F394339

General Info

Members Datasets Scaffolds Average Seq Length
298 218 297 315

Family's Representative Sequence

Representative Sequence 3300031665|Ga0316575_10024066|Ga0316575_100240663
Length 336
Sequence MLRRMEPVPTKGKAMARRPNASDDGLIELFLDMLAAERGAGENTLSAYRNDLTDLASHLRAAKSSIARADTDDLRGFIKSLDERGFKPASLARRLSAVRQLYRFLYAEGKRGDDPAAVLEGPKRGRSLPKVLSIAEVDTLLAKARANADDTTPPPAQRLRAVRLLCLLEVVYATGLRVSELVALPASAARRDQKMLVVRGKGGKERLVPLNKAARQTMTEYLSLRSEAGKANEKSKKAPESKWLFPSFGETGHLTRQHFARDLKALGAACGIGGERLSPHVLRHAFASHLLHNGADLRVVQTLLGHADISTTQIYTHVLEDRLKSLVRDLHPLGEG

Samples

Sample ID Description Type Environment
1 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
60 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
62 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
63 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
94 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
95 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
96 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
97 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
98 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
99 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
100 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
101 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
102 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
103 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
104 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
105 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
106 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
107 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
108 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
110 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
111 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
112 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
113 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
114 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
115 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
116 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
117 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
118 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
119 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
120 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
121 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
122 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
123 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
133 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
134 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
135 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
136 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
137 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
142 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
143 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
144 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
145 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
146 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
147 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
148 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
149 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
150 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
151 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
152 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
153 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
154 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
155 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
158 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
159 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
160 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
161 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
162 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
165 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
166 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
167 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
168 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
169 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
170 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
171 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
172 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
192 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
193 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
194 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
196 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
197 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
198 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
199 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
200 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
201 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
208 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
209 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
210 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
211 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
212 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
213 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
214 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
215 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
216 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
217 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
218 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.33
Metatranscriptomes 0.34
Isolates 0.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.05
Nodule 0
Rhizoplane 7.05
Rhizosphere 83.22
Stem 0
Stem Tuber 0
Unclassified 1.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10013258 3300003203 Bacteria 3549
2 JGI25153J46596_10020575 3300003215 Bacteria 2492
3 Ga0070658_10014677 3300005327 Bacteria 6284
4 Ga0070658_10106452 3300005327 Bacteria 2320
5 Ga0070676_10030532 3300005328 Bacteria 3074
6 Ga0070690_100003947 3300005330 Bacteria 8190
7 Ga0070670_100137643 3300005331 Bacteria 2110
8 Ga0070680_100008619 3300005336 Bacteria 7816
9 Ga0070689_100006271 3300005340 Bacteria 8210
10 Ga0070689_100051132 3300005340 Bacteria 3193
11 Ga0070689_100386456 3300005340 Bacteria 1180
12 Ga0070687_100034082 3300005343 Bacteria 2518
13 Ga0070687_100078786 3300005343 Bacteria 1791
14 Ga0070675_100281684 3300005354 Bacteria 1461
15 Ga0070675_100292573 3300005354 Bacteria 1433
16 Ga0070674_100002246 3300005356 Bacteria 10641
17 Ga0070674_100045258 3300005356 Bacteria 3007
18 Ga0070688_100007704 3300005365 Bacteria 5815
19 Ga0070659_100052987 3300005366 Bacteria 3192
