga0157377_10658540 3300014745 Unclassified 755
124 Ga0157379_10257204 3300014968 Bacteria 1586
125 Ga0157376_10821634 3300014969 Bacteria 943
126 Ga0163161_10302468 3300017792 Bacteria 1260
127 Ga0213875_10099963 3300021388 Bacteria 1354
128 Ga0207697_10030100 3300025315 Bacteria 2222
129 Ga0207682_10041280 3300025893 Bacteria 1882
130 Ga0207680_10016696 3300025903 Bacteria 3860
131 Ga0207645_10212126 3300025907 Bacteria 1276
132 Ga0207645_10244322 3300025907 Bacteria 1186
133 Ga0207643_10079158 3300025908 Bacteria 1902
134 Ga0207684_10092962 3300025910 Bacteria 2571
135 Ga0207684_10550875 3300025910 Bacteria 987
136 Ga0207662_10098179 3300025918 Bacteria 1812
137 Ga0207657_10006248 3300025919 Bacteria 12387
138 Ga0207657_11025727 3300025919 Bacteria 632
139 Ga0207646_10492943 3300025922 Bacteria 1104
140 Ga0207646_11249065 3300025922 Bacteria 650
141 Ga0207681_10428069 3300025923 Bacteria 1073
142 Ga0207659_10001883 3300025926 Bacteria 12429
143 Ga0207700_10153398 3300025928 Bacteria 1906
144 Ga0207664_11029031 3300025929 Bacteria 738
145 Ga0207644_10221128 3300025931 Bacteria 1501
146 Ga0207690_10480063 3300025932 Unclassified 1003
147 Ga0207706_10062481 3300025933 Bacteria 3280
148 Ga0207706_11417202 3300025933 Unclassified 570
149 Ga0207709_10513375 3300025935 Unclassified 937
150 Ga0207670_10186926 3300025936 Bacteria 1565
151 Ga0207670_10841901 3300025936 Bacteria 766
152 Ga0207704_10289756 3300025938 Bacteria 1249
153 Ga0207704_10692890 3300025938 Unclassified 843
154 Ga0207691_10060624 3300025940 Bacteria 3437
155 Ga0207691_10335226 3300025940 Bacteria 1295
156 Ga0207711_11211955 3300025941 Unclassified 696
157 Ga0207711_11258028 3300025941 Unclassified 682
158 Ga0207711_11904910 3300025941 Bacteria 537
159 Ga0207689_10052171 3300025942 Bacteria 3371
160 Ga0207661_10524318 3300025944 Bacteria 1084
161 Ga0207679_10391755 3300025945 Bacteria 1220
162 Ga0207667_10225308 3300025949 Bacteria 1920
163 Ga0207651_10018898 3300025960 Bacteria 4115
164 Ga0207651_10139032 3300025960 Bacteria 1873
165 Ga0207712_10851407 3300025961 Bacteria 804
166 Ga0207712_11587850 3300025961 Bacteria 586
167 Ga0207640_10832642 3300025981 Unclassified 802
168 Ga0207658_11744087 3300025986 Bacteria 568
169 Ga0207677_10873970 3300026023 Bacteria 809
170 Ga0207703_10009997 3300026035 Bacteria 7441
171 Ga0207703_10715202 3300026035 Bacteria 953
172 Ga0207703_10775793 3300026035 Unclassified 914
173 Ga0207639_12277579 3300026041 Unclassified 503
174 Ga0207708_10371657 3300026075 Unclassified 1177
175 Ga0207641_10110949 3300026088 Bacteria 2431
176 Ga0207641_10301395 3300026088 Bacteria 1514
177 Ga0207641_12523361 3300026088 Unclassified 512
178 Ga0207648_10118306 3300026089 Bacteria 2329
179 Ga0207676_10346788 3300026095 Bacteria 1372
180 Ga0207676_11782220 3300026095 Unclassified 614
181 Ga0207675_100118738 3300026118 Bacteria 2501
