F394339
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 298 | 218 | 297 | 315 |
Family's Representative Sequence
| Representative Sequence | 3300031665|Ga0316575_10024066|Ga0316575_100240663 |
| Length | 336 |
| Sequence | MLRRMEPVPTKGKAMARRPNASDDGLIELFLDMLAAERGAGENTLSAYRNDLTDLASHLRAAKSSIARADTDDLRGFIKSLDERGFKPASLARRLSAVRQLYRFLYAEGKRGDDPAAVLEGPKRGRSLPKVLSIAEVDTLLAKARANADDTTPPPAQRLRAVRLLCLLEVVYATGLRVSELVALPASAARRDQKMLVVRGKGGKERLVPLNKAARQTMTEYLSLRSEAGKANEKSKKAPESKWLFPSFGETGHLTRQHFARDLKALGAACGIGGERLSPHVLRHAFASHLLHNGADLRVVQTLLGHADISTTQIYTHVLEDRLKSLVRDLHPLGEG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2891088606 | Methylosinus sp. 3S-1 | Isolate | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 20 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 23 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 25 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 26 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 27 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 28 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 29 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 30 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 31 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 32 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 34 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 35 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 36 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 37 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 39 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 40 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 41 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 42 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 43 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 44 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 45 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 46 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 60 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 61 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 94 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 95 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 96 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 97 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 98 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 99 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 100 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 101 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 102 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 103 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 104 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 105 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 106 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 107 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 108 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 109 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 110 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 111 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 112 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 113 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 114 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 115 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 116 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 117 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 118 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 119 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 120 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 121 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 122 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 123 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 124 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 125 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 126 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 127 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 128 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 129 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 130 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 131 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 132 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 133 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 134 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 135 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 136 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 137 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 138 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 139 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 174 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 175 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 176 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 177 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 178 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 179 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 180 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 181 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 183 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 184 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 185 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 197 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 198 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 199 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 200 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 201 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 202 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 203 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 204 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 205 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 206 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 208 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 214 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 215 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 216 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 217 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.33 |