20 Ga0070667_100034910 3300005367 Bacteria 4211
21 Ga0070714_100085792 3300005435 Bacteria 2751
22 Ga0070678_100008402 3300005456 Bacteria 6183
23 Ga0070678_100028850 3300005456 Bacteria 3791
24 Ga0070681_10039831 3300005458 Bacteria 4710
25 Ga0070681_10162000 3300005458 Bacteria 2161
26 Ga0068867_100008051 3300005459 Bacteria 7448
27 Ga0068867_100023806 3300005459 Bacteria 4387
28 Ga0070685_10072417 3300005466 Bacteria 2045
29 Ga0070679_100063420 3300005530 Bacteria 3683
30 Ga0070679_100084277 3300005530 Bacteria 3167
31 Ga0070679_100092210 3300005530 Bacteria 3017
32 Ga0070679_100440514 3300005530 Bacteria 1248
33 Ga0068853_100384910 3300005539 Bacteria 1310
34 Ga0070672_100032911 3300005543 Bacteria 3920
35 Ga0068855_100011392 3300005563 Bacteria 10739
36 Ga0068855_100449444 3300005563 Bacteria 1406
37 Ga0068854_100019175 3300005578 Bacteria 4605
38 Ga0068852_100155747 3300005616 Bacteria 2128
39 Ga0068852_100215586 3300005616 Bacteria 1823
40 Ga0068864_100099393 3300005618 Bacteria 2577
41 Ga0068860_100126676 3300005843 Bacteria 2448
42 Ga0068862_100188034 3300005844 Bacteria 1857
43 Ga0081540_1000005 3300005983 Bacteria 227052
44 Ga0081539_10001341 3300005985 Bacteria 42889
45 Ga0070717_10228744 3300006028 Bacteria 1637
46 Ga0075365_10024805 3300006038 Bacteria 3789
47 Ga0075368_10004691 3300006042 Bacteria 4650
48 Ga0075363_100000174 3300006048 Bacteria 16828
49 Ga0075364_10000925 3300006051 Bacteria 15511
50 Ga0070712_100057155 3300006175 Bacteria 2739
51 Ga0075362_10006120 3300006177 Bacteria 4460
52 Ga0075367_10063533 3300006178 Bacteria 2207
53 Ga0075369_10036375 3300006186 Bacteria 2095
54 Ga0075366_10027679 3300006195 Bacteria 3327
55 Ga0075431_100571428 3300006847 Bacteria 1117
56 Ga0075433_10105491 3300006852 Bacteria 2497
57 Ga0075433_10260409 3300006852 Bacteria 1538
58 Ga0075434_100066798 3300006871 Bacteria 3583
59 Ga0075434_100124186 3300006871 Bacteria 2598
60 Ga0075435_100077372 3300007076 Bacteria 2728
61 Ga0111539_10019416 3300009094 Bacteria 8389
62 Ga0111539_10026013 3300009094 Bacteria 7162
63 Ga0114129_10316698 3300009147 Bacteria 2075
64 Ga0105248_10015107 3300009177 Bacteria 8503
65 Ga0105248_10391312 3300009177 Bacteria 1565
66 Ga0105238_10030196 3300009551 Bacteria 5515
67 Ga0105238_10133845 3300009551 Bacteria 2457
68 Ga0105249_10367201 3300009553 Bacteria 1462
69 Ga0105246_10244038 3300011119 Bacteria 1422
70 Ga0157373_10073082 3300013100 Bacteria 2420
71 Ga0157370_10148284 3300013104 Bacteria 2184
72 Ga0163162_10168777 3300013306 Bacteria 2312
73 Ga0163162_10304856 3300013306 Bacteria 1725
74 Ga0157372_10076656 3300013307 Bacteria 3775
75 Ga0157372_10237576 3300013307 Bacteria 2114
76 Ga0157375_10638003 3300013308 Bacteria 1222
77 Ga0163163_10192352 3300014325 Bacteria 2089
78 Ga0163163_10693602 3300014325 Bacteria 1082
79 Ga0157380_10394012 3300014326 Bacteria 1311
80 Ga0182008_10083427 3300014497 Bacteria 1573
81 Ga0206356_11841863 3300020070 Bacteria 1124
82 Ga0209233_1009263 3300025261 Bacteria 3004
83 Ga0209758_1000430 3300025297 Bacteria 71132
84 Ga0207697_10017547 3300025315 Bacteria 2941
85 Ga0207682_10003834 3300025893 Bacteria 6455
86 Ga0207688_10026349 3300025901 Bacteria 3197
87 Ga0207688_10139334 3300025901 Bacteria 1427
88 Ga0207645_10037006 3300025907 Bacteria 3133
89 Ga0207705_10062918 3300025909 Bacteria 2680
90 Ga0207707_10132966 3300025912 Bacteria 2176
91 Ga0207707_10181551 3300025912 Bacteria 1837
92 Ga0207707_10362880 3300025912 Bacteria 1247
93 Ga0207693_10048512 3300025915 Bacteria 3335
94 Ga0207660_10047336 3300025917 Bacteria 3040
95 Ga0207662_10005397 3300025918 Bacteria 6809
96 Ga0207652_10049403 3300025921 Bacteria 3601
97 Ga0207652_10075775 3300025921 Bacteria 2932
98 Ga0207650_10089483 3300025925 Bacteria 2350
99 Ga0207650_10451593 3300025925 Bacteria 1070
100 Ga0207664_10149665 3300025929 Bacteria 1982
101 Ga0207644_10239379 3300025931 Bacteria 1444
102 Ga0207670_10004720 3300025936 Bacteria 7390
103 Ga0207670_10093944 3300025936 Bacteria 2126
104 Ga0207669_10001250 3300025937 Bacteria 10802
105 Ga0207669_10048606 3300025937 Bacteria 2521
106 Ga0207704_10250838 3300025938 Bacteria 1328
107 Ga0207665_10059178 3300025939 Bacteria 2592
108 Ga0207691_10004922 3300025940 Bacteria 12889
109 Ga0207691_10156825 3300025940 Bacteria 1999
110 Ga0207711_10005226 3300025941 Bacteria 10999
111 Ga0207661_10240974 3300025944 Bacteria 1605
112 Ga0207667_10024638 3300025949 Bacteria 6602
113 Ga0207658_10133970 3300025986 Bacteria 1995
114 Ga0207648_10002948 3300026089 Bacteria 18006
115 Ga0207648_10033201 3300026089 Bacteria 4552
116 Ga0207676_10011837 3300026095 Bacteria 6242
117 Ga0207674_10364569 3300026116 Bacteria 1397
118 Ga0207675_100292428 3300026118 Bacteria 1585
119 Ga0207698_10137836 3300026142 Bacteria 2096
120 Ga0209970_1002027 3300027614 Bacteria 3481
121 Ga0268265_10226095 3300028380 Bacteria 1641
122 Ga0268264_10084040 3300028381 Bacteria 2728
123 Ga0268264_10356593 3300028381 Bacteria 1394
124 Ga0265330_10019679 3300031235 Bacteria 3090
125 Ga0265332_10025083 3300031238 Bacteria 2621
126 Ga0265328_10000971 3300031239 Bacteria 13164
127 Ga0265325_10031299 3300031241 Bacteria 2848
128 Ga0265325_10044214 3300031241 Bacteria 2321
129 Ga0265340_10017200 3300031247 Bacteria 3740
130 Ga0265340_10036841 3300031247 Bacteria 2423
131 Ga0265339_10005736 3300031249 Bacteria 8245
132 Ga0265339_10005962 3300031249 Bacteria 8056
133 Ga0265331_10014621 3300031250 Bacteria 4170
134 Ga0265331_10045419 3300031250 Bacteria 2121
135 Ga0307513_10102099 3300031456 Bacteria 2888
136 Ga0307513_10138070 3300031456 Bacteria 2369
137 Ga0316575_10024066 3300031665 Bacteria 2356
138 Ga0265314_10042042 3300031711 Bacteria 3264
139 Ga0265314_10061433 3300031711 Bacteria 2558
140 Ga0265314_10165677 3300031711 Bacteria 1339
141 Ga0265342_10000139 3300031712 Bacteria 81785
142 Ga0265342_10004338 3300031712 Bacteria 11220
143 Ga0316583_10052014 3300032133 Bacteria 1441
144 Ga0373938_0009009 3300034957 Bacteria 1796
145 Ga0373928_0041169 3300035084 Bacteria 1061
146 Ga0373951_0004828 3300035091 Bacteria 3173
147 Ga0373923_0005873 3300035111 Bacteria 4194
148 Ga0373936_0002216 3300035113 Bacteria 7252
149 Ga0373936_0039106 3300035113 Bacteria 1898
150 Ga0373939_0020622 3300035114 Bacteria 1793
151 Ga0373939_0092303 3300035114 Bacteria 1025
152 Ga0373945_0011777 3300035116 Bacteria 2896
153 Ga0373953_0001424 3300035117 Bacteria 6914
154 Ga0373954_0002291 3300035118 Bacteria 7971
155 Ga0373954_0085874 3300035118 Bacteria 1507
156 Ga0373956_0032255 3300035119 Bacteria 2298
157 Ga0373943_0001584 3300035170 Bacteria 10306
158 Ga0373943_0167598 3300035170 Bacteria 1200