182 Ga0207675_100795876 3300026118 Unclassified 958
183 Ga0207698_11609054 3300026142 Unclassified 665
184 Ga0207698_12330075 3300026142 Bacteria 547
185 Ga0207428_10053877 3300027907 Bacteria 3206
186 Ga0268266_11189595 3300028379 Unclassified 737
187 Ga0268265_10817866 3300028380 Bacteria 909
188 Ga0268265_12454919 3300028380 Unclassified 527
189 Ga0268264_10484145 3300028381 Bacteria 1204
190 Ga0268264_10687413 3300028381 Bacteria 1015
191 Ga0268264_11292707 3300028381 Bacteria 739
192 Ga0268264_11571703 3300028381 Bacteria 668
193 Ga0307408_100879729 3300031548 Unclassified 818
194 Ga0307413_10284463 3300031824 Bacteria 1245
195 Ga0307410_11252691 3300031852 Bacteria 647
196 Ga0307406_10069629 3300031901 Bacteria 2301
197 Ga0307407_10107888 3300031903 Bacteria 1742
198 Ga0307412_10190142 3300031911 Bacteria 1551
199 Ga0307409_102787708 3300031995 Bacteria 516
200 Ga0307416_100603651 3300032002 Unclassified 1177
201 Ga0307414_10026217 3300032004 Bacteria 3748
202 Ga0307411_10136806 3300032005 Bacteria 1800
203 Ga0373932_0198055 3300035112 Unclassified 713
204 Ga0373953_0182698 3300035117 Unclassified 905
205 Ga0373937_0970143 3300036401 Unclassified 799
206 Ga0436360_1039220 3300039438 Unclassified 632
207 Ga0436361_0574272 3300039447 Unclassified 662
208 Ga0436363_1182296 3300039450 Unclassified 852
209 Ga0436362_0954442 3300039453 Unclassified 551
210 Ga0451791_0816873 3300041451 Bacteria 913
211 Ga0451797_0793004 3300041453 Bacteria 516
212 Ga0451802_0904456 3300041460 Bacteria 659
213 Ga0451807_0361987 3300041486 Unclassified 670
214 Ga0451807_0448947 3300041486 Bacteria 665
215 Ga0451807_0550254 3300041486 Bacteria 1335
216 Ga0451807_1367243 3300041486 Unclassified 854
217 Ga0451807_1678815 3300041486 Unclassified 564
218 Ga0451853_1510451 3300041512 Unclassified 1139
219 Ga0439443_071106 3300042003 Unclassified 635
220 Ga0450923_103884 3300042125 Unclassified 658
221 Ga0450908_017912 3300042184 Bacteria 1255
222 Ga0439435_0189654 3300042436 Unclassified 674
223 Ga0439444_0076327 3300042437 Bacteria 726
224 Ga0439440_0056497 3300042993 Unclassified 993
225 Ga0495592_0305815 3300046454 Bacteria 1032
226 Ga0495628_0273789 3300046516 Bacteria 1255
227 Ga0495630_0509145 3300046517 Unclassified 923
228 Ga0495666_0399558 3300046526 Bacteria 618
229 Ga0495642_0037909 3300046528 Bacteria 1952
230 Ga0495598_0042909 3300046537 Bacteria 1330
231 Ga0495634_0076616 3300046642 Bacteria 2195
232 Ga0495659_0057715 3300046664 Bacteria 1427
233 Ga0495669_0135381 3300046684 Bacteria 1161
234 Ga0495670_0351717 3300046691 Bacteria 793
235 Ga0495604_0528360 3300047317 Unclassified 763
236 Ga0496106_1547458 3300048909 Bacteria 509
237 Ga0496108_0785117 3300048911 Unclassified 822
238 Ga0501031_0294787 3300049568 Unclassified 1051
239 Ga0501032_0741966 3300049569 Unclassified 621