| Metatranscriptomes | 0.34 |
| Isolates | 0.34 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.05 |
| Nodule | 0 |
| Rhizoplane | 7.05 |
| Rhizosphere | 83.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.68 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10013258 | 3300003203 | Bacteria | 3549 |
| 2 | JGI25153J46596_10020575 | 3300003215 | Bacteria | 2492 |
| 3 | Ga0070658_10014677 | 3300005327 | Bacteria | 6284 |
| 4 | Ga0070658_10106452 | 3300005327 | Bacteria | 2320 |
| 5 | Ga0070676_10030532 | 3300005328 | Bacteria | 3074 |
| 6 | Ga0070690_100003947 | 3300005330 | Bacteria | 8190 |
| 7 | Ga0070670_100137643 | 3300005331 | Bacteria | 2110 |
| 8 | Ga0070680_100008619 | 3300005336 | Bacteria | 7816 |
| 9 | Ga0070689_100006271 | 3300005340 | Bacteria | 8210 |
| 10 | Ga0070689_100051132 | 3300005340 | Bacteria | 3193 |
| 11 | Ga0070689_100386456 | 3300005340 | Bacteria | 1180 |
| 12 | Ga0070687_100034082 | 3300005343 | Bacteria | 2518 |
| 13 | Ga0070687_100078786 | 3300005343 | Bacteria | 1791 |
| 14 | Ga0070675_100281684 | 3300005354 | Bacteria | 1461 |
| 15 | Ga0070675_100292573 | 3300005354 | Bacteria | 1433 |
| 16 | Ga0070674_100002246 | 3300005356 | Bacteria | 10641 |
| 17 | Ga0070674_100045258 | 3300005356 | Bacteria | 3007 |
| 18 | Ga0070688_100007704 | 3300005365 | Bacteria | 5815 |
| 19 | Ga0070659_100052987 | 3300005366 | Bacteria | 3192 |
| 20 | Ga0070667_100034910 | 3300005367 | Bacteria | 4211 |
| 21 | Ga0070714_100085792 | 3300005435 | Bacteria | 2751 |
| 22 | Ga0070678_100008402 | 3300005456 | Bacteria | 6183 |
| 23 | Ga0070678_100028850 | 3300005456 | Bacteria | 3791 |
| 24 | Ga0070681_10039831 | 3300005458 | Bacteria | 4710 |
| 25 | Ga0070681_10162000 | 3300005458 | Bacteria | 2161 |
| 26 | Ga0068867_100008051 | 3300005459 | Bacteria | 7448 |
| 27 | Ga0068867_100023806 | 3300005459 | Bacteria | 4387 |
| 28 | Ga0070685_10072417 | 3300005466 | Bacteria | 2045 |
| 29 | Ga0070679_100063420 | 3300005530 | Bacteria | 3683 |
| 30 | Ga0070679_100084277 | 3300005530 | Bacteria | 3167 |
| 31 | Ga0070679_100092210 | 3300005530 | Bacteria | 3017 |
| 32 | Ga0070679_100440514 | 3300005530 | Bacteria | 1248 |
| 33 | Ga0068853_100384910 | 3300005539 | Bacteria | 1310 |
| 34 | Ga0070672_100032911 | 3300005543 | Bacteria | 3920 |
| 35 | Ga0068855_100011392 | 3300005563 | Bacteria | 10739 |
| 36 | Ga0068855_100449444 | 3300005563 | Bacteria | 1406 |
| 37 | Ga0068854_100019175 | 3300005578 | Bacteria | 4605 |
| 38 | Ga0068852_100155747 | 3300005616 | Bacteria | 2128 |
| 39 | Ga0068852_100215586 | 3300005616 | Bacteria | 1823 |
| 40 | Ga0068864_100099393 | 3300005618 | Bacteria | 2577 |
| 41 | Ga0068860_100126676 | 3300005843 | Bacteria | 2448 |
| 42 | Ga0068862_100188034 | 3300005844 | Bacteria | 1857 |
| 43 | Ga0081540_1000005 | 3300005983 | Bacteria | 227052 |
| 44 | Ga0081539_10001341 | 3300005985 | Bacteria | 42889 |
| 45 | Ga0070717_10228744 | 3300006028 | Bacteria | 1637 |
| 46 | Ga0075365_10024805 | 3300006038 | Bacteria | 3789 |
| 47 | Ga0075368_10004691 | 3300006042 | Bacteria | 4650 |
| 48 | Ga0075363_100000174 | 3300006048 | Bacteria | 16828 |
| 49 | Ga0075364_10000925 | 3300006051 | Bacteria | 15511 |
| 50 | Ga0070712_100057155 | 3300006175 | Bacteria | 2739 |
| 51 | Ga0075362_10006120 | 3300006177 | Bacteria | 4460 |
| 52 | Ga0075367_10063533 | 3300006178 | Bacteria | 2207 |
| 53 | Ga0075369_10036375 | 3300006186 | Bacteria | 2095 |
| 54 | Ga0075366_10027679 | 3300006195 | Bacteria | 3327 |
| 55 | Ga0075431_100571428 | 3300006847 | Bacteria | 1117 |
| 56 | Ga0075433_10105491 | 3300006852 | Bacteria | 2497 |
| 57 | Ga0075433_10260409 | 3300006852 | Bacteria | 1538 |
| 58 | Ga0075434_100066798 | 3300006871 | Bacteria | 3583 |
| 59 | Ga0075434_100124186 | 3300006871 | Bacteria | 2598 |
| 60 | Ga0075435_100077372 | 3300007076 | Bacteria | 2728 |
| 61 | Ga0111539_10019416 | 3300009094 | Bacteria | 8389 |
| 62 | Ga0111539_10026013 | 3300009094 | Bacteria | 7162 |
| 63 | Ga0114129_10316698 | 3300009147 | Bacteria | 2075 |
| 64 | Ga0105248_10015107 | 3300009177 | Bacteria | 8503 |
| 65 | Ga0105248_10391312 | 3300009177 | Bacteria | 1565 |
| 66 | Ga0105238_10030196 | 3300009551 | Bacteria | 5515 |
| 67 | Ga0105238_10133845 | 3300009551 | Bacteria | 2457 |
| 68 | Ga0105249_10367201 | 3300009553 | Bacteria | 1462 |
| 69 | Ga0105246_10244038 | 3300011119 | Bacteria | 1422 |
| 70 | Ga0157373_10073082 | 3300013100 | Bacteria | 2420 |
| 71 | Ga0157370_10148284 | 3300013104 | Bacteria | 2184 |
| 72 | Ga0163162_10168777 | 3300013306 | Bacteria | 2312 |
| 73 | Ga0163162_10304856 | 3300013306 | Bacteria | 1725 |
| 74 | Ga0157372_10076656 | 3300013307 | Bacteria | 3775 |
| 75 | Ga0157372_10237576 | 3300013307 | Bacteria | 2114 |
| 76 | Ga0157375_10638003 | 3300013308 | Bacteria | 1222 |
| 77 | Ga0163163_10192352 | 3300014325 | Bacteria | 2089 |
| 78 | Ga0163163_10693602 | 3300014325 | Bacteria | 1082 |
| 79 | Ga0157380_10394012 | 3300014326 | Bacteria | 1311 |
| 80 | Ga0182008_10083427 | 3300014497 | Bacteria | 1573 |
| 81 | Ga0206356_11841863 | 3300020070 | Bacteria | 1124 |
| 82 | Ga0209233_1009263 | 3300025261 | Bacteria | 3004 |
| 83 | Ga0209758_1000430 | 3300025297 | Bacteria | 71132 |
| 84 | Ga0207697_10017547 | 3300025315 | Bacteria | 2941 |
| 85 | Ga0207682_10003834 | 3300025893 | Bacteria | 6455 |
| 86 | Ga0207688_10026349 | 3300025901 | Bacteria | 3197 |
| 87 | Ga0207688_10139334 | 3300025901 | Bacteria | 1427 |
| 88 | Ga0207645_10037006 | 3300025907 | Bacteria | 3133 |
| 89 | Ga0207705_10062918 | 3300025909 | Bacteria | 2680 |
| 90 | Ga0207707_10132966 | 3300025912 | Bacteria | 2176 |
| 91 | Ga0207707_10181551 | 3300025912 | Bacteria | 1837 |
| 92 | Ga0207707_10362880 | 3300025912 | Bacteria | 1247 |
| 93 | Ga0207693_10048512 | 3300025915 | Bacteria | 3335 |
| 94 | Ga0207660_10047336 | 3300025917 | Bacteria | 3040 |
| 95 | Ga0207662_10005397 | 3300025918 | Bacteria | 6809 |