159 Ga0373946_0002328 3300035171 Bacteria 6719
160 Ga0373955_0000338 3300035172 Bacteria 19607
161 Ga0373924_0005579 3300035410 Bacteria 4463
162 Ga0373931_0007577 3300035691 Bacteria 5113
163 Ga0373931_0015115 3300035691 Bacteria 3782
164 Ga0373935_0040406 3300035692 Bacteria 2928
165 Ga0373935_0185484 3300035692 Bacteria 1430
166 Ga0373927_0022573 3300035695 Bacteria 4122
167 Ga0373927_0277612 3300035695 Bacteria 1102
168 Ga0373933_0012856 3300035724 Bacteria 4629
169 Ga0373947_0003801 3300035725 Bacteria 8902
170 Ga0373947_0035434 3300035725 Bacteria 2955
171 Ga0373937_0000005 3300036401 Bacteria 199965
172 Ga0373937_0555725 3300036401 Bacteria 1090
173 Ga0373925_0000007 3300037068 Bacteria 257023
174 Ga0373925_0007976 3300037068 Bacteria 7710
175 Ga0373925_0128986 3300037068 Bacteria 1970
176 Ga0395899_0015917 3300037312 Bacteria 5735
177 Ga0395900_0004045 3300037418 Bacteria 15646
178 Ga0395900_0015042 3300037418 Bacteria 7887
179 Ga0395898_0012308 3300037466 Bacteria 8847
180 Ga0395898_0057536 3300037466 Bacteria 3788
181 Ga0395898_0084049 3300037466 Bacteria 3068
182 Ga0436364_1367845 3300037853 Bacteria 1379
183 Ga0395901_0047625 3300038443 Bacteria 4451
184 Ga0395901_0252306 3300038443 Bacteria 1838
185 Ga0436365_0301595 3300039437 Bacteria 4258
186 Ga0436361_0613394 3300039447 Bacteria 2769
187 Ga0436363_0311730 3300039450 Bacteria 3816
188 Ga0439450_009727 3300042008 Bacteria 1836
189 Ga0450923_010843 3300042125 Bacteria 1627
190 Ga0439459_0018908 3300042438 Bacteria 1300
191 Ga0466963_0021477 3300044694 Bacteria 4073
192 Ga0466967_0154847 3300045976 Bacteria 2146
193 Ga0495592_0000241 3300046454 Bacteria 46812
194 Ga0495629_0015097 3300046459 Bacteria 5552
195 Ga0495629_0167508 3300046459 Bacteria 1525
196 Ga0495638_0011669 3300046460 Bacteria 6051
197 Ga0495651_0000555 3300046462 Bacteria 28819
198 Ga0495653_0000103 3300046463 Bacteria 69772
199 Ga0495662_0012843 3300046476 Bacteria 4082
200 Ga0495664_0000003 3300046477 Bacteria 551602
201 Ga0495664_0095150 3300046477 Bacteria 1793
202 Ga0495608_0000131 3300046511 Bacteria 53612
203 Ga0495608_0158911 3300046511 Bacteria 1438
204 Ga0495618_0000019 3300046514 Bacteria 136770
205 Ga0495628_0000080 3300046516 Bacteria 75108
206 Ga0495630_0000989 3300046517 Bacteria 19766
207 Ga0495630_0345875 3300046517 Bacteria 1138
208 Ga0495652_0000006 3300046529 Bacteria 459709
209 Ga0495652_0280902 3300046529 Bacteria 1219
210 Ga0495665_0083169 3300046531 Bacteria 1683
211 Ga0495640_0000002 3300046533 Bacteria 646434
212 Ga0495587_0000001 3300046536 Bacteria 724132
213 Ga0495587_0045334 3300046536 Bacteria 2614
214 Ga0495621_0031398 3300046539 Bacteria 1822
215 Ga0495645_0000009 3300046543 Bacteria 239632
216 Ga0495667_0000021 3300046559 Bacteria 180625
217 Ga0495635_0000001 3300046663 Bacteria 704901
218 Ga0495657_0000088 3300046675 Bacteria 81307
219 Ga0495599_0000025 3300046678 Bacteria 120337
220 Ga0495623_0000018 3300046679 Bacteria 107338
221 Ga0495646_0000003 3300046680 Bacteria 287773
222 Ga0495647_0065520 3300046681 Bacteria 1443
223 Ga0495613_0052038 3300046689 Bacteria 3017
224 Ga0495600_0000042 3300046809 Bacteria 74873
225 Ga0495581_0008078 3300047315 Bacteria 6092
226 Ga0495604_0000008 3300047317 Bacteria 341160
227 Ga0495674_0000028 3300047319 Bacteria 124722
228 Ga0495680_0001113 3300047322 Bacteria 29690
229 Ga0495675_0000691 3300047444 Bacteria 21173
230 Ga0495684_0000002 3300047471 Bacteria 341216
231 Ga0495593_0005631 3300047673 Bacteria 7394
232 Ga0495602_0000022 3300048088 Bacteria 163672
233 Ga0496100_0228184 3300048903 Bacteria 1369
234 Ga0496101_0002031 3300048904 Bacteria 12306
235 Ga0496103_0039827 3300048906 Bacteria 2888
236 Ga0496104_0001419 3300048907 Bacteria 20752
237 Ga0496104_0001499 3300048907 Bacteria 20140
238 Ga0496104_0017387 3300048907 Bacteria 6548
239 Ga0496105_0010619 3300048908 Bacteria 7245
240 Ga0496105_0181624 3300048908 Bacteria 1723
241 Ga0496106_0258433 3300048909 Bacteria 1393
242 Ga0496107_0033824 3300048910 Bacteria 3658
243 Ga0496108_0332790 3300048911 Bacteria 1324
244 Ga0496109_0169885 3300048912 Bacteria 2045
245 Ga0496109_0300207 3300048912 Bacteria 1514
246 Ga0496111_0036104 3300048914 Bacteria 3534
247 Ga0496112_0093346 3300048915 Bacteria 2980
248 Ga0496112_0115132 3300048915 Bacteria 2659
249 Ga0496112_0173890 3300048915 Bacteria 2119
250 Ga0496115_0019547 3300048918 Bacteria 5214
251 Ga0496115_0044413 3300048918 Bacteria 3544
252 Ga0496115_0052116 3300048918 Bacteria 3282
253 Ga0496115_0255024 3300048918 Bacteria 1443
254 Ga0501032_0026639 3300049569 Bacteria 3974
255 Ga0501034_0024050 3300049571 Bacteria 6199
256 Ga0501034_0169483 3300049571 Bacteria 2151
257 Ga0501037_0060180 3300049573 Bacteria 2770
258 Ga0501038_0028450 3300049574 Bacteria 4966
259 Ga0501047_0010868 3300049581 Bacteria 8605
260 Ga0501048_0140640 3300049582 Bacteria 1707
261 Ga0501071_0254722 3300049587 Bacteria 1325
262 Ga0501073_0046862 3300049589 Bacteria 3039
263 Ga0501073_0060313 3300049589 Bacteria 2647
264 Ga0501083_0005209 3300049744 Bacteria 9202
265 Ga0501083_0030262 3300049744 Bacteria 3720
266 Ga0501035_0283157 3300049822 Bacteria 1401
267 Ga0501044_0020418 3300049823 Bacteria 7074
268 Ga0501044_0082893 3300049823 Bacteria 3243
269 nmdc:mga03n38_3664_c1 3300050490 Bacteria 4969
270 nmdc:mga00v17_18034_c1 3300050491 Bacteria 4006
271 nmdc:mga00v17_34258_c1 3300050491 Bacteria 3014
272 nmdc:mga0yw44_232278_c1 3300050492 Bacteria 1224
273 nmdc:mga0k408_87405_c1 3300050493 Bacteria 1831
274 nmdc:mga06z11_25963_c1 3300050494 Bacteria 2783
275 nmdc:mga06z11_36026_c1 3300050494 Bacteria 2439
276 nmdc:mga07m45_18447_c1 3300050496 Bacteria 3766
277 nmdc:mga05p37_177567_c1 3300050507 Bacteria 2593
278 nmdc:mga08y16_215545_c1 3300050511 Bacteria 1988
279 nmdc:mga0n895_267351_c1 3300050512 Bacteria 1735
280 nmdc:mga0rr50_312705_c1 3300050513 Bacteria 1316
281 nmdc:mga0a205_52232_c1 3300050515 Bacteria 3945
282 nmdc:mga0sz30_37487_c1 3300050516 Bacteria 2029
283 Ga0495601_0000001 3300053077 Bacteria 549454
284 Ga0495601_0021394 3300053077 Bacteria 3961
285 Ga0495612_0000003 3300053078 Bacteria 303629
286 Ga0495655_0012554 3300053083 Bacteria 1730
287 Ga0495595_0000093 3300053084 Bacteria 42083
288 Ga0495595_0032397 3300053084 Bacteria 2354
289 Ga0495619_0000004 3300053085 Bacteria 500068
290 Ga0500646_0013460 3300053090 Bacteria 2117
291 Ga0500593_002013 3300053117 Bacteria 7373
292 Ga0500577_0106045 3300053142 Bacteria 1154
293 Ga0500616_0087996 3300053153 Bacteria 1545
294 Ga0501084_0124129 3300054114 Bacteria 2172
295 Ga0501084_0275691 3300054114 Bacteria 1420
296 Ga0501082_0012588 3300060353 Bacteria 7270
297 Ga0501082_0238818 3300060353 Bacteria 1581