240 Ga0501033_0583540 3300049570 Unclassified 768
241 Ga0501034_0029594 3300049571 Bacteria 5569
242 Ga0501034_0420461 3300049571 Bacteria 1258
243 Ga0501036_0930642 3300049572 Unclassified 713
244 Ga0501036_1069753 3300049572 Unclassified 659
245 Ga0501036_1415539 3300049572 Unclassified 563
246 Ga0501038_0499027 3300049574 Bacteria 931
247 Ga0501040_0510748 3300049576 Unclassified 866
248 Ga0501041_0582864 3300049577 Unclassified 713
249 Ga0501042_0176252 3300049578 Bacteria 1542
250 Ga0501046_0211121 3300049580 Bacteria 1441
251 Ga0501047_0031100 3300049581 Bacteria 5148
252 Ga0501048_0208890 3300049582 Unclassified 1385
253 Ga0501068_1126853 3300049584 Unclassified 519
254 Ga0501070_1544444 3300049586 Unclassified 501
255 Ga0501071_0250234 3300049587 Unclassified 1337
256 Ga0501071_1290649 3300049587 Unclassified 564
257 Ga0501072_0067179 3300049588 Unclassified 2829
258 Ga0501072_1184972 3300049588 Unclassified 593
259 Ga0501074_0585176 3300049590 Unclassified 789
260 Ga0501075_0396161 3300049591 Bacteria 1053
261 Ga0501075_1466958 3300049591 Unclassified 516
262 Ga0501076_0462497 3300049592 Unclassified 1045
263 Ga0501076_1075734 3300049592 Unclassified 662
264 Ga0501076_1559311 3300049592 Unclassified 542
265 Ga0501077_0853251 3300049593 Unclassified 586
266 Ga0501077_0961941 3300049593 Unclassified 549
267 Ga0501217_042425 3300049661 Unclassified 1162
268 Ga0501235_061489 3300049669 Unclassified 880
269 Ga0501239_043495 3300049672 Bacteria 629
270 Ga0501243_064791 3300049675 Unclassified 684
271 Ga0501251_028324 3300049681 Unclassified 785
272 Ga0501079_0255980 3300049741 Bacteria 1368
273 Ga0501080_0060847 3300049742 Bacteria 3515
274 Ga0501080_1545707 3300049742 Bacteria 563
275 Ga0501081_0549848 3300049743 Unclassified 862
276 Ga0501081_0725849 3300049743 Unclassified 746
277 Ga0501266_027466 3300049763 Unclassified 801
278 Ga0501274_010719 3300049771 Unclassified 848
279 Ga0501035_0767347 3300049822 Bacteria 772
280 Ga0501044_0043975 3300049823 Bacteria 4638
281 Ga0501045_0087296 3300049824 Bacteria 2303
282 nmdc:mga05p37_202199_c1 3300050507 Bacteria 2405
283 nmdc:mga05p37_34416_c1 3300050507 Bacteria 6205
284 nmdc:mga09592_118900_c1 3300050508 Bacteria 2268
285 nmdc:mga0qj67_337117_c1 3300050509 Bacteria 1220
286 nmdc:mga06r32_1574398_c1 3300050510 Unclassified 596
287 nmdc:mga08y16_107381_c1 3300050511 Bacteria 2906
288 nmdc:mga0n895_1054536_c1 3300050512 Bacteria 792
289 nmdc:mga0n895_471152_c1 3300050512 Unclassified 1267
290 nmdc:mga08x19_32985_c1 3300050514 Unclassified 3266
291 nmdc:mga0a205_137626_c1 3300050515 Bacteria 2342
292 Ga0500555_001074 3300053103 Bacteria 9174
293 Ga0500655_003186 3300053133 Bacteria 2977
294 Ga0500616_0000226 3300053153 Bacteria 88101
295 Ga0501082_0607970 3300060353 Unclassified 957
296 Ga0501082_1690790 3300060353 Unclassified 552
297 Ga0530510_0550647 3300061734 Unclassified 876