| 96 | Ga0207652_10049403 | 3300025921 | Bacteria | 3601 |
| 97 | Ga0207652_10075775 | 3300025921 | Bacteria | 2932 |
| 98 | Ga0207650_10089483 | 3300025925 | Bacteria | 2350 |
| 99 | Ga0207650_10451593 | 3300025925 | Bacteria | 1070 |
| 100 | Ga0207664_10149665 | 3300025929 | Bacteria | 1982 |
| 101 | Ga0207644_10239379 | 3300025931 | Bacteria | 1444 |
| 102 | Ga0207670_10004720 | 3300025936 | Bacteria | 7390 |
| 103 | Ga0207670_10093944 | 3300025936 | Bacteria | 2126 |
| 104 | Ga0207669_10001250 | 3300025937 | Bacteria | 10802 |
| 105 | Ga0207669_10048606 | 3300025937 | Bacteria | 2521 |
| 106 | Ga0207704_10250838 | 3300025938 | Bacteria | 1328 |
| 107 | Ga0207665_10059178 | 3300025939 | Bacteria | 2592 |
| 108 | Ga0207691_10004922 | 3300025940 | Bacteria | 12889 |
| 109 | Ga0207691_10156825 | 3300025940 | Bacteria | 1999 |
| 110 | Ga0207711_10005226 | 3300025941 | Bacteria | 10999 |
| 111 | Ga0207661_10240974 | 3300025944 | Bacteria | 1605 |
| 112 | Ga0207667_10024638 | 3300025949 | Bacteria | 6602 |
| 113 | Ga0207658_10133970 | 3300025986 | Bacteria | 1995 |
| 114 | Ga0207648_10002948 | 3300026089 | Bacteria | 18006 |
| 115 | Ga0207648_10033201 | 3300026089 | Bacteria | 4552 |
| 116 | Ga0207676_10011837 | 3300026095 | Bacteria | 6242 |
| 117 | Ga0207674_10364569 | 3300026116 | Bacteria | 1397 |
| 118 | Ga0207675_100292428 | 3300026118 | Bacteria | 1585 |
| 119 | Ga0207698_10137836 | 3300026142 | Bacteria | 2096 |
| 120 | Ga0209970_1002027 | 3300027614 | Bacteria | 3481 |
| 121 | Ga0268265_10226095 | 3300028380 | Bacteria | 1641 |
| 122 | Ga0268264_10084040 | 3300028381 | Bacteria | 2728 |
| 123 | Ga0268264_10356593 | 3300028381 | Bacteria | 1394 |
| 124 | Ga0265330_10019679 | 3300031235 | Bacteria | 3090 |
| 125 | Ga0265332_10025083 | 3300031238 | Bacteria | 2621 |
| 126 | Ga0265328_10000971 | 3300031239 | Bacteria | 13164 |
| 127 | Ga0265325_10031299 | 3300031241 | Bacteria | 2848 |
| 128 | Ga0265325_10044214 | 3300031241 | Bacteria | 2321 |
| 129 | Ga0265340_10017200 | 3300031247 | Bacteria | 3740 |
| 130 | Ga0265340_10036841 | 3300031247 | Bacteria | 2423 |
| 131 | Ga0265339_10005736 | 3300031249 | Bacteria | 8245 |
| 132 | Ga0265339_10005962 | 3300031249 | Bacteria | 8056 |
| 133 | Ga0265331_10014621 | 3300031250 | Bacteria | 4170 |
| 134 | Ga0265331_10045419 | 3300031250 | Bacteria | 2121 |
| 135 | Ga0307513_10102099 | 3300031456 | Bacteria | 2888 |
| 136 | Ga0307513_10138070 | 3300031456 | Bacteria | 2369 |
| 137 | Ga0316575_10024066 | 3300031665 | Bacteria | 2356 |
| 138 | Ga0265314_10042042 | 3300031711 | Bacteria | 3264 |
| 139 | Ga0265314_10061433 | 3300031711 | Bacteria | 2558 |
| 140 | Ga0265314_10165677 | 3300031711 | Bacteria | 1339 |
| 141 | Ga0265342_10000139 | 3300031712 | Bacteria | 81785 |
| 142 | Ga0265342_10004338 | 3300031712 | Bacteria | 11220 |
| 143 | Ga0316583_10052014 | 3300032133 | Bacteria | 1441 |
| 144 | Ga0373938_0009009 | 3300034957 | Bacteria | 1796 |
| 145 | Ga0373928_0041169 | 3300035084 | Bacteria | 1061 |
| 146 | Ga0373951_0004828 | 3300035091 | Bacteria | 3173 |
| 147 | Ga0373923_0005873 | 3300035111 | Bacteria | 4194 |
| 148 | Ga0373936_0002216 | 3300035113 | Bacteria | 7252 |
| 149 | Ga0373936_0039106 | 3300035113 | Bacteria | 1898 |
| 150 | Ga0373939_0020622 | 3300035114 | Bacteria | 1793 |
| 151 | Ga0373939_0092303 | 3300035114 | Bacteria | 1025 |
| 152 | Ga0373945_0011777 | 3300035116 | Bacteria | 2896 |
| 153 | Ga0373953_0001424 | 3300035117 | Bacteria | 6914 |
| 154 | Ga0373954_0002291 | 3300035118 | Bacteria | 7971 |
| 155 | Ga0373954_0085874 | 3300035118 | Bacteria | 1507 |
| 156 | Ga0373956_0032255 | 3300035119 | Bacteria | 2298 |
| 157 | Ga0373943_0001584 | 3300035170 | Bacteria | 10306 |
| 158 | Ga0373943_0167598 | 3300035170 | Bacteria | 1200 |
| 159 | Ga0373946_0002328 | 3300035171 | Bacteria | 6719 |
| 160 | Ga0373955_0000338 | 3300035172 | Bacteria | 19607 |
| 161 | Ga0373924_0005579 | 3300035410 | Bacteria | 4463 |
| 162 | Ga0373931_0007577 | 3300035691 | Bacteria | 5113 |
| 163 | Ga0373931_0015115 | 3300035691 | Bacteria | 3782 |
| 164 | Ga0373935_0040406 | 3300035692 | Bacteria | 2928 |
| 165 | Ga0373935_0185484 | 3300035692 | Bacteria | 1430 |
| 166 | Ga0373927_0022573 | 3300035695 | Bacteria | 4122 |
| 167 | Ga0373927_0277612 | 3300035695 | Bacteria | 1102 |
| 168 | Ga0373933_0012856 | 3300035724 | Bacteria | 4629 |
| 169 | Ga0373947_0003801 | 3300035725 | Bacteria | 8902 |
| 170 | Ga0373947_0035434 | 3300035725 | Bacteria | 2955 |
| 171 | Ga0373937_0000005 | 3300036401 | Bacteria | 199965 |
| 172 | Ga0373937_0555725 | 3300036401 | Bacteria | 1090 |
| 173 | Ga0373925_0000007 | 3300037068 | Bacteria | 257023 |
| 174 | Ga0373925_0007976 | 3300037068 | Bacteria | 7710 |
| 175 | Ga0373925_0128986 | 3300037068 | Bacteria | 1970 |
| 176 | Ga0395899_0015917 | 3300037312 | Bacteria | 5735 |
| 177 | Ga0395900_0004045 | 3300037418 | Bacteria | 15646 |
| 178 | Ga0395900_0015042 | 3300037418 | Bacteria | 7887 |
| 179 | Ga0395898_0012308 | 3300037466 | Bacteria | 8847 |
| 180 | Ga0395898_0057536 | 3300037466 | Bacteria | 3788 |
| 181 | Ga0395898_0084049 | 3300037466 | Bacteria | 3068 |
| 182 | Ga0436364_1367845 | 3300037853 | Bacteria | 1379 |
| 183 | Ga0395901_0047625 | 3300038443 | Bacteria | 4451 |
| 184 | Ga0395901_0252306 | 3300038443 | Bacteria | 1838 |
| 185 | Ga0436365_0301595 | 3300039437 | Bacteria | 4258 |
| 186 | Ga0436361_0613394 | 3300039447 | Bacteria | 2769 |
| 187 | Ga0436363_0311730 | 3300039450 | Bacteria | 3816 |
| 188 | Ga0439450_009727 | 3300042008 | Bacteria | 1836 |
| 189 | Ga0450923_010843 | 3300042125 | Bacteria | 1627 |
| 190 | Ga0439459_0018908 | 3300042438 | Bacteria | 1300 |
| 191 | Ga0466963_0021477 | 3300044694 | Bacteria | 4073 |
| 192 | Ga0466967_0154847 | 3300045976 | Bacteria | 2146 |
| 193 | Ga0495592_0000241 | 3300046454 | Bacteria | 46812 |
| 194 | Ga0495629_0015097 | 3300046459 | Bacteria | 5552 |
| 195 | Ga0495629_0167508 | 3300046459 | Bacteria | 1525 |
| 196 | Ga0495638_0011669 | 3300046460 | Bacteria | 6051 |