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026116 Ga0207674_10364569 Ga0207674_103645693 253
2 3300039447 Ga0436361_0613394 Ga0436361_0613394_156_1112 267
3 3300005367 Ga0070667_100034910 Ga0070667_1000349104 272
4 3300031235 Ga0265330_10019679 Ga0265330_100196794 273
5 3300031250 Ga0265331_10014621 Ga0265331_100146211 273
6 3300031250 Ga0265331_10045419 Ga0265331_100454192 278
7 3300031238 Ga0265332_10025083 Ga0265332_100250832 280
8 3300031241 Ga0265325_10044214 Ga0265325_100442142 280
9 3300031247 Ga0265340_10036841 Ga0265340_100368412 280
10 3300031249 Ga0265339_10005962 Ga0265339_100059621 280
11 3300031712 Ga0265342_10000139 Ga0265342_1000013939 280
12 3300035113 Ga0373936_0039106 Ga0373936_0039106_13_978 282
13 3300009147 Ga0114129_10316698 Ga0114129_103166983 283
14 3300050507 nmdc:mga05p37_177567_c1 nmdc:mga05p37_177567_c1_1551_2489 283
15 3300060353 Ga0501082_0238818 Ga0501082_0238818_82_1014 284
16 3300005578 Ga0068854_100019175 Ga0068854_1000191754 285
17 3300006175 Ga0070712_100057155 Ga0070712_1000571554 285
18 3300025915 Ga0207693_10048512 Ga0207693_100485122 285
19 3300025917 Ga0207660_10047336 Ga0207660_100473363 285
20 3300005458 Ga0070681_10162000 Ga0070681_101620002 286
21 3300005530 Ga0070679_100063420 Ga0070679_1000634203 286
22 3300005539 Ga0068853_100384910 Ga0068853_1003849101 286
23 3300006871 Ga0075434_100124186 Ga0075434_1001241862 286
24 3300013307 Ga0157372_10076656 Ga0157372_100766565 286
25 3300025912 Ga0207707_10181551 Ga0207707_101815512 286
26 3300025925 Ga0207650_10451593 Ga0207650_104515932 286
27 3300025939 Ga0207665_10059178 Ga0207665_100591782 286
28 3300028380 Ga0268265_10226095 Ga0268265_102260951 286
29 3300050512 nmdc:mga0n895_267351_c1 nmdc:mga0n895_267351_c1_522_1472 286
30 3300031241 Ga0265325_10031299 Ga0265325_100312993 288
31 3300009094 Ga0111539_10019416 Ga0111539_100194166 290
32 3300025921 Ga0207652_10049403 Ga0207652_100494034 291
33 3300031711 Ga0265314_10165677 Ga0265314_101656771 291
34 3300050491 nmdc:mga00v17_34258_c1 nmdc:mga00v17_34258_c1_1500_2411 291
35 3300035695 Ga0373927_0277612 Ga0373927_0277612_73_1014 293
36 3300035725 Ga0373947_0035434 Ga0373947_0035434_1111_2052 293
37 3300036401 Ga0373937_0555725 Ga0373937_0555725_115_1056 293
38 3300037068 Ga0373925_0128986 Ga0373925_0128986_168_1109 293
39 3300042125 Ga0450923_010843 Ga0450923_010843_47_988 293
40 3300046477 Ga0495664_0095150 Ga0495664_0095150_223_1164 293
41 3300046511 Ga0495608_0158911 Ga0495608_0158911_103_1044 293
42 3300046536 Ga0495587_0045334 Ga0495587_0045334_560_1501 293
43 3300053077 Ga0495601_0021394 Ga0495601_0021394_792_1733 293
44 3300053084 Ga0495595_0032397 Ga0495595_0032397_734_1675 293
45 3300007076 Ga0075435_100077372 Ga0075435_1000773724 295
46 3300050513 nmdc:mga0rr50_312705_c1 nmdc:mga0rr50_312705_c1_137_1096 295
47 3300005530 Ga0070679_100084277 Ga0070679_1000842774 297
48 3300038443 Ga0395901_0252306 Ga0395901_0252306_897_1820 297
49 3300006028 Ga0070717_10228744 Ga0070717_102287443 301
50 3300054114 Ga0501084_0124129 Ga0501084_0124129_712_1650 301
51 3300006847 Ga0075431_100571428 Ga0075431_1005714281 303
52 3300006852 Ga0075433_10105491 Ga0075433_101054912 305
53 3300050515 nmdc:mga0a205_52232_c1 nmdc:mga0a205_52232_c1_2168_3124 305
54 3300003215 JGI25153J46596_10020575 JGI25153J46596_100205752 306
55 3300005331 Ga0070670_100137643 Ga0070670_1001376433 306
56 3300005343 Ga0070687_100034082 Ga0070687_1000340823 306
57 3300011119 Ga0105246_10244038 Ga0105246_102440381 306
58 3300014325 Ga0163163_10192352 Ga0163163_101923522 306
59 3300025297 Ga0209758_1000430 Ga0209758_100043025 306
60 3300025925 Ga0207650_10089483 Ga0207650_100894832 306
61 3300053153 Ga0500616_0087996 Ga0500616_0087996_454_1455 306
62 3300005354 Ga0070675_100292573 Ga0070675_1002925731 307
63 3300005356 Ga0070674_100002246 Ga0070674_1000022463 307
64 3300005456 Ga0070678_100008402 Ga0070678_1000084027 307
65 3300005459 Ga0068867_100008051 Ga0068867_1000080514 307
66 3300005466 Ga0070685_10072417 Ga0070685_100724171 307
67 3300025315 Ga0207697_10017547 Ga0207697_100175472 307
68 3300025893 Ga0207682_10003834 Ga0207682_100038344 307
69 3300025901 Ga0207688_10026349 Ga0207688_100263494 307
70 3300025937 Ga0207669_10001250 Ga0207669_100012509 307
71 3300025940 Ga0207691_10004922 Ga0207691_100049225 307
72 3300025986 Ga0207658_10133970 Ga0207658_101339701 307
73 3300026089 Ga0207648_10002948 Ga0207648_1000294812 307
74 3300026118 Ga0207675_100292428 Ga0207675_1002924281 307
75 3300046539 Ga0495621_0031398 Ga0495621_0031398_683_1696 307
76 3300005328 Ga0070676_10030532 Ga0070676_100305323 308
77 3300005330 Ga0070690_100003947 Ga0070690_1000039472 308