298 Ga0530510_1130999 3300061734 Unclassified 600
299 Ga0450920_092442
300 JGI24749J21850_1082962
301 JGI24034J26672_10082931
302 rootL2_10009529
303 Ga0065712_10286255
304 Ga0065715_10094919
305 Ga0070683_100817084
306 Ga0070690_100009229
307 Ga0070690_101195287
308 Ga0070677_10037052
309 Ga0068869_100175980
310 Ga0068869_101022761
311 Ga0070666_10029016
312 Ga0070660_100013094
313 Ga0070660_100985420
314 Ga0070689_100008950
315 Ga0070687_100136595
316 Ga0070669_100211090
317 Ga0070675_100004704
318 Ga0070671_100227890
319 Ga0070671_100506264
320 Ga0070671_101149817
321 Ga0070673_100133377
322 Ga0070688_100006224
323 Ga0070659_100280157
324 Ga0070667_100029386
325 Ga0070713_100903258
326 Ga0070701_10302607
327 Ga0070705_101561718
328 Ga0070700_100302332
329 Ga0070708_100262144
330 Ga0070708_100362745
331 Ga0070708_101217036
332 Ga0070662_100038947
333 Ga0068867_100300984
334 Ga0070685_10184025
335 Ga0070706_100094058
336 Ga0070706_101578136
337 Ga0070707_100028039
338 Ga0070707_100153659
339 Ga0070707_100620563
340 Ga0070698_100191529
341 Ga0070698_100379213
342 Ga0070698_100683377
343 Ga0070699_100005675
344 Ga0070684_100779577
345 Ga0070697_100047833
346 Ga0070697_100191255
347 Ga0070697_100774825
348 Ga0070697_101048117
349 Ga0070697_101798512
350 Ga0068853_100732827
351 Ga0070672_100076405
352 Ga0070665_100351463
353 Ga0070665_101301053
354 Ga0068855_100126055
355 Ga0070664_100009130
356 Ga0068854_101048259
357 Ga0070702_100710867
358 Ga0068852_101013750
359 Ga0068859_100175549
360 Ga0068864_101087170
361 Ga0068864_101104434
362 Ga0068861_100169243
363 Ga0068861_100176653
364 Ga0068870_10156186
365 Ga0068863_100022952
366 Ga0068863_100730568
367 Ga0068863_101042555
368 Ga0068858_100001993
369 Ga0068858_100226774
370 Ga0068860_100185975
371 Ga0068860_100235316
372 Ga0068860_100385651
373 Ga0068860_100626914
374 Ga0068860_102010668
375 Ga0068862_101731243
376 Ga0068862_102435680
377 Ga0081539_10047238
378 Ga0075364_10647968
379 Ga0097621_102057501
380 Ga0068871_100256759
381 Ga0068871_101776483
382 Ga0075430_100071278
383 Ga0075431_100924385
384 Ga0075433_10170298
385 Ga0075434_100389957
386 Ga0075434_100393257
387 Ga0075429_100309212
388 Ga0068865_100317678
389 Ga0068865_100707750
390 Ga0075436_100028487
391 Ga0097620_100175539
392 Ga0099794_10117218
393 Ga0105240_10108093
394 Ga0111539_10219651
395 Ga0105247_10145694
396 Ga0114129_10019018
397 Ga0114129_10102528
398 Ga0114129_10145874
399 Ga0114129_11691116
400 Ga0114129_13320478
401 Ga0105241_12567122
402 Ga0105248_10286401
403 Ga0105248_11881747
404 Ga0105248_11918724
405 Ga0105248_13248768
406 Ga0105249_10399346
407 Ga0105249_10828730
408 Ga0105249_10947559
409 Ga0105246_10234488
410 Ga0105246_11597035
411 Ga0163162_10727858
412 Ga0163162_10947285
413 Ga0157375_10021290
414 Ga0163163_10471895
415 Ga0163163_10482647