| 197 | Ga0495651_0000555 | 3300046462 | Bacteria | 28819 |
| 198 | Ga0495653_0000103 | 3300046463 | Bacteria | 69772 |
| 199 | Ga0495662_0012843 | 3300046476 | Bacteria | 4082 |
| 200 | Ga0495664_0000003 | 3300046477 | Bacteria | 551602 |
| 201 | Ga0495664_0095150 | 3300046477 | Bacteria | 1793 |
| 202 | Ga0495608_0000131 | 3300046511 | Bacteria | 53612 |
| 203 | Ga0495608_0158911 | 3300046511 | Bacteria | 1438 |
| 204 | Ga0495618_0000019 | 3300046514 | Bacteria | 136770 |
| 205 | Ga0495628_0000080 | 3300046516 | Bacteria | 75108 |
| 206 | Ga0495630_0000989 | 3300046517 | Bacteria | 19766 |
| 207 | Ga0495630_0345875 | 3300046517 | Bacteria | 1138 |
| 208 | Ga0495652_0000006 | 3300046529 | Bacteria | 459709 |
| 209 | Ga0495652_0280902 | 3300046529 | Bacteria | 1219 |
| 210 | Ga0495665_0083169 | 3300046531 | Bacteria | 1683 |
| 211 | Ga0495640_0000002 | 3300046533 | Bacteria | 646434 |
| 212 | Ga0495587_0000001 | 3300046536 | Bacteria | 724132 |
| 213 | Ga0495587_0045334 | 3300046536 | Bacteria | 2614 |
| 214 | Ga0495621_0031398 | 3300046539 | Bacteria | 1822 |
| 215 | Ga0495645_0000009 | 3300046543 | Bacteria | 239632 |
| 216 | Ga0495667_0000021 | 3300046559 | Bacteria | 180625 |
| 217 | Ga0495635_0000001 | 3300046663 | Bacteria | 704901 |
| 218 | Ga0495657_0000088 | 3300046675 | Bacteria | 81307 |
| 219 | Ga0495599_0000025 | 3300046678 | Bacteria | 120337 |
| 220 | Ga0495623_0000018 | 3300046679 | Bacteria | 107338 |
| 221 | Ga0495646_0000003 | 3300046680 | Bacteria | 287773 |
| 222 | Ga0495647_0065520 | 3300046681 | Bacteria | 1443 |
| 223 | Ga0495613_0052038 | 3300046689 | Bacteria | 3017 |
| 224 | Ga0495600_0000042 | 3300046809 | Bacteria | 74873 |
| 225 | Ga0495581_0008078 | 3300047315 | Bacteria | 6092 |
| 226 | Ga0495604_0000008 | 3300047317 | Bacteria | 341160 |
| 227 | Ga0495674_0000028 | 3300047319 | Bacteria | 124722 |
| 228 | Ga0495680_0001113 | 3300047322 | Bacteria | 29690 |
| 229 | Ga0495675_0000691 | 3300047444 | Bacteria | 21173 |
| 230 | Ga0495684_0000002 | 3300047471 | Bacteria | 341216 |
| 231 | Ga0495593_0005631 | 3300047673 | Bacteria | 7394 |
| 232 | Ga0495602_0000022 | 3300048088 | Bacteria | 163672 |
| 233 | Ga0496100_0228184 | 3300048903 | Bacteria | 1369 |
| 234 | Ga0496101_0002031 | 3300048904 | Bacteria | 12306 |
| 235 | Ga0496103_0039827 | 3300048906 | Bacteria | 2888 |
| 236 | Ga0496104_0001419 | 3300048907 | Bacteria | 20752 |
| 237 | Ga0496104_0001499 | 3300048907 | Bacteria | 20140 |
| 238 | Ga0496104_0017387 | 3300048907 | Bacteria | 6548 |
| 239 | Ga0496105_0010619 | 3300048908 | Bacteria | 7245 |
| 240 | Ga0496105_0181624 | 3300048908 | Bacteria | 1723 |
| 241 | Ga0496106_0258433 | 3300048909 | Bacteria | 1393 |
| 242 | Ga0496107_0033824 | 3300048910 | Bacteria | 3658 |
| 243 | Ga0496108_0332790 | 3300048911 | Bacteria | 1324 |
| 244 | Ga0496109_0169885 | 3300048912 | Bacteria | 2045 |
| 245 | Ga0496109_0300207 | 3300048912 | Bacteria | 1514 |
| 246 | Ga0496111_0036104 | 3300048914 | Bacteria | 3534 |
| 247 | Ga0496112_0093346 | 3300048915 | Bacteria | 2980 |
| 248 | Ga0496112_0115132 | 3300048915 | Bacteria | 2659 |
| 249 | Ga0496112_0173890 | 3300048915 | Bacteria | 2119 |
| 250 | Ga0496115_0019547 | 3300048918 | Bacteria | 5214 |
| 251 | Ga0496115_0044413 | 3300048918 | Bacteria | 3544 |
| 252 | Ga0496115_0052116 | 3300048918 | Bacteria | 3282 |
| 253 | Ga0496115_0255024 | 3300048918 | Bacteria | 1443 |
| 254 | Ga0501032_0026639 | 3300049569 | Bacteria | 3974 |
| 255 | Ga0501034_0024050 | 3300049571 | Bacteria | 6199 |
| 256 | Ga0501034_0169483 | 3300049571 | Bacteria | 2151 |
| 257 | Ga0501037_0060180 | 3300049573 | Bacteria | 2770 |
| 258 | Ga0501038_0028450 | 3300049574 | Bacteria | 4966 |
| 259 | Ga0501047_0010868 | 3300049581 | Bacteria | 8605 |
| 260 | Ga0501048_0140640 | 3300049582 | Bacteria | 1707 |
| 261 | Ga0501071_0254722 | 3300049587 | Bacteria | 1325 |
| 262 | Ga0501073_0046862 | 3300049589 | Bacteria | 3039 |
| 263 | Ga0501073_0060313 | 3300049589 | Bacteria | 2647 |
| 264 | Ga0501083_0005209 | 3300049744 | Bacteria | 9202 |
| 265 | Ga0501083_0030262 | 3300049744 | Bacteria | 3720 |
| 266 | Ga0501035_0283157 | 3300049822 | Bacteria | 1401 |
| 267 | Ga0501044_0020418 | 3300049823 | Bacteria | 7074 |
| 268 | Ga0501044_0082893 | 3300049823 | Bacteria | 3243 |
| 269 | nmdc:mga03n38_3664_c1 | 3300050490 | Bacteria | 4969 |
| 270 | nmdc:mga00v17_18034_c1 | 3300050491 | Bacteria | 4006 |
| 271 | nmdc:mga00v17_34258_c1 | 3300050491 | Bacteria | 3014 |
| 272 | nmdc:mga0yw44_232278_c1 | 3300050492 | Bacteria | 1224 |
| 273 | nmdc:mga0k408_87405_c1 | 3300050493 | Bacteria | 1831 |
| 274 | nmdc:mga06z11_25963_c1 | 3300050494 | Bacteria | 2783 |
| 275 | nmdc:mga06z11_36026_c1 | 3300050494 | Bacteria | 2439 |
| 276 | nmdc:mga07m45_18447_c1 | 3300050496 | Bacteria | 3766 |
| 277 | nmdc:mga05p37_177567_c1 | 3300050507 | Bacteria | 2593 |
| 278 | nmdc:mga08y16_215545_c1 | 3300050511 | Bacteria | 1988 |
| 279 | nmdc:mga0n895_267351_c1 | 3300050512 | Bacteria | 1735 |
| 280 | nmdc:mga0rr50_312705_c1 | 3300050513 | Bacteria | 1316 |
| 281 | nmdc:mga0a205_52232_c1 | 3300050515 | Bacteria | 3945 |
| 282 | nmdc:mga0sz30_37487_c1 | 3300050516 | Bacteria | 2029 |
| 283 | Ga0495601_0000001 | 3300053077 | Bacteria | 549454 |
| 284 | Ga0495601_0021394 | 3300053077 | Bacteria | 3961 |
| 285 | Ga0495612_0000003 | 3300053078 | Bacteria | 303629 |
| 286 | Ga0495655_0012554 | 3300053083 | Bacteria | 1730 |
| 287 | Ga0495595_0000093 | 3300053084 | Bacteria | 42083 |
| 288 | Ga0495595_0032397 | 3300053084 | Bacteria | 2354 |
| 289 | Ga0495619_0000004 | 3300053085 | Bacteria | 500068 |
| 290 | Ga0500646_0013460 | 3300053090 | Bacteria | 2117 |
| 291 | Ga0500593_002013 | 3300053117 | Bacteria | 7373 |
| 292 | Ga0500577_0106045 | 3300053142 | Bacteria | 1154 |
| 293 | Ga0500616_0087996 | 3300053153 | Bacteria | 1545 |
| 294 | Ga0501084_0124129 | 3300054114 | Bacteria | 2172 |
| 295 | Ga0501084_0275691 | 3300054114 | Bacteria | 1420 |
| 296 | Ga0501082_0012588 | 3300060353 | Bacteria | 7270 |