78 3300005340 Ga0070689_100386456 Ga0070689_1003864562 308
79 3300005354 Ga0070675_100281684 Ga0070675_1002816842 308
80 3300005356 Ga0070674_100045258 Ga0070674_1000452584 308
81 3300005365 Ga0070688_100007704 Ga0070688_1000077045 308
82 3300005456 Ga0070678_100028850 Ga0070678_1000288502 308
83 3300005459 Ga0068867_100023806 Ga0068867_1000238063 308
84 3300005543 Ga0070672_100032911 Ga0070672_1000329115 308
85 3300005618 Ga0068864_100099393 Ga0068864_1000993934 308
86 3300005843 Ga0068860_100126676 Ga0068860_1001266762 308
87 3300005844 Ga0068862_100188034 Ga0068862_1001880343 308
88 3300009177 Ga0105248_10015107 Ga0105248_100151076 308
89 3300009177 Ga0105248_10391312 Ga0105248_103913123 308
90 3300009553 Ga0105249_10367201 Ga0105249_103672012 308
91 3300013306 Ga0163162_10168777 Ga0163162_101687772 308
92 3300013306 Ga0163162_10304856 Ga0163162_103048562 308
93 3300013308 Ga0157375_10638003 Ga0157375_106380032 308
94 3300025907 Ga0207645_10037006 Ga0207645_100370062 308
95 3300025931 Ga0207644_10239379 Ga0207644_102393792 308
96 3300025936 Ga0207670_10004720 Ga0207670_100047207 308
97 3300025937 Ga0207669_10048606 Ga0207669_100486064 308
98 3300025938 Ga0207704_10250838 Ga0207704_102508381 308
99 3300025940 Ga0207691_10156825 Ga0207691_101568252 308
100 3300025941 Ga0207711_10005226 Ga0207711_100052269 308
101 3300026089 Ga0207648_10033201 Ga0207648_100332014 308
102 3300026095 Ga0207676_10011837 Ga0207676_100118375 308
103 3300028381 Ga0268264_10084040 Ga0268264_100840402 308
104 3300028381 Ga0268264_10356593 Ga0268264_103565931 308
105 3300034957 Ga0373938_0009009 Ga0373938_0009009_752_1693 308
106 3300035084 Ga0373928_0041169 Ga0373928_0041169_46_987 308
107 3300035114 Ga0373939_0020622 Ga0373939_0020622_241_1182 308
108 3300035114 Ga0373939_0092303 Ga0373939_0092303_67_1008 308
109 3300035170 Ga0373943_0167598 Ga0373943_0167598_28_969 308
110 3300035691 Ga0373931_0007577 Ga0373931_0007577_3057_3998 308
111 3300035691 Ga0373931_0015115 Ga0373931_0015115_1016_1957 308
112 3300035692 Ga0373935_0040406 Ga0373935_0040406_57_998 308
113 3300046460 Ga0495638_0011669 Ga0495638_0011669_796_1800 308
114 3300048904 Ga0496101_0002031 Ga0496101_0002031_4618_5559 308
115 3300048906 Ga0496103_0039827 Ga0496103_0039827_138_1079 308
116 3300048907 Ga0496104_0017387 Ga0496104_0017387_3706_4647 308
117 3300048910 Ga0496107_0033824 Ga0496107_0033824_239_1180 308
118 3300048914 Ga0496111_0036104 Ga0496111_0036104_2346_3287 308
119 3300048915 Ga0496112_0115132 Ga0496112_0115132_725_1666 308
120 3300048918 Ga0496115_0255024 Ga0496115_0255024_33_971 308
121 3300050492 nmdc:mga0yw44_232278_c1 nmdc:mga0yw44_232278_c1_146_1150 308
122 3300050494 nmdc:mga06z11_36026_c1 nmdc:mga06z11_36026_c1_423_1364 308
123 3300050516 nmdc:mga0sz30_37487_c1 nmdc:mga0sz30_37487_c1_222_1226 308
124 3300053083 Ga0495655_0012554 Ga0495655_0012554_725_1672 308
125 3300053090 Ga0500646_0013460 Ga0500646_0013460_407_1411 308
126 3300053142 Ga0500577_0106045 Ga0500577_0106045_42_1043 308
127 iso_pu_bacteria 2891088606 2891089961 308
128 3300005327 Ga0070658_10014677 Ga0070658_100146772 309
129 3300005327 Ga0070658_10106452 Ga0070658_101064522 309
130 3300005336 Ga0070680_100008619 Ga0070680_1000086196 309
131 3300005366 Ga0070659_100052987 Ga0070659_1000529873 309
132 3300005435 Ga0070714_100085792 Ga0070714_1000857921 309
133 3300005458 Ga0070681_10039831 Ga0070681_100398315 309
134 3300005530 Ga0070679_100092210 Ga0070679_1000922104 309
135 3300005563 Ga0068855_100011392 Ga0068855_1000113927 309
136 3300005563 Ga0068855_100449444 Ga0068855_1004494442 309
137 3300005616 Ga0068852_100155747 Ga0068852_1001557472 309
138 3300005616 Ga0068852_100215586 Ga0068852_1002155862 309
139 3300006038 Ga0075365_10024805 Ga0075365_100248052 309
140 3300006042 Ga0075368_10004691 Ga0075368_100046913 309
141 3300006178 Ga0075367_10063533 Ga0075367_100635334 309
142 3300006186 Ga0075369_10036375 Ga0075369_100363753 309
143 3300009551 Ga0105238_10133845 Ga0105238_101338452 309
144 3300013104 Ga0157370_10148284 Ga0157370_101482842 309
145 3300013307 Ga0157372_10237576 Ga0157372_102375762 309
146 3300020070 Ga0206356_11841863 Ga0206356_118418632 309
147 3300025909 Ga0207705_10062918 Ga0207705_100629182 309
148 3300025912 Ga0207707_10132966 Ga0207707_101329662 309
149 3300025921 Ga0207652_10075775 Ga0207652_100757754 309
150 3300025929 Ga0207664_10149665 Ga0207664_101496652 309
151 3300025944 Ga0207661_10240974 Ga0207661_102409743 309
152 3300025949 Ga0207667_10024638 Ga0207667_100246382 309
153 3300026142 Ga0207698_10137836 Ga0207698_101378364 309
154 3300031711 Ga0265314_10061433 Ga0265314_100614333 309