416 Ga0157380_10017386
417 Ga0157380_10062137
418 Ga0157380_10596863
419 Ga0182008_10641696
420 Ga0157377_10010835
421 Ga0157377_10658540
422 Ga0157379_10257204
423 Ga0157376_10821634
424 Ga0163161_10302468
425 Ga0213875_10099963
426 Ga0207697_10030100
427 Ga0207682_10041280
428 Ga0207680_10016696
429 Ga0207645_10212126
430 Ga0207645_10244322
431 Ga0207643_10079158
432 Ga0207684_10092962
433 Ga0207684_10550875
434 Ga0207662_10098179
435 Ga0207657_10006248
436 Ga0207657_11025727
437 Ga0207646_10492943
438 Ga0207646_11249065
439 Ga0207681_10428069
440 Ga0207659_10001883
441 Ga0207700_10153398
442 Ga0207664_11029031
443 Ga0207644_10221128
444 Ga0207690_10480063
445 Ga0207706_10062481
446 Ga0207706_11417202
447 Ga0207709_10513375
448 Ga0207670_10186926
449 Ga0207670_10841901
450 Ga0207704_10289756
451 Ga0207704_10692890
452 Ga0207691_10060624
453 Ga0207691_10335226
454 Ga0207711_11211955
455 Ga0207711_11258028
456 Ga0207711_11904910
457 Ga0207689_10052171
458 Ga0207661_10524318
459 Ga0207679_10391755
460 Ga0207667_10225308
461 Ga0207651_10018898
462 Ga0207651_10139032
463 Ga0207712_10851407
464 Ga0207712_11587850
465 Ga0207640_10832642
466 Ga0207658_11744087
467 Ga0207677_10873970
468 Ga0207703_10009997
469 Ga0207703_10715202
470 Ga0207703_10775793
471 Ga0207639_12277579
472 Ga0207708_10371657
473 Ga0207641_10110949
474 Ga0207641_10301395
475 Ga0207641_12523361
476 Ga0207648_10118306
477 Ga0207676_10346788
478 Ga0207676_11782220
479 Ga0207675_100118738
480 Ga0207675_100795876
481 Ga0207698_11609054
482 Ga0207698_12330075
483 Ga0207428_10053877
484 Ga0268266_11189595
485 Ga0268265_10817866
486 Ga0268265_12454919
487 Ga0268264_10484145
488 Ga0268264_10687413
489 Ga0268264_11292707
490 Ga0268264_11571703
491 Ga0307408_100879729
492 Ga0307413_10284463
493 Ga0307410_11252691
494 Ga0307406_10069629
495 Ga0307407_10107888
496 Ga0307412_10190142
497 Ga0307409_102787708
498 Ga0307416_100603651
499 Ga0307414_10026217
500 Ga0307411_10136806
501 Ga0373932_0198055
502 Ga0373953_0182698
503 Ga0373937_0970143
504 Ga0436360_1039220
505 Ga0436361_0574272
506 Ga0436363_1182296
507 Ga0436362_0954442
508 Ga0451791_0816873
509 Ga0451797_0793004
510 Ga0451802_0904456
511 Ga0451807_0361987
512 Ga0451807_0448947
513 Ga0451807_0550254
514 Ga0451807_1367243
515 Ga0451807_1678815
516 Ga0451853_1510451
517 Ga0439443_071106
518 Ga0450923_103884
519 Ga0450908_017912
520 Ga0439435_0189654
521 Ga0439444_0076327
522 Ga0439440_0056497
523 Ga0495592_0305815
524 Ga0495628_0273789
525 Ga0495630_0509145
526 Ga0495666_0399558
527 Ga0495642_0037909
528 Ga0495598_0042909
529 Ga0495634_0076616
530 Ga0495659_0057715
531 Ga0495669_0135381
532 Ga0495670_0351717
533 Ga0495604_0528360
534 Ga0496106_1547458
535 Ga0496108_0785117
536 Ga0501031_0294787
537 Ga0501032_0741966
538 Ga0501033_0583540
539 Ga0501034_0029594
540 Ga0501034_0420461
541 Ga0501036_0930642