| 297 | Ga0501082_0238818 | 3300060353 | Bacteria | 1581 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026116 | Ga0207674_10364569 | Ga0207674_103645693 | 253 |
| 2 | 3300039447 | Ga0436361_0613394 | Ga0436361_0613394_156_1112 | 267 |
| 3 | 3300005367 | Ga0070667_100034910 | Ga0070667_1000349104 | 272 |
| 4 | 3300031235 | Ga0265330_10019679 | Ga0265330_100196794 | 273 |
| 5 | 3300031250 | Ga0265331_10014621 | Ga0265331_100146211 | 273 |
| 6 | 3300031250 | Ga0265331_10045419 | Ga0265331_100454192 | 278 |
| 7 | 3300031238 | Ga0265332_10025083 | Ga0265332_100250832 | 280 |
| 8 | 3300031241 | Ga0265325_10044214 | Ga0265325_100442142 | 280 |
| 9 | 3300031247 | Ga0265340_10036841 | Ga0265340_100368412 | 280 |
| 10 | 3300031249 | Ga0265339_10005962 | Ga0265339_100059621 | 280 |
| 11 | 3300031712 | Ga0265342_10000139 | Ga0265342_1000013939 | 280 |
| 12 | 3300035113 | Ga0373936_0039106 | Ga0373936_0039106_13_978 | 282 |
| 13 | 3300009147 | Ga0114129_10316698 | Ga0114129_103166983 | 283 |
| 14 | 3300050507 | nmdc:mga05p37_177567_c1 | nmdc:mga05p37_177567_c1_1551_2489 | 283 |
| 15 | 3300060353 | Ga0501082_0238818 | Ga0501082_0238818_82_1014 | 284 |
| 16 | 3300005578 | Ga0068854_100019175 | Ga0068854_1000191754 | 285 |
| 17 | 3300006175 | Ga0070712_100057155 | Ga0070712_1000571554 | 285 |
| 18 | 3300025915 | Ga0207693_10048512 | Ga0207693_100485122 | 285 |
| 19 | 3300025917 | Ga0207660_10047336 | Ga0207660_100473363 | 285 |
| 20 | 3300005458 | Ga0070681_10162000 | Ga0070681_101620002 | 286 |
| 21 | 3300005530 | Ga0070679_100063420 | Ga0070679_1000634203 | 286 |
| 22 | 3300005539 | Ga0068853_100384910 | Ga0068853_1003849101 | 286 |
| 23 | 3300006871 | Ga0075434_100124186 | Ga0075434_1001241862 | 286 |
| 24 | 3300013307 | Ga0157372_10076656 | Ga0157372_100766565 | 286 |
| 25 | 3300025912 | Ga0207707_10181551 | Ga0207707_101815512 | 286 |
| 26 | 3300025925 | Ga0207650_10451593 | Ga0207650_104515932 | 286 |
| 27 | 3300025939 | Ga0207665_10059178 | Ga0207665_100591782 | 286 |
| 28 | 3300028380 | Ga0268265_10226095 | Ga0268265_102260951 | 286 |
| 29 | 3300050512 | nmdc:mga0n895_267351_c1 | nmdc:mga0n895_267351_c1_522_1472 | 286 |
| 30 | 3300031241 | Ga0265325_10031299 | Ga0265325_100312993 | 288 |
| 31 | 3300009094 | Ga0111539_10019416 | Ga0111539_100194166 | 290 |
| 32 | 3300025921 | Ga0207652_10049403 | Ga0207652_100494034 | 291 |
| 33 | 3300031711 | Ga0265314_10165677 | Ga0265314_101656771 | 291 |
| 34 | 3300050491 | nmdc:mga00v17_34258_c1 | nmdc:mga00v17_34258_c1_1500_2411 | 291 |
| 35 | 3300035695 | Ga0373927_0277612 | Ga0373927_0277612_73_1014 | 293 |
| 36 | 3300035725 | Ga0373947_0035434 | Ga0373947_0035434_1111_2052 | 293 |
| 37 | 3300036401 | Ga0373937_0555725 | Ga0373937_0555725_115_1056 | 293 |
| 38 | 3300037068 | Ga0373925_0128986 | Ga0373925_0128986_168_1109 | 293 |
| 39 | 3300042125 | Ga0450923_010843 | Ga0450923_010843_47_988 | 293 |
| 40 | 3300046477 | Ga0495664_0095150 | Ga0495664_0095150_223_1164 | 293 |
| 41 | 3300046511 | Ga0495608_0158911 | Ga0495608_0158911_103_1044 | 293 |
| 42 | 3300046536 | Ga0495587_0045334 | Ga0495587_0045334_560_1501 | 293 |
| 43 | 3300053077 | Ga0495601_0021394 | Ga0495601_0021394_792_1733 | 293 |
| 44 | 3300053084 | Ga0495595_0032397 | Ga0495595_0032397_734_1675 | 293 |
| 45 | 3300007076 | Ga0075435_100077372 | Ga0075435_1000773724 | 295 |
| 46 | 3300050513 | nmdc:mga0rr50_312705_c1 | nmdc:mga0rr50_312705_c1_137_1096 | 295 |
| 47 | 3300005530 | Ga0070679_100084277 | Ga0070679_1000842774 | 297 |
| 48 | 3300038443 | Ga0395901_0252306 | Ga0395901_0252306_897_1820 | 297 |
| 49 | 3300006028 | Ga0070717_10228744 | Ga0070717_102287443 | 301 |
| 50 | 3300054114 | Ga0501084_0124129 | Ga0501084_0124129_712_1650 | 301 |
| 51 | 3300006847 | Ga0075431_100571428 | Ga0075431_1005714281 | 303 |
| 52 | 3300006852 | Ga0075433_10105491 | Ga0075433_101054912 | 305 |
| 53 | 3300050515 | nmdc:mga0a205_52232_c1 | nmdc:mga0a205_52232_c1_2168_3124 | 305 |
| 54 | 3300003215 | JGI25153J46596_10020575 | JGI25153J46596_100205752 | 306 |
| 55 | 3300005331 | Ga0070670_100137643 | Ga0070670_1001376433 | 306 |
| 56 | 3300005343 | Ga0070687_100034082 | Ga0070687_1000340823 | 306 |
| 57 | 3300011119 | Ga0105246_10244038 | Ga0105246_102440381 | 306 |
| 58 | 3300014325 | Ga0163163_10192352 | Ga0163163_101923522 | 306 |
| 59 | 3300025297 | Ga0209758_1000430 | Ga0209758_100043025 | 306 |
| 60 | 3300025925 | Ga0207650_10089483 | Ga0207650_100894832 | 306 |
| 61 | 3300053153 | Ga0500616_0087996 | Ga0500616_0087996_454_1455 | 306 |
| 62 | 3300005354 | Ga0070675_100292573 | Ga0070675_1002925731 | 307 |
| 63 | 3300005356 | Ga0070674_100002246 | Ga0070674_1000022463 | 307 |
| 64 | 3300005456 | Ga0070678_100008402 | Ga0070678_1000084027 | 307 |
| 65 | 3300005459 | Ga0068867_100008051 | Ga0068867_1000080514 | 307 |
| 66 | 3300005466 | Ga0070685_10072417 | Ga0070685_100724171 | 307 |
| 67 | 3300025315 | Ga0207697_10017547 | Ga0207697_100175472 | 307 |
| 68 | 3300025893 | Ga0207682_10003834 | Ga0207682_100038344 | 307 |
| 69 | 3300025901 | Ga0207688_10026349 | Ga0207688_100263494 | 307 |
| 70 | 3300025937 | Ga0207669_10001250 | Ga0207669_100012509 | 307 |
| 71 | 3300025940 | Ga0207691_10004922 | Ga0207691_100049225 | 307 |
| 72 | 3300025986 | Ga0207658_10133970 | Ga0207658_101339701 | 307 |
| 73 | 3300026089 | Ga0207648_10002948 | Ga0207648_1000294812 | 307 |
| 74 | 3300026118 | Ga0207675_100292428 | Ga0207675_1002924281 | 307 |
| 75 | 3300046539 | Ga0495621_0031398 | Ga0495621_0031398_683_1696 | 307 |
| 76 | 3300005328 | Ga0070676_10030532 | Ga0070676_100305323 | 308 |
| 77 | 3300005330 | Ga0070690_100003947 | Ga0070690_1000039472 | 308 |
| 78 | 3300005340 | Ga0070689_100386456 | Ga0070689_1003864562 | 308 |
| 79 | 3300005354 | Ga0070675_100281684 | Ga0070675_1002816842 | 308 |
| 80 | 3300005356 | Ga0070674_100045258 | Ga0070674_1000452584 | 308 |
| 81 | 3300005365 | Ga0070688_100007704 | Ga0070688_1000077045 | 308 |
| 82 | 3300005456 | Ga0070678_100028850 | Ga0070678_1000288502 | 308 |
| 83 | 3300005459 | Ga0068867_100023806 | Ga0068867_1000238063 | 308 |
| 84 | 3300005543 | Ga0070672_100032911 | Ga0070672_1000329115 | 308 |