155 3300031712 Ga0265342_10004338 Ga0265342_1000433810 309
156 3300039437 Ga0436365_0301595 Ga0436365_0301595_121_1071 309
157 3300045976 Ga0466967_0154847 Ga0466967_0154847_878_1846 309
158 3300048903 Ga0496100_0228184 Ga0496100_0228184_239_1189 309
159 3300048908 Ga0496105_0181624 Ga0496105_0181624_755_1705 309
160 3300048918 Ga0496115_0052116 Ga0496115_0052116_2182_3132 309
161 3300049822 Ga0501035_0283157 Ga0501035_0283157_273_1226 309
162 3300050494 nmdc:mga06z11_25963_c1 nmdc:mga06z11_25963_c1_60_1025 309
163 3300050496 nmdc:mga07m45_18447_c1 nmdc:mga07m45_18447_c1_2790_3755 309
164 3300005983 Ga0081540_1000005 Ga0081540_10000054 310
165 3300031239 Ga0265328_10000971 Ga0265328_1000097117 310
166 3300031456 Ga0307513_10102099 Ga0307513_101020992 310
167 3300031456 Ga0307513_10138070 Ga0307513_101380701 310
168 3300035118 Ga0373954_0085874 Ga0373954_0085874_349_1359 310
169 3300037312 Ga0395899_0015917 Ga0395899_0015917_1446_2417 310
170 3300037418 Ga0395900_0004045 Ga0395900_0004045_8749_9720 310
171 3300037418 Ga0395900_0015042 Ga0395900_0015042_5391_6362 310
172 3300037466 Ga0395898_0012308 Ga0395898_0012308_5230_6201 310
173 3300037466 Ga0395898_0057536 Ga0395898_0057536_531_1502 310
174 3300037466 Ga0395898_0084049 Ga0395898_0084049_870_1841 310
175 3300037853 Ga0436364_1367845 Ga0436364_1367845_321_1319 310
176 3300038443 Ga0395901_0047625 Ga0395901_0047625_281_1252 310
177 3300044694 Ga0466963_0021477 Ga0466963_0021477_65_1036 310
178 3300048907 Ga0496104_0001419 Ga0496104_0001419_10366_11391 310
179 3300048907 Ga0496104_0001499 Ga0496104_0001499_7526_8524 310
180 3300048908 Ga0496105_0010619 Ga0496105_0010619_3512_4537 310
181 3300048909 Ga0496106_0258433 Ga0496106_0258433_275_1300 310
182 3300048911 Ga0496108_0332790 Ga0496108_0332790_103_1128 310
183 3300048912 Ga0496109_0169885 Ga0496109_0169885_790_1815 310
184 3300048912 Ga0496109_0300207 Ga0496109_0300207_468_1466 310
185 3300048915 Ga0496112_0093346 Ga0496112_0093346_1611_2636 310
186 3300048915 Ga0496112_0173890 Ga0496112_0173890_528_1511 310
187 3300048918 Ga0496115_0019547 Ga0496115_0019547_600_1625 310
188 3300048918 Ga0496115_0044413 Ga0496115_0044413_1558_2556 310
189 3300049571 Ga0501034_0024050 Ga0501034_0024050_143_1099 310
190 3300049571 Ga0501034_0169483 Ga0501034_0169483_735_1676 310
191 3300049587 Ga0501071_0254722 Ga0501071_0254722_82_1038 310
192 3300049589 Ga0501073_0046862 Ga0501073_0046862_120_1064 310
193 3300049744 Ga0501083_0005209 Ga0501083_0005209_3089_4048 310
194 3300054114 Ga0501084_0275691 Ga0501084_0275691_373_1317 310
195 3300005530 Ga0070679_100440514 Ga0070679_1004405141 311
196 3300006852 Ga0075433_10260409 Ga0075433_102604092 311
197 3300006871 Ga0075434_100066798 Ga0075434_1000667984 311
198 3300009094 Ga0111539_10026013 Ga0111539_100260132 311
199 3300013100 Ga0157373_10073082 Ga0157373_100730822 311
200 3300014497 Ga0182008_10083427 Ga0182008_100834273 311
201 3300025912 Ga0207707_10362880 Ga0207707_103628801 311
202 3300027614 Ga0209970_1002027 Ga0209970_10020272 311
203 3300031247 Ga0265340_10017200 Ga0265340_100172003 311
204 3300031249 Ga0265339_10005736 Ga0265339_1000573611 311
205 3300031711 Ga0265314_10042042 Ga0265314_100420424 311
206 3300035091 Ga0373951_0004828 Ga0373951_0004828_1434_2387 311
207 3300035111 Ga0373923_0005873 Ga0373923_0005873_1501_2478 311
208 3300035113 Ga0373936_0002216 Ga0373936_0002216_760_1737 311
209 3300035116 Ga0373945_0011777 Ga0373945_0011777_404_1381 311
210 3300035117 Ga0373953_0001424 Ga0373953_0001424_1690_2667 311
211 3300035118 Ga0373954_0002291 Ga0373954_0002291_2737_3714 311
212 3300035119 Ga0373956_0032255 Ga0373956_0032255_538_1515 311
213 3300035170 Ga0373943_0001584 Ga0373943_0001584_5540_6517 311
214 3300035171 Ga0373946_0002328 Ga0373946_0002328_1466_2443 311
215 3300035172 Ga0373955_0000338 Ga0373955_0000338_5849_6826 311
216 3300035410 Ga0373924_0005579 Ga0373924_0005579_3143_4120 311
217 3300035692 Ga0373935_0185484 Ga0373935_0185484_150_1124 311
218 3300035695 Ga0373927_0022573 Ga0373927_0022573_1235_2212 311
219 3300035724 Ga0373933_0012856 Ga0373933_0012856_148_1125 311
220 3300035725 Ga0373947_0003801 Ga0373947_0003801_6274_7251 311
221 3300036401 Ga0373937_0000005 Ga0373937_0000005_81348_82325 311
222 3300037068 Ga0373925_0000007 Ga0373925_0000007_117868_118845 311
223 3300037068 Ga0373925_0007976 Ga0373925_0007976_1593_2567 311
224 3300039450 Ga0436363_0311730 Ga0436363_0311730_1725_2672 311
225 3300042008 Ga0439450_009727 Ga0439450_009727_630_1577 311
226 3300046454 Ga0495592_0000241 Ga0495592_0000241_43209_44186 311
227 3300046459 Ga0495629_0015097 Ga0495629_0015097_2701_3678 311
228 3300046459 Ga0495629_0167508 Ga0495629_0167508_454_1428 311
229 3300046462 Ga0495651_0000555 Ga0495651_0000555_6147_7124 311
230 3300046463 Ga0495653_0000103 Ga0495653_0000103_7062_8039 311
231 3300046476 Ga0495662_0012843 Ga0495662_0012843_2737_3714 311
232 3300046477 Ga0495664_0000003 Ga0495664_0000003_440716_441693 311
233 3300046511 Ga0495608_0000131 Ga0495608_0000131_24320_25297 311
234 3300046514 Ga0495618_0000019 Ga0495618_0000019_5883_6860 311
235 3300046516 Ga0495628_0000080 Ga0495628_0000080_61630_62607 311
236 3300046517 Ga0495630_0000989 Ga0495630_0000989_15359_16336 311
237 3300046517 Ga0495630_0345875 Ga0495630_0345875_113_1087 311
238 3300046529 Ga0495652_0000006 Ga0495652_0000006_198189_199166 311
239 3300046529 Ga0495652_0280902 Ga0495652_0280902_95_1066 311
240 3300046531 Ga0495665_0083169 Ga0495665_0083169_497_1474 311
241 3300046533 Ga0495640_0000002 Ga0495640_0000002_384930_385907 311
242 3300046536 Ga0495587_0000001 Ga0495587_0000001_457386_458363 311
243 3300046543 Ga0495645_0000009 Ga0495645_0000009_24321_25298 311
244 3300046559 Ga0495667_0000021 Ga0495667_0000021_61863_62840 311
245 3300046663 Ga0495635_0000001 Ga0495635_0000001_443197_444174 311
246 3300046675 Ga0495657_0000088 Ga0495657_0000088_59048_60025 311
247 3300046678 Ga0495599_0000025 Ga0495599_0000025_57664_58641 311
248 3300046679 Ga0495623_0000018 Ga0495623_0000018_13797_14774 311
249 3300046680 Ga0495646_0000003 Ga0495646_0000003_21185_22162 311
250 3300046681 Ga0495647_0065520 Ga0495647_0065520_131_1105 311
251 3300046689 Ga0495613_0052038 Ga0495613_0052038_1284_2258 311
252 3300046809 Ga0495600_0000042 Ga0495600_0000042_24350_25327 311
253 3300047315 Ga0495581_0008078 Ga0495581_0008078_1596_2573 311
254 3300047317 Ga0495604_0000008 Ga0495604_0000008_61671_62648 311
255 3300047319 Ga0495674_0000028 Ga0495674_0000028_61991_62968 311
256 3300047322 Ga0495680_0001113 Ga0495680_0001113_4355_5332 311
257 3300047444 Ga0495675_0000691 Ga0495675_0000691_20020_20997 311
258 3300047471 Ga0495684_0000002 Ga0495684_0000002_61729_62706 311
259 3300047673 Ga0495593_0005631 Ga0495593_0005631_4390_5367 311
260 3300048088 Ga0495602_0000022 Ga0495602_0000022_24334_25311 311
261 3300049569 Ga0501032_0026639 Ga0501032_0026639_1150_2097 311
262 3300049573 Ga0501037_0060180 Ga0501037_0060180_718_1665 311
263 3300049574 Ga0501038_0028450 Ga0501038_0028450_2340_3287 311
264 3300049581 Ga0501047_0010868 Ga0501047_0010868_3468_4415 311
265 3300049582 Ga0501048_0140640 Ga0501048_0140640_731_1678 311
266 3300049589 Ga0501073_0060313 Ga0501073_0060313_1266_2213 311
267 3300049744 Ga0501083_0030262 Ga0501083_0030262_449_1396 311
268 3300049823 Ga0501044_0020418 Ga0501044_0020418_2945_3892 311
269 3300050511 nmdc:mga08y16_215545_c1 nmdc:mga08y16_215545_c1_443_1399 311
270 3300053077 Ga0495601_0000001 Ga0495601_0000001_101229_102206 311
271 3300053078 Ga0495612_0000003 Ga0495612_0000003_240899_241876 311
272 3300053084 Ga0495595_0000093 Ga0495595_0000093_24342_25319 311
273 3300053085 Ga0495619_0000004 Ga0495619_0000004_101260_102237 311
274 3300060353 Ga0501082_0012588 Ga0501082_0012588_3442_4389 311
275 3300025261 Ga0209233_1009263 Ga0209233_10092634 312
276 3300049823 Ga0501044_0082893 Ga0501044_0082893_2231_3211 312
277 3300009551 Ga0105238_10030196 Ga0105238_100301968 313
278 3300053117 Ga0500593_002013 Ga0500593_002013_1056_2024 313
279 3300031665 Ga0316575_10024066 Ga0316575_100240663 315
280 3300032133 Ga0316583_10052014 Ga0316583_100520141 315
281 3300042438 Ga0439459_0018908 Ga0439459_0018908_299_1249 316
282 3300005340 Ga0070689_100006271 Ga0070689_1000062714 317
283 3300005340 Ga0070689_100051132 Ga0070689_1000511323 317
284 3300005343 Ga0070687_100078786 Ga0070687_1000787862 317
285 3300005985 Ga0081539_10001341 Ga0081539_1000134139 317
286 3300006048 Ga0075363_100000174 Ga0075363_10000017412 317
287 3300006051 Ga0075364_10000925 Ga0075364_1000092512 317
288 3300006177 Ga0075362_10006120 Ga0075362_100061205 317
289 3300006195 Ga0075366_10027679 Ga0075366_100276792 317
290 3300014325 Ga0163163_10693602 Ga0163163_106936021 317
291 3300014326 Ga0157380_10394012 Ga0157380_103940121 317
292 3300025901 Ga0207688_10139334 Ga0207688_101393341 317
293 3300025918 Ga0207662_10005397 Ga0207662_100053976 317
294 3300025936 Ga0207670_10093944 Ga0207670_100939442 317
295 3300050490 nmdc:mga03n38_3664_c1 nmdc:mga03n38_3664_c1_2519_3484 317
296 3300050491 nmdc:mga00v17_18034_c1 nmdc:mga00v17_18034_c1_1893_2858 317
297 3300050493 nmdc:mga0k408_87405_c1 nmdc:mga0k408_87405_c1_462_1427 317
298 3300003203 JGI25406J46586_10013258 JGI25406J46586_100132583 318

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02899

Phage_int_SAM_1

Phage integrase, N-terminal SAM-like domain

27

109

0.99

PF00589

Phage_integrase

Phage integrase family

130

322

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nrw-assembly1.cif.gz_A crystal structure of the n-terminal domain of phage integrase/site-specific recombinase (tnp) from haloarcula marismortui, northeast structural genomics consortium target hmr208a 0.8913 4 96
2kd1-assembly1.cif.gz_A solution nmr structure of the integrase-like domain from bacillus cereus ordered locus bc_1272. northeast structural genomics consortium target bcr268f 0.8285 2 99
3nrw-assembly1.cif.gz_A crystal structure of the n-terminal domain of phage integrase/site-specific recombinase (tnp) from haloarcula marismortui, northeast structural genomics consortium target hmr208a 0.7891 4 96
3nkh-assembly1.cif.gz_B crystal structure of integrase from mrsa strain staphylococcus aureus 0.7635 112 315
2kj8-assembly1.cif.gz_A nmr structure of fragment 87-196 from the putative phage integrase ints of e. coli: northeast structural genomics consortium target er652a, psi-2 0.7522 1 107
ID Description Score Start End Superfamily
af_Q2FY74_2_96_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.9636 7 97 1.10.150.130
af_P0A8P6_5_99_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.9397 7 97 1.10.150.130
af_P9WF35_2_96_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.9318 8 99 1.10.150.130
af_Q2FZ30_3_95_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.9218 8 94 1.10.150.130
1a0pA01 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.916 8 99 1.10.150.130
ID Description Score Start End GO Terms
AF-A0A3D5USP4-F1-model_v4 Recombinase XerD 0.9847 5 94 GO:0003677
GO:0015074
AF-A0A3B8PAE6-F1-model_v4 deleted 0.9757 5 97
AF-A0A3C0FMU1-F1-model_v4 Recombinase XerD 0.9341 5 104 GO:0003677
GO:0015074
AF-A0A2H0ENX4-F1-model_v4 Core-binding (CB) domain-containing protein 0.9337 1 99 GO:0003677
GO:0015074
AF-A0A3D5USP4-F1-model_v4 Recombinase XerD 0.9054 5 94 GO:0003677
GO:0015074

Feature Viewer

pLDDT pTM Quality
77.63 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map