542 Ga0501036_1069753
543 Ga0501036_1415539
544 Ga0501038_0499027
545 Ga0501040_0510748
546 Ga0501041_0582864
547 Ga0501042_0176252
548 Ga0501046_0211121
549 Ga0501047_0031100
550 Ga0501048_0208890
551 Ga0501068_1126853
552 Ga0501070_1544444
553 Ga0501071_0250234
554 Ga0501071_1290649
555 Ga0501072_0067179
556 Ga0501072_1184972
557 Ga0501074_0585176
558 Ga0501075_0396161
559 Ga0501075_1466958
560 Ga0501076_0462497
561 Ga0501076_1075734
562 Ga0501076_1559311
563 Ga0501077_0853251
564 Ga0501077_0961941
565 Ga0501217_042425
566 Ga0501235_061489
567 Ga0501239_043495
568 Ga0501243_064791
569 Ga0501251_028324
570 Ga0501079_0255980
571 Ga0501080_0060847
572 Ga0501080_1545707
573 Ga0501081_0549848
574 Ga0501081_0725849
575 Ga0501266_027466
576 Ga0501274_010719
577 Ga0501035_0767347
578 Ga0501044_0043975
579 Ga0501045_0087296
580 nmdc:mga05p37_202199_c1
581 nmdc:mga05p37_34416_c1
582 nmdc:mga09592_118900_c1
583 nmdc:mga0qj67_337117_c1
584 nmdc:mga06r32_1574398_c1
585 nmdc:mga08y16_107381_c1
586 nmdc:mga0n895_1054536_c1
587 nmdc:mga0n895_471152_c1
588 nmdc:mga08x19_32985_c1
589 nmdc:mga0a205_137626_c1
590 Ga0500555_001074
591 Ga0500655_003186
592 Ga0500616_0000226
593 Ga0501082_0607970
594 Ga0501082_1690790
595 Ga0530510_0550647
596 Ga0530510_1130999

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04255

DUF433

Protein of unknown function (DUF433)

22

77

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ga1-assembly1.cif.gz_B crystal structure of a duf433 member protein (ava_0674) from anabaena variabilis atcc 29413 at 2.00 a resolution 0.9043 1 68
5af3-assembly1.cif.gz_B x-ray crystal structure of rv2018 from mycobacterium tuberculosis 0.8221 7 59
5af3-assembly1.cif.gz_A x-ray crystal structure of rv2018 from mycobacterium tuberculosis 0.8218 7 59
2ga1-assembly1.cif.gz_B crystal structure of a duf433 member protein (ava_0674) from anabaena variabilis atcc 29413 at 2.00 a resolution 0.7796 1 68
5cy1-assembly1.cif.gz_A tn3 resolvase - site iii complex crystal form i 0.6943 21 69
ID Description Score Start End Superfamily
2ga1B02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9334 7 68 1.10.10.10
af_P9WLC5_172_234_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.855 7 66 1.10.10.10
2ga1B02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8199 7 68 1.10.10.10
af_P9WLC5_172_234_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7974 7 66 1.10.10.10
af_P71963_1_266_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7572 27 65 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A512N3P2-F1-model_v4 Antitoxin 0.9837 5 64
AF-A8LGG5-F1-model_v4 deleted 0.9823 3 64
AF-A0A7W1HWH2-F1-model_v4 DUF433 domain-containing protein 0.9816 6 64
AF-A0A5E4KU47-F1-model_v4 DUF433 domain-containing protein 0.9791 6 67
AF-A0A4P2QVE1-F1-model_v4 DUF433 domain-containing protein 0.9777 3 69

Map