| 85 | 3300005618 | Ga0068864_100099393 | Ga0068864_1000993934 | 308 |
| 86 | 3300005843 | Ga0068860_100126676 | Ga0068860_1001266762 | 308 |
| 87 | 3300005844 | Ga0068862_100188034 | Ga0068862_1001880343 | 308 |
| 88 | 3300009177 | Ga0105248_10015107 | Ga0105248_100151076 | 308 |
| 89 | 3300009177 | Ga0105248_10391312 | Ga0105248_103913123 | 308 |
| 90 | 3300009553 | Ga0105249_10367201 | Ga0105249_103672012 | 308 |
| 91 | 3300013306 | Ga0163162_10168777 | Ga0163162_101687772 | 308 |
| 92 | 3300013306 | Ga0163162_10304856 | Ga0163162_103048562 | 308 |
| 93 | 3300013308 | Ga0157375_10638003 | Ga0157375_106380032 | 308 |
| 94 | 3300025907 | Ga0207645_10037006 | Ga0207645_100370062 | 308 |
| 95 | 3300025931 | Ga0207644_10239379 | Ga0207644_102393792 | 308 |
| 96 | 3300025936 | Ga0207670_10004720 | Ga0207670_100047207 | 308 |
| 97 | 3300025937 | Ga0207669_10048606 | Ga0207669_100486064 | 308 |
| 98 | 3300025938 | Ga0207704_10250838 | Ga0207704_102508381 | 308 |
| 99 | 3300025940 | Ga0207691_10156825 | Ga0207691_101568252 | 308 |
| 100 | 3300025941 | Ga0207711_10005226 | Ga0207711_100052269 | 308 |
| 101 | 3300026089 | Ga0207648_10033201 | Ga0207648_100332014 | 308 |
| 102 | 3300026095 | Ga0207676_10011837 | Ga0207676_100118375 | 308 |
| 103 | 3300028381 | Ga0268264_10084040 | Ga0268264_100840402 | 308 |
| 104 | 3300028381 | Ga0268264_10356593 | Ga0268264_103565931 | 308 |
| 105 | 3300034957 | Ga0373938_0009009 | Ga0373938_0009009_752_1693 | 308 |
| 106 | 3300035084 | Ga0373928_0041169 | Ga0373928_0041169_46_987 | 308 |
| 107 | 3300035114 | Ga0373939_0020622 | Ga0373939_0020622_241_1182 | 308 |
| 108 | 3300035114 | Ga0373939_0092303 | Ga0373939_0092303_67_1008 | 308 |
| 109 | 3300035170 | Ga0373943_0167598 | Ga0373943_0167598_28_969 | 308 |
| 110 | 3300035691 | Ga0373931_0007577 | Ga0373931_0007577_3057_3998 | 308 |
| 111 | 3300035691 | Ga0373931_0015115 | Ga0373931_0015115_1016_1957 | 308 |
| 112 | 3300035692 | Ga0373935_0040406 | Ga0373935_0040406_57_998 | 308 |
| 113 | 3300046460 | Ga0495638_0011669 | Ga0495638_0011669_796_1800 | 308 |
| 114 | 3300048904 | Ga0496101_0002031 | Ga0496101_0002031_4618_5559 | 308 |
| 115 | 3300048906 | Ga0496103_0039827 | Ga0496103_0039827_138_1079 | 308 |
| 116 | 3300048907 | Ga0496104_0017387 | Ga0496104_0017387_3706_4647 | 308 |
| 117 | 3300048910 | Ga0496107_0033824 | Ga0496107_0033824_239_1180 | 308 |
| 118 | 3300048914 | Ga0496111_0036104 | Ga0496111_0036104_2346_3287 | 308 |
| 119 | 3300048915 | Ga0496112_0115132 | Ga0496112_0115132_725_1666 | 308 |
| 120 | 3300048918 | Ga0496115_0255024 | Ga0496115_0255024_33_971 | 308 |
| 121 | 3300050492 | nmdc:mga0yw44_232278_c1 | nmdc:mga0yw44_232278_c1_146_1150 | 308 |
| 122 | 3300050494 | nmdc:mga06z11_36026_c1 | nmdc:mga06z11_36026_c1_423_1364 | 308 |
| 123 | 3300050516 | nmdc:mga0sz30_37487_c1 | nmdc:mga0sz30_37487_c1_222_1226 | 308 |
| 124 | 3300053083 | Ga0495655_0012554 | Ga0495655_0012554_725_1672 | 308 |
| 125 | 3300053090 | Ga0500646_0013460 | Ga0500646_0013460_407_1411 | 308 |
| 126 | 3300053142 | Ga0500577_0106045 | Ga0500577_0106045_42_1043 | 308 |
| 127 | iso_pu_bacteria | 2891088606 | 2891089961 | 308 |
| 128 | 3300005327 | Ga0070658_10014677 | Ga0070658_100146772 | 309 |
| 129 | 3300005327 | Ga0070658_10106452 | Ga0070658_101064522 | 309 |
| 130 | 3300005336 | Ga0070680_100008619 | Ga0070680_1000086196 | 309 |
| 131 | 3300005366 | Ga0070659_100052987 | Ga0070659_1000529873 | 309 |
| 132 | 3300005435 | Ga0070714_100085792 | Ga0070714_1000857921 | 309 |
| 133 | 3300005458 | Ga0070681_10039831 | Ga0070681_100398315 | 309 |
| 134 | 3300005530 | Ga0070679_100092210 | Ga0070679_1000922104 | 309 |
| 135 | 3300005563 | Ga0068855_100011392 | Ga0068855_1000113927 | 309 |
| 136 | 3300005563 | Ga0068855_100449444 | Ga0068855_1004494442 | 309 |
| 137 | 3300005616 | Ga0068852_100155747 | Ga0068852_1001557472 | 309 |
| 138 | 3300005616 | Ga0068852_100215586 | Ga0068852_1002155862 | 309 |
| 139 | 3300006038 | Ga0075365_10024805 | Ga0075365_100248052 | 309 |
| 140 | 3300006042 | Ga0075368_10004691 | Ga0075368_100046913 | 309 |
| 141 | 3300006178 | Ga0075367_10063533 | Ga0075367_100635334 | 309 |
| 142 | 3300006186 | Ga0075369_10036375 | Ga0075369_100363753 | 309 |
| 143 | 3300009551 | Ga0105238_10133845 | Ga0105238_101338452 | 309 |
| 144 | 3300013104 | Ga0157370_10148284 | Ga0157370_101482842 | 309 |
| 145 | 3300013307 | Ga0157372_10237576 | Ga0157372_102375762 | 309 |
| 146 | 3300020070 | Ga0206356_11841863 | Ga0206356_118418632 | 309 |
| 147 | 3300025909 | Ga0207705_10062918 | Ga0207705_100629182 | 309 |
| 148 | 3300025912 | Ga0207707_10132966 | Ga0207707_101329662 | 309 |
| 149 | 3300025921 | Ga0207652_10075775 | Ga0207652_100757754 | 309 |
| 150 | 3300025929 | Ga0207664_10149665 | Ga0207664_101496652 | 309 |
| 151 | 3300025944 | Ga0207661_10240974 | Ga0207661_102409743 | 309 |
| 152 | 3300025949 | Ga0207667_10024638 | Ga0207667_100246382 | 309 |
| 153 | 3300026142 | Ga0207698_10137836 | Ga0207698_101378364 | 309 |
| 154 | 3300031711 | Ga0265314_10061433 | Ga0265314_100614333 | 309 |
| 155 | 3300031712 | Ga0265342_10004338 | Ga0265342_1000433810 | 309 |
| 156 | 3300039437 | Ga0436365_0301595 | Ga0436365_0301595_121_1071 | 309 |
| 157 | 3300045976 | Ga0466967_0154847 | Ga0466967_0154847_878_1846 | 309 |
| 158 | 3300048903 | Ga0496100_0228184 | Ga0496100_0228184_239_1189 | 309 |
| 159 | 3300048908 | Ga0496105_0181624 | Ga0496105_0181624_755_1705 | 309 |
| 160 | 3300048918 | Ga0496115_0052116 | Ga0496115_0052116_2182_3132 | 309 |
| 161 | 3300049822 | Ga0501035_0283157 | Ga0501035_0283157_273_1226 | 309 |
| 162 | 3300050494 | nmdc:mga06z11_25963_c1 | nmdc:mga06z11_25963_c1_60_1025 | 309 |
| 163 | 3300050496 | nmdc:mga07m45_18447_c1 | nmdc:mga07m45_18447_c1_2790_3755 | 309 |
| 164 | 3300005983 | Ga0081540_1000005 | Ga0081540_10000054 | 310 |
| 165 | 3300031239 | Ga0265328_10000971 | Ga0265328_1000097117 | 310 |
| 166 | 3300031456 | Ga0307513_10102099 | Ga0307513_101020992 | 310 |
| 167 | 3300031456 | Ga0307513_10138070 | Ga0307513_101380701 | 310 |
| 168 | 3300035118 | Ga0373954_0085874 | Ga0373954_0085874_349_1359 | 310 |
| 169 | 3300037312 | Ga0395899_0015917 | Ga0395899_0015917_1446_2417 | 310 |
| 170 | 3300037418 | Ga0395900_0004045 | Ga0395900_0004045_8749_9720 | 310 |
| 171 | 3300037418 | Ga0395900_0015042 | Ga0395900_0015042_5391_6362 | 310 |
| 172 | 3300037466 | Ga0395898_0012308 | Ga0395898_0012308_5230_6201 | 310 |
| 173 | 3300037466 | Ga0395898_0057536 | Ga0395898_0057536_531_1502 | 310 |
| 174 | 3300037466 | Ga0395898_0084049 | Ga0395898_0084049_870_1841 | 310 |
| 175 | 3300037853 | Ga0436364_1367845 | Ga0436364_1367845_321_1319 | 310 |
| 176 | 3300038443 | Ga0395901_0047625 | Ga0395901_0047625_281_1252 | 310 |
| 177 | 3300044694 | Ga0466963_0021477 | Ga0466963_0021477_65_1036 | 310 |
| 178 | 3300048907 | Ga0496104_0001419 | Ga0496104_0001419_10366_11391 | 310 |
| 179 | 3300048907 | Ga0496104_0001499 | Ga0496104_0001499_7526_8524 | 310 |
| 180 | 3300048908 | Ga0496105_0010619 | Ga0496105_0010619_3512_4537 | 310 |
| 181 | 3300048909 | Ga0496106_0258433 | Ga0496106_0258433_275_1300 | 310 |
| 182 | 3300048911 | Ga0496108_0332790 | Ga0496108_0332790_103_1128 | 310 |
| 183 | 3300048912 | Ga0496109_0169885 | Ga0496109_0169885_790_1815 | 310 |
| 184 | 3300048912 | Ga0496109_0300207 | Ga0496109_0300207_468_1466 | 310 |
| 185 | 3300048915 | Ga0496112_0093346 | Ga0496112_0093346_1611_2636 | 310 |
| 186 | 3300048915 | Ga0496112_0173890 | Ga0496112_0173890_528_1511 | 310 |
| 187 | 3300048918 | Ga0496115_0019547 | Ga0496115_0019547_600_1625 | 310 |
| 188 | 3300048918 | Ga0496115_0044413 | Ga0496115_0044413_1558_2556 | 310 |
| 189 | 3300049571 | Ga0501034_0024050 | Ga0501034_0024050_143_1099 | 310 |
| 190 | 3300049571 | Ga0501034_0169483 | Ga0501034_0169483_735_1676 | 310 |
| 191 | 3300049587 | Ga0501071_0254722 | Ga0501071_0254722_82_1038 | 310 |
| 192 | 3300049589 | Ga0501073_0046862 | Ga0501073_0046862_120_1064 | 310 |
| 193 | 3300049744 | Ga0501083_0005209 | Ga0501083_0005209_3089_4048 | 310 |
| 194 | 3300054114 | Ga0501084_0275691 | Ga0501084_0275691_373_1317 | 310 |
| 195 | 3300005530 | Ga0070679_100440514 | Ga0070679_1004405141 | 311 |
| 196 | 3300006852 | Ga0075433_10260409 | Ga0075433_102604092 | 311 |
| 197 | 3300006871 | Ga0075434_100066798 | Ga0075434_1000667984 | 311 |
| 198 | 3300009094 | Ga0111539_10026013 | Ga0111539_100260132 | 311 |
| 199 | 3300013100 | Ga0157373_10073082 | Ga0157373_100730822 | 311 |
| 200 | 3300014497 | Ga0182008_10083427 | Ga0182008_100834273 | 311 |
| 201 | 3300025912 | Ga0207707_10362880 | Ga0207707_103628801 | 311 |
| 202 | 3300027614 | Ga0209970_1002027 | Ga0209970_10020272 | 311 |
| 203 | 3300031247 | Ga0265340_10017200 | Ga0265340_100172003 | 311 |
| 204 | 3300031249 | Ga0265339_10005736 | Ga0265339_1000573611 | 311 |
| 205 | 3300031711 | Ga0265314_10042042 | Ga0265314_100420424 | 311 |
| 206 | 3300035091 | Ga0373951_0004828 | Ga0373951_0004828_1434_2387 | 311 |
| 207 | 3300035111 | Ga0373923_0005873 | Ga0373923_0005873_1501_2478 | 311 |
| 208 | 3300035113 | Ga0373936_0002216 | Ga0373936_0002216_760_1737 | 311 |
| 209 | 3300035116 | Ga0373945_0011777 | Ga0373945_0011777_404_1381 | 311 |
| 210 | 3300035117 | Ga0373953_0001424 | Ga0373953_0001424_1690_2667 | 311 |
| 211 | 3300035118 | Ga0373954_0002291 | Ga0373954_0002291_2737_3714 | 311 |
| 212 | 3300035119 | Ga0373956_0032255 | Ga0373956_0032255_538_1515 | 311 |
| 213 | 3300035170 | Ga0373943_0001584 | Ga0373943_0001584_5540_6517 | 311 |
| 214 | 3300035171 | Ga0373946_0002328 | Ga0373946_0002328_1466_2443 | 311 |
| 215 | 3300035172 | Ga0373955_0000338 | Ga0373955_0000338_5849_6826 | 311 |
| 216 | 3300035410 | Ga0373924_0005579 | Ga0373924_0005579_3143_4120 | 311 |
| 217 | 3300035692 | Ga0373935_0185484 | Ga0373935_0185484_150_1124 | 311 |
| 218 | 3300035695 | Ga0373927_0022573 | Ga0373927_0022573_1235_2212 | 311 |
| 219 | 3300035724 | Ga0373933_0012856 | Ga0373933_0012856_148_1125 | 311 |
| 220 | 3300035725 | Ga0373947_0003801 | Ga0373947_0003801_6274_7251 | 311 |
| 221 | 3300036401 | Ga0373937_0000005 | Ga0373937_0000005_81348_82325 | 311 |
| 222 | 3300037068 | Ga0373925_0000007 | Ga0373925_0000007_117868_118845 | 311 |
| 223 | 3300037068 | Ga0373925_0007976 | Ga0373925_0007976_1593_2567 | 311 |
| 224 | 3300039450 | Ga0436363_0311730 | Ga0436363_0311730_1725_2672 | 311 |
| 225 | 3300042008 | Ga0439450_009727 | Ga0439450_009727_630_1577 | 311 |
| 226 | 3300046454 | Ga0495592_0000241 | Ga0495592_0000241_43209_44186 | 311 |
| 227 | 3300046459 | Ga0495629_0015097 | Ga0495629_0015097_2701_3678 | 311 |
| 228 | 3300046459 | Ga0495629_0167508 | Ga0495629_0167508_454_1428 | 311 |
| 229 | 3300046462 | Ga0495651_0000555 | Ga0495651_0000555_6147_7124 | 311 |
| 230 | 3300046463 | Ga0495653_0000103 | Ga0495653_0000103_7062_8039 | 311 |
| 231 | 3300046476 | Ga0495662_0012843 | Ga0495662_0012843_2737_3714 | 311 |
| 232 | 3300046477 | Ga0495664_0000003 | Ga0495664_0000003_440716_441693 | 311 |
| 233 | 3300046511 | Ga0495608_0000131 | Ga0495608_0000131_24320_25297 | 311 |
| 234 | 3300046514 | Ga0495618_0000019 | Ga0495618_0000019_5883_6860 | 311 |
| 235 | 3300046516 | Ga0495628_0000080 | Ga0495628_0000080_61630_62607 | 311 |
| 236 | 3300046517 | Ga0495630_0000989 | Ga0495630_0000989_15359_16336 | 311 |
| 237 | 3300046517 | Ga0495630_0345875 | Ga0495630_0345875_113_1087 | 311 |
| 238 | 3300046529 | Ga0495652_0000006 | Ga0495652_0000006_198189_199166 | 311 |
| 239 | 3300046529 | Ga0495652_0280902 | Ga0495652_0280902_95_1066 | 311 |
| 240 | 3300046531 | Ga0495665_0083169 | Ga0495665_0083169_497_1474 | 311 |
| 241 | 3300046533 | Ga0495640_0000002 | Ga0495640_0000002_384930_385907 | 311 |
| 242 | 3300046536 | Ga0495587_0000001 | Ga0495587_0000001_457386_458363 | 311 |
| 243 | 3300046543 | Ga0495645_0000009 | Ga0495645_0000009_24321_25298 | 311 |
| 244 | 3300046559 | Ga0495667_0000021 | Ga0495667_0000021_61863_62840 | 311 |
| 245 | 3300046663 | Ga0495635_0000001 | Ga0495635_0000001_443197_444174 | 311 |
| 246 | 3300046675 | Ga0495657_0000088 | Ga0495657_0000088_59048_60025 | 311 |
| 247 | 3300046678 | Ga0495599_0000025 | Ga0495599_0000025_57664_58641 | 311 |
| 248 | 3300046679 | Ga0495623_0000018 | Ga0495623_0000018_13797_14774 | 311 |
| 249 | 3300046680 | Ga0495646_0000003 | Ga0495646_0000003_21185_22162 | 311 |
| 250 | 3300046681 | Ga0495647_0065520 | Ga0495647_0065520_131_1105 | 311 |
| 251 | 3300046689 | Ga0495613_0052038 | Ga0495613_0052038_1284_2258 | 311 |
| 252 | 3300046809 | Ga0495600_0000042 | Ga0495600_0000042_24350_25327 | 311 |
| 253 | 3300047315 | Ga0495581_0008078 | Ga0495581_0008078_1596_2573 | 311 |
| 254 | 3300047317 | Ga0495604_0000008 | Ga0495604_0000008_61671_62648 | 311 |
| 255 | 3300047319 | Ga0495674_0000028 | Ga0495674_0000028_61991_62968 | 311 |
| 256 | 3300047322 | Ga0495680_0001113 | Ga0495680_0001113_4355_5332 | 311 |
| 257 | 3300047444 | Ga0495675_0000691 | Ga0495675_0000691_20020_20997 | 311 |
| 258 | 3300047471 | Ga0495684_0000002 | Ga0495684_0000002_61729_62706 | 311 |
| 259 | 3300047673 | Ga0495593_0005631 | Ga0495593_0005631_4390_5367 | 311 |
| 260 | 3300048088 | Ga0495602_0000022 | Ga0495602_0000022_24334_25311 | 311 |
| 261 | 3300049569 | Ga0501032_0026639 | Ga0501032_0026639_1150_2097 | 311 |
| 262 | 3300049573 | Ga0501037_0060180 | Ga0501037_0060180_718_1665 | 311 |
| 263 | 3300049574 | Ga0501038_0028450 | Ga0501038_0028450_2340_3287 | 311 |
| 264 | 3300049581 | Ga0501047_0010868 | Ga0501047_0010868_3468_4415 | 311 |
| 265 | 3300049582 | Ga0501048_0140640 | Ga0501048_0140640_731_1678 | 311 |
| 266 | 3300049589 | Ga0501073_0060313 | Ga0501073_0060313_1266_2213 | 311 |
| 267 | 3300049744 | Ga0501083_0030262 | Ga0501083_0030262_449_1396 | 311 |
| 268 | 3300049823 | Ga0501044_0020418 | Ga0501044_0020418_2945_3892 | 311 |
| 269 | 3300050511 | nmdc:mga08y16_215545_c1 | nmdc:mga08y16_215545_c1_443_1399 | 311 |
| 270 | 3300053077 | Ga0495601_0000001 | Ga0495601_0000001_101229_102206 | 311 |
| 271 | 3300053078 | Ga0495612_0000003 | Ga0495612_0000003_240899_241876 | 311 |
| 272 | 3300053084 | Ga0495595_0000093 | Ga0495595_0000093_24342_25319 | 311 |
| 273 | 3300053085 | Ga0495619_0000004 | Ga0495619_0000004_101260_102237 | 311 |
| 274 | 3300060353 | Ga0501082_0012588 | Ga0501082_0012588_3442_4389 | 311 |
| 275 | 3300025261 | Ga0209233_1009263 | Ga0209233_10092634 | 312 |
| 276 | 3300049823 | Ga0501044_0082893 | Ga0501044_0082893_2231_3211 | 312 |
| 277 | 3300009551 | Ga0105238_10030196 | Ga0105238_100301968 | 313 |
| 278 | 3300053117 | Ga0500593_002013 | Ga0500593_002013_1056_2024 | 313 |
| 279 | 3300031665 | Ga0316575_10024066 | Ga0316575_100240663 | 315 |
| 280 | 3300032133 | Ga0316583_10052014 | Ga0316583_100520141 | 315 |
| 281 | 3300042438 | Ga0439459_0018908 | Ga0439459_0018908_299_1249 | 316 |
| 282 | 3300005340 | Ga0070689_100006271 | Ga0070689_1000062714 | 317 |
| 283 | 3300005340 | Ga0070689_100051132 | Ga0070689_1000511323 | 317 |
| 284 | 3300005343 | Ga0070687_100078786 | Ga0070687_1000787862 | 317 |
| 285 | 3300005985 | Ga0081539_10001341 | Ga0081539_1000134139 | 317 |
| 286 | 3300006048 | Ga0075363_100000174 | Ga0075363_10000017412 | 317 |
| 287 | 3300006051 | Ga0075364_10000925 | Ga0075364_1000092512 | 317 |
| 288 | 3300006177 | Ga0075362_10006120 | Ga0075362_100061205 | 317 |
| 289 | 3300006195 | Ga0075366_10027679 | Ga0075366_100276792 | 317 |
| 290 | 3300014325 | Ga0163163_10693602 | Ga0163163_106936021 | 317 |
| 291 | 3300014326 | Ga0157380_10394012 | Ga0157380_103940121 | 317 |
| 292 | 3300025901 | Ga0207688_10139334 | Ga0207688_101393341 | 317 |
| 293 | 3300025918 | Ga0207662_10005397 | Ga0207662_100053976 | 317 |
| 294 | 3300025936 | Ga0207670_10093944 | Ga0207670_100939442 | 317 |
| 295 | 3300050490 | nmdc:mga03n38_3664_c1 | nmdc:mga03n38_3664_c1_2519_3484 | 317 |
| 296 | 3300050491 | nmdc:mga00v17_18034_c1 | nmdc:mga00v17_18034_c1_1893_2858 | 317 |
| 297 | 3300050493 | nmdc:mga0k408_87405_c1 | nmdc:mga0k408_87405_c1_462_1427 | 317 |
| 298 | 3300003203 | JGI25406J46586_10013258 | JGI25406J46586_100132583 | 318 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3nrw-assembly1.cif.gz_A | crystal structure of the n-terminal domain of phage integrase/site-specific recombinase (tnp) from haloarcula marismortui, northeast structural genomics consortium target hmr208a | 0.8913 | 4 | 96 |
| 2kd1-assembly1.cif.gz_A | solution nmr structure of the integrase-like domain from bacillus cereus ordered locus bc_1272. northeast structural genomics consortium target bcr268f | 0.8285 | 2 | 99 |
| 3nrw-assembly1.cif.gz_A | crystal structure of the n-terminal domain of phage integrase/site-specific recombinase (tnp) from haloarcula marismortui, northeast structural genomics consortium target hmr208a | 0.7891 | 4 | 96 |
| 3nkh-assembly1.cif.gz_B | crystal structure of integrase from mrsa strain staphylococcus aureus | 0.7635 | 112 | 315 |
| 2kj8-assembly1.cif.gz_A | nmr structure of fragment 87-196 from the putative phage integrase ints of e. coli: northeast structural genomics consortium target er652a, psi-2 | 0.7522 | 1 | 107 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FY74_2_96_1.10.150.130 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain | 0.9636 | 7 | 97 | 1.10.150.130 |
| af_P0A8P6_5_99_1.10.150.130 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain | 0.9397 | 7 | 97 | 1.10.150.130 |
| af_P9WF35_2_96_1.10.150.130 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain | 0.9318 | 8 | 99 | 1.10.150.130 |
| af_Q2FZ30_3_95_1.10.150.130 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain | 0.9218 | 8 | 94 | 1.10.150.130 |
| 1a0pA01 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain | 0.916 | 8 | 99 | 1.10.150.130 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D5USP4-F1-model_v4 | Recombinase XerD | 0.9847 | 5 | 94 |
GO:0003677
GO:0015074 |
| AF-A0A3B8PAE6-F1-model_v4 | deleted | 0.9757 | 5 | 97 |
|
| AF-A0A3C0FMU1-F1-model_v4 | Recombinase XerD | 0.9341 | 5 | 104 |
GO:0003677
GO:0015074 |
| AF-A0A2H0ENX4-F1-model_v4 | Core-binding (CB) domain-containing protein | 0.9337 | 1 | 99 |
GO:0003677
GO:0015074 |
| AF-A0A3D5USP4-F1-model_v4 | Recombinase XerD | 0.9054 | 5 | 94 |
GO:0003677
GO:0015074 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar