F394307

General Info

Members Datasets Scaffolds Average Seq Length
298 185 293 306

Family's Representative Sequence

Representative Sequence 3300025929|Ga0207664_10292858|Ga0207664_102928582
Length 364
Sequence MVTPSPRYDAHPPAFAQPRLGSFIHVDMARRPSQRGHLALAAHRVGLGRSFEAIGSHGWEAAIVAAILTEGLAKYFGATAALRPLNLQVGEGEVLGYLGPNGAGKTTTIRCLLGMIRASSGRAEIFGVDAQQHPAEAHRRLAYVPGEANLWPGLTGGQALHLLGRIQGRVDEAYRDELIGRFQLDPSKRVRAYSKGNRQKVLLIAALSSRADLLILDEPTTGLDPLMEQTFRECVAQARERGQAVFLSSHILSEVEALSDRVAILRAGELVEVGTLAQMRHLSALSVDATFDGTPPDLSRIPGVTAVEVHGNQVRCQIVGSFEPLLSVLATSGVHQLLSREPSLEELFLAHYGRGMSEAVAHAS

Samples

Sample ID Description Type Environment
1 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
2 2619618881 Frankia sp. ACN1ag Isolate Unclassified
3 2619619003 Frankia sp. CpI1-P Isolate Nodule
4 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
5 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
6 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
50 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
69 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
70 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
71 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
72 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
73 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
74 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
75 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
76 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
77 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
78 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
79 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
80 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
81 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
82 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
83 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
84 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
85 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
86 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
87 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
88 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
89 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
90 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
91 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
92 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
93 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
94 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
95 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
96 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
97 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
98 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
99 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
100 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
101 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
102 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
108 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
109 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
110 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
111 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
112 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
113 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
114 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
115 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
116 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
117 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
118 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
119 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
120 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
121 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
122 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
123 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
124 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
125 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
126 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
127 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
128 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
129 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
130 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
131 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
132 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
133 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
134 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
135 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
136 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
137 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
138 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
139 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
140 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
141 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
142 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
143 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
144 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
145 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
146 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
147 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
148 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
163 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
164 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
165 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
166 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
167 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
168 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
169 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
170 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
171 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
172 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
173 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
174 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
175 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
176 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
177 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
178 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
179 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
180 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
181 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
182 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
183 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
184 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
185 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.32
Metatranscriptomes 0
Isolates 1.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.74
Nodule 0.34
Rhizoplane 9.73
Rhizosphere 74.5
Stem 0
Stem Tuber 0
Unclassified 4.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1003577 3300001915 Bacteria 3671
2 rootH2_10000244 3300003320 Bacteria 697651
3 Ga0070683_100013587 3300005329 Bacteria 7104
4 Ga0070683_100289184 3300005329 Bacteria 1559
5 Ga0070677_10009897 3300005333 Unclassified 3247
6 Ga0070703_10000416 3300005406 Bacteria 17571
7 Ga0070709_10000388 3300005434 Bacteria 27087
8 Ga0070714_100038811 3300005435 Bacteria 4006
9 Ga0070713_100037932 3300005436 Bacteria 3899
10 Ga0070711_100011484 3300005439 Bacteria 5501
11 Ga0070708_100006729 3300005445 Bacteria 9154
12 Ga0070708_100014544 3300005445 Bacteria 6481
13 Ga0070708_100075974 3300005445 Bacteria 3033
14 Ga0070681_10050683 3300005458 Bacteria 4142
15 Ga0070706_100002888 3300005467 Bacteria 17120
16 Ga0070706_100020424 3300005467 Bacteria 6104
17 Ga0070706_100029871 3300005467 Bacteria 5020
18 Ga0070706_100186915 3300005467 Bacteria 1936
19 Ga0070707_100064634 3300005468 Bacteria 3513
20 Ga0070707_100174833 3300005468 Bacteria 2093
21 Ga0070698_100010754 3300005471 Bacteria 9737
22 Ga0070699_100026910 3300005518 Bacteria 4961
23 Ga0070684_100226026 3300005535 Bacteria 1708
24 Ga0070697_100110039 3300005536 Bacteria 2295
25 Ga0070696_100019498 3300005546 Bacteria 4592
26 Ga0068855_100000001 3300005563 Bacteria 818777
27 Ga0068855_100446965 3300005563 Bacteria 1411
28 Ga0068856_100000215 3300005614 Bacteria 62264
29 Ga0068859_100004792 3300005617 Bacteria 13767
30 Ga0068858_100484433 3300005842 Bacteria 1194
31 Ga0070717_10113275 3300006028 Bacteria 2316
32 Ga0070717_10119344 3300006028 Bacteria 2257
33 Ga0075368_10000005 3300006042 Bacteria 55453
34 Ga0075368_10000726 3300006042 Bacteria 10076
35 Ga0075363_100000641 3300006048 Bacteria 11591
36 Ga0075364_10039652 3300006051 Bacteria 3054
37 Ga0070715_10002335 3300006163 Bacteria 5797
38 Ga0070716_100039786 3300006173 Bacteria 2612
39 Ga0070712_100049274 3300006175 Bacteria 2924
40 Ga0070712_100077058 3300006175 Bacteria 2402
41 Ga0075367_10000356 3300006178 Bacteria 16409
42 Ga0075367_10001617 3300006178 Bacteria 9781
43 Ga0075367_10014067 3300006178 Bacteria 4322
44 Ga0075369_10000009 3300006186 Bacteria 79582
45 Ga0075366_10000590 3300006195 Bacteria 16958
46 Ga0075370_10043096 3300006353 Bacteria 2551
47 Ga0068871_100000011 3300006358 Bacteria 105600
48 Ga0075428_100000002 3300006844 Bacteria 546374
49 Ga0097620_100004792 3300006931 Bacteria 13767
50 Ga0105245_10000007 3300009098 Bacteria 312285
51 Ga0105245_10183114 3300009098 Bacteria 2002
52 Ga0105247_10001870 3300009101 Bacteria 14740
53 Ga0105241_10000003 3300009174 Bacteria 839043
54 Ga0105241_10482563 3300009174 Bacteria 1102
55 Ga0105237_10144302 3300009545 Bacteria 2375
56 Ga0157373_10002698 3300013100 Bacteria 13454
57 Ga0157369_10052842 3300013105 Bacteria 4394
58 Ga0157374_10000014 3300013296 Bacteria 396846
59 Ga0213875_10040007 3300021388 Bacteria 2208
60 Ga0207653_10000426 3300025885 Bacteria 17561
61 Ga0207710_10001195 3300025900 Bacteria 13166
62 Ga0207685_10007894 3300025905 Bacteria 2998
63 Ga0207699_10000155 3300025906 Bacteria 42643
64 Ga0207684_10004854 3300025910 Bacteria 12581
65 Ga0207684_10111277 3300025910 Bacteria 2344
66 Ga0207684_10349776 3300025910 Bacteria 1272
67 Ga0207654_10000002 3300025911 Bacteria 1460142
68 Ga0207707_10011180 3300025912 Bacteria 7808
69 Ga0207693_10004697 3300025915 Bacteria 11493
70 Ga0207693_10252854 3300025915 Bacteria 1382
71 Ga0207663_10037327 3300025916 Bacteria 2928
72 Ga0207646_10025013 3300025922 Bacteria 5465
73 Ga0207646_10340473 3300025922 Bacteria 1355
74 Ga0207687_10000008 3300025927 Bacteria 497738
75 Ga0207700_10096643 3300025928 Bacteria 2346
76 Ga0207700_10190898 3300025928 Bacteria 1721
77 Ga0207664_10292858 3300025929 Bacteria 1431
78 Ga0207665_10023958 3300025939 Bacteria 4022
79 Ga0207661_10014724 3300025944 Bacteria 5738
80 Ga0207667_10000003 3300025949 Bacteria 822935
81 Ga0207702_10000569 3300026078 Bacteria 40973
82 Ga0207683_10252829 3300026121 Bacteria 1608
83 Ga0209813_10000001 3300027866 Bacteria 280406
84 Ga0209813_10012994 3300027866 Bacteria 2213
85 Ga0265337_1000384 3300028556 Bacteria 23747
86 Ga0265337_1000731 3300028556 Bacteria 17268
87 Ga0265326_10002969 3300028558 Bacteria 5654
88 Ga0265326_10011049 3300028558 Bacteria 2671
89 Ga0265319_1002343 3300028563 Bacteria 10425
90 Ga0265334_10005457 3300028573 Bacteria 5556
91 Ga0265334_10006458 3300028573 Bacteria 5046
92 Ga0265334_10020716 3300028573 Bacteria 2691
93 Ga0265318_10025777 3300028577 Bacteria 2318
94 Ga0265323_10019415 3300028653 Bacteria 2621
95 Ga0265322_10011069 3300028654 Bacteria 2617
96 Ga0265322_10011818 3300028654 Bacteria 2526
97 Ga0265336_10000047 3300028666 Bacteria 123576
98 Ga0265336_10000571 3300028666 Bacteria 20772
99 Ga0265336_10009654 3300028666 Bacteria 3329
100 Ga0265338_10000039 3300028800 Bacteria 236135
101 Ga0265338_10000400 3300028800 Bacteria 77806
102 Ga0265338_10000482 3300028800 Bacteria 71209
103 Ga0265338_10000595 3300028800 Bacteria 63820
104 Ga0265338_10000727 3300028800 Bacteria 56128
105 Ga0265338_10000938 3300028800 Bacteria 49159
106 Ga0265338_10002437 3300028800 Bacteria 27961
107 Ga0265338_10002780 3300028800 Bacteria 25593
108 Ga0265338_10003468 3300028800 Bacteria 22188
109 Ga0265338_10024315 3300028800 Bacteria 6191
110 Ga0265338_10025242 3300028800 Bacteria 6039
111 Ga0265338_10083879 3300028800 Bacteria 2663
112 Ga0265324_10002135 3300029957 Bacteria 10397
113 Ga0265324_10004771 3300029957 Bacteria 6003
114 Ga0265320_10044794 3300031240 Bacteria 2177
115 Ga0265325_10001157 3300031241 Bacteria 18910
116 Ga0265325_10002048 3300031241 Bacteria 13849
117 Ga0265325_10008740 3300031241 Bacteria 5957
118 Ga0265325_10018502 3300031241 Bacteria 3864
119 Ga0265325_10041739 3300031241 Bacteria 2403
120 Ga0265340_10008639 3300031247 Bacteria 5490
121 Ga0265340_10018698 3300031247 Bacteria 3572
122 Ga0265340_10055627 3300031247 Bacteria 1905
123 Ga0265340_10066366 3300031247 Bacteria 1717
124 Ga0265340_10118449 3300031247 Bacteria 1219
125 Ga0265339_10016014 3300031249 Bacteria 4479
126 Ga0265339_10030153 3300031249 Bacteria 3073
127 Ga0265339_10048284 3300031249 Bacteria 2334
128 Ga0265327_10000017 3300031251 Bacteria 445264
129 Ga0265327_10000106 3300031251 Bacteria 184297
130 Ga0265327_10002783 3300031251 Bacteria 17675
131 Ga0265327_10052490 3300031251 Bacteria 2123
132 Ga0265327_10057832 3300031251 Bacteria 1993
133 Ga0265316_10030366 3300031344 Bacteria 4431
134 Ga0265316_10185353 3300031344 Bacteria 1548
135 Ga0265316_10185390 3300031344 Bacteria 1548
136 Ga0307509_10331567 3300031507 Bacteria 1253
137 Ga0265313_10001010 3300031595 Bacteria 27503
138 Ga0265313_10016438 3300031595 Bacteria 4254
139 Ga0265313_10078665 3300031595 Bacteria 1503
140 Ga0265314_10002147 3300031711 Bacteria 20651
141 Ga0265314_10085485 3300031711 Bacteria 2068
142 Ga0265342_10046232 3300031712 Bacteria 2616
143 Ga0265342_10183969 3300031712 Bacteria 1143
144 Ga0307409_100469111 3300031995 Bacteria 1219
145 Ga0307415_100046282 3300032126 Bacteria 2922
146 Ga0373926_0033254 3300035083 Bacteria 1822
147 Ga0373944_0004118 3300035089 Bacteria 3774
148 Ga0373936_0005882 3300035113 Bacteria 4616
149 Ga0373945_0001580 3300035116 Bacteria 6977
150 Ga0373953_0004125 3300035117 Bacteria 4608
151 Ga0373943_0008925 3300035170 Bacteria 4491
152 Ga0373946_0000569 3300035171 Bacteria 12183
153 Ga0373935_0078203 3300035692 Bacteria 2145
154 Ga0373927_0043977 3300035695 Bacteria 2890
155 Ga0373927_0065517 3300035695 Bacteria 2350
156 Ga0373927_0077521 3300035695 Bacteria 2153
157 Ga0373933_0054304 3300035724 Bacteria 2401
158 Ga0373947_0014624 3300035725 Bacteria 4499
159 Ga0373937_0028529 3300036401 Bacteria 5051
160 Ga0373937_0075813 3300036401 Bacteria 3105
161 Ga0373937_0119361 3300036401 Bacteria 2457
162 Ga0373925_0044900 3300037068 Bacteria 3281
163 Ga0395900_0060924 3300037418 Bacteria 3882
164 Ga0436364_0524765 3300037853 Bacteria 2430
165 Ga0436364_0915257 3300037853 Bacteria 20960
166 Ga0395901_0063127 3300038443 Unclassified 3855
167 Ga0395901_0166943 3300038443 Bacteria 2310
168 Ga0436365_0747521 3300039437 Bacteria 20665
169 Ga0436363_1226233 3300039450 Bacteria 3349
170 Ga0495603_0043580 3300046455 Bacteria 2679
171 Ga0495629_0012777 3300046459 Bacteria 6076
172 Ga0495629_0091549 3300046459 Bacteria 2122
173 Ga0495629_0207862 3300046459 Bacteria 1352
174 Ga0495641_0018009 3300046461 Unclassified 3659
175 Ga0495641_0058293 3300046461 Bacteria 1747
176 Ga0495651_0008048 3300046462 Bacteria 8083
177 Ga0495651_0016738 3300046462 Bacteria 5678
178 Ga0495651_0209978 3300046462 Bacteria 1356
179 Ga0495653_0038241 3300046463 Bacteria 3767
180 Ga0495653_0078245 3300046463 Bacteria 2453
181 Ga0495582_0018167 3300046473 Bacteria 3848
182 Ga0495639_0035654 3300046475 Bacteria 2226
183 Ga0495662_0007203 3300046476 Bacteria 5509
184 Ga0495664_0036855 3300046477 Bacteria 2884
185 Ga0495594_0020226 3300046499 Bacteria 3545
186 Ga0495608_0028245 3300046511 Bacteria 3813
187 Ga0495608_0140341 3300046511 Bacteria 1543
188 Ga0495628_0130616 3300046516 Bacteria 1921
189 Ga0495628_0312715 3300046516 Bacteria 1161
190 Ga0495630_0004764 3300046517 Bacteria 9518
191 Ga0495666_0055336 3300046526 Bacteria 1901
192 Ga0495652_0083116 3300046529 Bacteria 2637
193 Ga0495665_0002624 3300046531 Bacteria 9696
194 Ga0495640_0043298 3300046533 Bacteria 3136
195 Ga0495586_0062573 3300046535 Bacteria 2026
196 Ga0495587_0044439 3300046536 Bacteria 2642
197 Ga0495645_0042943 3300046543 Bacteria 3297
198 Ga0495667_0080009 3300046559 Bacteria 2124
199 Ga0495634_0006380 3300046642 Bacteria 8968
200 Ga0495634_0047104 3300046642 Bacteria 2906
201 Ga0495599_0053104 3300046678 Bacteria 2539
202 Ga0495623_0029911 3300046679 Bacteria 3505
203 Ga0495623_0063089 3300046679 Bacteria 2321
204 Ga0495647_0000212 3300046681 Bacteria 15653
205 Ga0495658_0000264 3300046683 Bacteria 29775
206 Ga0495658_0215145 3300046683 Bacteria 1202
207 Ga0495658_0285967 3300046683 Bacteria 1041
208 Ga0495613_0000809 3300046689 Bacteria 24258
209 Ga0495613_0182072 3300046689 Bacteria 1487
210 Ga0495613_0213062 3300046689 Bacteria 1358
211 Ga0495624_0000732 3300046690 Bacteria 25830
212 Ga0495600_0291704 3300046809 Bacteria 1031
213 Ga0495581_0011391 3300047315 Bacteria 5145
214 Ga0495581_0044652 3300047315 Bacteria 2563
215 Ga0495674_0157536 3300047319 Bacteria 1901
216 Ga0495674_0173039 3300047319 Bacteria 1801
217 Ga0495676_0091842 3300047321 Bacteria 2267
218 Ga0495676_0284540 3300047321 Bacteria 1119
219 Ga0495680_0060241 3300047322 Bacteria 2927
220 Ga0495680_0081971 3300047322 Bacteria 2434
221 Ga0495680_0253556 3300047322 Bacteria 1246
222 Ga0495675_0021438 3300047444 Bacteria 4114
223 Ga0495675_0068152 3300047444 Bacteria 2248
224 Ga0495684_0056746 3300047471 Bacteria 2985
225 Ga0495684_0120360 3300047471 Bacteria 1978
226 Ga0495593_0020547 3300047673 Bacteria 3697
227 Ga0495602_0043617 3300048088 Bacteria 4076
228 Ga0495602_0276043 3300048088 Bacteria 1240
229 Ga0495614_0015889 3300048089 Bacteria 3278
230 Ga0496100_0072598 3300048903 Bacteria 2301
231 Ga0496101_0016860 3300048904 Bacteria 4945
232 Ga0496101_0491992 3300048904 Bacteria 969
233 Ga0496102_0000090 3300048905 Bacteria 127346
234 Ga0496102_0029645 3300048905 Bacteria 4897
235 Ga0496102_0112951 3300048905 Bacteria 2534
236 Ga0496103_0000034 3300048906 Bacteria 189284
237 Ga0496104_0155486 3300048907 Bacteria 2195
238 Ga0496104_0473809 3300048907 Bacteria 1163
239 Ga0496105_0404225 3300048908 Bacteria 1084
240 Ga0496106_0240550 3300048909 Bacteria 1446
241 Ga0496107_0043917 3300048910 Bacteria 3212
242 Ga0496108_0007402 3300048911 Bacteria 8902
243 Ga0496108_0013103 3300048911 Bacteria 6759
244 Ga0496108_0032458 3300048911 Bacteria 4337
245 Ga0496108_0131848 3300048911 Bacteria 2148
246 Ga0496108_0351021 3300048911 Bacteria 1287
247 Ga0496109_0137706 3300048912 Bacteria 2282
248 Ga0496109_0296966 3300048912 Bacteria 1523
249 Ga0496110_0029233 3300048913 Bacteria 4741
250 Ga0496110_0065501 3300048913 Bacteria 3212
251 Ga0496110_0085548 3300048913 Bacteria 2814
252 Ga0496111_0030719 3300048914 Bacteria 3821
253 Ga0496111_0052243 3300048914 Bacteria 2951
254 Ga0496111_0180674 3300048914 Bacteria 1568
255 Ga0496112_0081353 3300048915 Bacteria 3203
256 Ga0496112_0149863 3300048915 Bacteria 2300
257 Ga0496113_0009794 3300048916 Bacteria 6303
258 Ga0496114_0204891 3300048917 Bacteria 1729
259 Ga0496117_0070021 3300048920 Bacteria 2359
260 Ga0496118_0008416 3300048921 Bacteria 10666
261 Ga0496119_0018384 3300048922 Bacteria 5204
262 Ga0496121_0016369 3300048924 Bacteria 7661
263 Ga0496126_0180596 3300048929 Bacteria 1793
264 Ga0501071_0062851 3300049587 Bacteria 2691
265 nmdc:mga03n38_456_c1 3300050490 Bacteria 10253
266 nmdc:mga00v17_33252_c1 3300050491 Bacteria 3054
267 nmdc:mga0yw44_109051_c1 3300050492 Bacteria 1772
268 nmdc:mga0k408_10_c2 3300050493 Bacteria 32712
269 nmdc:mga0k408_126_c1 3300050493 Bacteria 37833
270 nmdc:mga0k408_589_c1 3300050493 Bacteria 20080
271 nmdc:mga06z11_12_c1 3300050494 Bacteria 100611
272 nmdc:mga06z11_1474_c1 3300050494 Bacteria 8758
273 nmdc:mga06z11_173125_c1 3300050494 Bacteria 1241
274 nmdc:mga04h51_1_c1 3300050495 Bacteria 273320
275 nmdc:mga04h51_42322_c1 3300050495 Bacteria 1493
276 nmdc:mga07m45_2211_c1 3300050496 Bacteria 9081
277 nmdc:mga0sz30_1_c1 3300050516 Bacteria 796501
278 Ga0495601_0013186 3300053077 Bacteria 4970
279 Ga0495601_0055998 3300053077 Bacteria 2497
280 Ga0495612_0006828 3300053078 Bacteria 4674
281 Ga0495612_0014873 3300053078 Bacteria 3122
282 Ga0495619_0004302 3300053085 Bacteria 9083
283 Ga0495619_0042746 3300053085 Bacteria 2969
284 Ga0495619_0080692 3300053085 Bacteria 2189
285 Ga0495619_0085776 3300053085 Bacteria 2127
286 Ga0500643_000133 3300053087 Bacteria 75773
287 Ga0500583_0000082 3300053092 Bacteria 54810
288 Ga0500583_0041105 3300053092 Bacteria 2098
289 Ga0500651_0123907 3300053093 Bacteria 1567
290 Ga0500568_0015964 3300053139 Bacteria 3348
291 Ga0500589_000013 3300053147 Bacteria 109118
292 Ga0500611_001362 3300053727 Bacteria 2665
293 Ga0501084_0041380 3300054114 Bacteria 3855

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037853 Ga0436364_0915257 Ga0436364_0915257_10766_11686 288
2 3300039437 Ga0436365_0747521 Ga0436365_0747521_12562_13482 288
3 3300039450 Ga0436363_1226233 Ga0436363_1226233_65_985 288
4 3300005617 Ga0068859_100004792 Ga0068859_10000479216 289
5 3300006931 Ga0097620_100004792 Ga0097620_10000479216 289
6 3300009101 Ga0105247_10001870 Ga0105247_100018702 289
7 3300025900 Ga0207710_10001195 Ga0207710_1000119513 289
8 3300046683 Ga0495658_0285967 Ga0495658_0285967_56_979 289
9 3300048905 Ga0496102_0000090 Ga0496102_0000090_92805_93683 289
10 3300048906 Ga0496103_0000034 Ga0496103_0000034_33695_34573 289
11 3300048920 Ga0496117_0070021 Ga0496117_0070021_1313_2191 289
12 3300048921 Ga0496118_0008416 Ga0496118_0008416_3480_4358 289
13 3300048922 Ga0496119_0018384 Ga0496119_0018384_640_1518 289
14 3300048924 Ga0496121_0016369 Ga0496121_0016369_3312_4190 289
15 3300006844 Ga0075428_100000002 Ga0075428_100000002506 291
16 3300028573 Ga0265334_10020716 Ga0265334_100207161 291
17 3300028654 Ga0265322_10011818 Ga0265322_100118183 291
18 3300028666 Ga0265336_10000047 Ga0265336_1000004798 291
19 3300028800 Ga0265338_10000039 Ga0265338_10000039191 291
20 3300025928 Ga0207700_10190898 Ga0207700_101908982 292
21 3300029957 Ga0265324_10004771 Ga0265324_100047715 292
22 3300046529 Ga0495652_0083116 Ga0495652_0083116_274_1188 292
23 3300048914 Ga0496111_0180674 Ga0496111_0180674_119_1027 292
24 3300005467 Ga0070706_100029871 Ga0070706_1000298712 293
25 3300005546 Ga0070696_100019498 Ga0070696_1000194983 293
26 3300009098 Ga0105245_10183114 Ga0105245_101831142 293
27 3300009174 Ga0105241_10482563 Ga0105241_104825631 293
28 3300028556 Ga0265337_1000384 Ga0265337_100038425 293
29 3300028666 Ga0265336_10000571 Ga0265336_1000057122 293
30 3300028800 Ga0265338_10024315 Ga0265338_100243154 293
31 3300031247 Ga0265340_10118449 Ga0265340_101184491 293
32 3300031251 Ga0265327_10057832 Ga0265327_100578321 293
33 3300035695 Ga0373927_0077521 Ga0373927_0077521_807_1706 293
34 3300035724 Ga0373933_0054304 Ga0373933_0054304_739_1656 293
35 3300036401 Ga0373937_0075813 Ga0373937_0075813_1573_2490 293
36 3300046455 Ga0495603_0043580 Ga0495603_0043580_903_1814 293
37 3300046462 Ga0495651_0008048 Ga0495651_0008048_5841_6758 293
38 3300046462 Ga0495651_0209978 Ga0495651_0209978_429_1319 293
39 3300046463 Ga0495653_0038241 Ga0495653_0038241_2772_3689 293
40 3300046477 Ga0495664_0036855 Ga0495664_0036855_589_1476 293
41 3300046511 Ga0495608_0028245 Ga0495608_0028245_1024_1941 293
42 3300046516 Ga0495628_0130616 Ga0495628_0130616_794_1681 293
43 3300046536 Ga0495587_0044439 Ga0495587_0044439_532_1449 293
44 3300046543 Ga0495645_0042943 Ga0495645_0042943_1115_2002 293
45 3300046679 Ga0495623_0029911 Ga0495623_0029911_2386_3303 293
46 3300047319 Ga0495674_0157536 Ga0495674_0157536_951_1838 293
47 3300047322 Ga0495680_0253556 Ga0495680_0253556_104_1021 293
48 3300047444 Ga0495675_0021438 Ga0495675_0021438_781_1698 293
49 3300047471 Ga0495684_0056746 Ga0495684_0056746_446_1363 293
50 3300048088 Ga0495602_0276043 Ga0495602_0276043_275_1192 293
51 3300048907 Ga0496104_0155486 Ga0496104_0155486_849_1757 293
52 3300048908 Ga0496105_0404225 Ga0496105_0404225_107_997 293
53 3300048911 Ga0496108_0013103 Ga0496108_0013103_4797_5705 293
54 3300048912 Ga0496109_0137706 Ga0496109_0137706_1151_2059 293
55 3300053078 Ga0495612_0014873 Ga0495612_0014873_229_1116 293
56 3300053085 Ga0495619_0085776 Ga0495619_0085776_360_1277 293
57 3300005329 Ga0070683_100289184 Ga0070683_1002891841 294
58 3300005406 Ga0070703_10000416 Ga0070703_1000041615 294
59 3300005445 Ga0070708_100075974 Ga0070708_1000759741 294
60 3300005467 Ga0070706_100002888 Ga0070706_10000288815 294
61 3300005468 Ga0070707_100174833 Ga0070707_1001748332 294
62 3300025910 Ga0207684_10004854 Ga0207684_1000485415 294
63 3300025910 Ga0207684_10349776 Ga0207684_103497762 294
64 3300028558 Ga0265326_10002969 Ga0265326_100029692 294
65 3300028573 Ga0265334_10006458 Ga0265334_100064582 294
66 3300028666 Ga0265336_10009654 Ga0265336_100096544 294
67 3300028800 Ga0265338_10000400 Ga0265338_1000040012 294
68 3300028800 Ga0265338_10000482 Ga0265338_1000048248 294
69 3300031241 Ga0265325_10002048 Ga0265325_100020486 294
70 3300031247 Ga0265340_10066366 Ga0265340_100663662 294
71 3300031249 Ga0265339_10048284 Ga0265339_100482842 294
72 3300031251 Ga0265327_10052490 Ga0265327_100524902 294
73 3300031344 Ga0265316_10185353 Ga0265316_101853532 294
74 3300031507 Ga0307509_10331567 Ga0307509_103315671 294
75 3300031595 Ga0265313_10001010 Ga0265313_1000101019 294
76 3300035695 Ga0373927_0065517 Ga0373927_0065517_673_1584 294
77 3300036401 Ga0373937_0028529 Ga0373937_0028529_3207_4118 294
78 3300037418 Ga0395900_0060924 Ga0395900_0060924_2913_3827 294
79 3300038443 Ga0395901_0063127 Ga0395901_0063127_1999_2913 294
80 3300046459 Ga0495629_0091549 Ga0495629_0091549_831_1736 294
81 3300046461 Ga0495641_0058293 Ga0495641_0058293_704_1609 294
82 3300046462 Ga0495651_0016738 Ga0495651_0016738_2535_3446 294
83 3300046475 Ga0495639_0035654 Ga0495639_0035654_1173_2075 294
84 3300046499 Ga0495594_0020226 Ga0495594_0020226_2377_3288 294
85 3300046535 Ga0495586_0062573 Ga0495586_0062573_397_1317 294
86 3300046559 Ga0495667_0080009 Ga0495667_0080009_1025_1936 294
87 3300046642 Ga0495634_0006380 Ga0495634_0006380_5074_5994 294
88 3300046679 Ga0495623_0063089 Ga0495623_0063089_50_961 294
89 3300046683 Ga0495658_0215145 Ga0495658_0215145_73_993 294
90 3300046689 Ga0495613_0000809 Ga0495613_0000809_5129_6049 294
91 3300046689 Ga0495613_0213062 Ga0495613_0213062_376_1278 294
92 3300046809 Ga0495600_0291704 Ga0495600_0291704_41_952 294
93 3300047315 Ga0495581_0044652 Ga0495581_0044652_386_1288 294
94 3300047321 Ga0495676_0284540 Ga0495676_0284540_34_936 294
95 3300047322 Ga0495680_0060241 Ga0495680_0060241_105_1016 294
96 3300047444 Ga0495675_0068152 Ga0495675_0068152_1182_2093 294
97 3300048088 Ga0495602_0043617 Ga0495602_0043617_1541_2452 294
98 3300048913 Ga0496110_0029233 Ga0496110_0029233_139_1044 294
99 3300048914 Ga0496111_0052243 Ga0496111_0052243_402_1307 294
100 3300049587 Ga0501071_0062851 Ga0501071_0062851_1656_2567 294
101 3300054114 Ga0501084_0041380 Ga0501084_0041380_598_1509 294
102 iso_pu_bacteria 2954711539 2954720242 294
103 3300005435 Ga0070714_100038811 Ga0070714_1000388112 295
104 3300005436 Ga0070713_100037932 Ga0070713_1000379322 295
105 3300005458 Ga0070681_10050683 Ga0070681_100506833 295
106 3300005535 Ga0070684_100226026 Ga0070684_1002260261 295
107 3300005536 Ga0070697_100110039 Ga0070697_1001100392 295
108 3300005563 Ga0068855_100446965 Ga0068855_1004469652 295
109 3300006028 Ga0070717_10113275 Ga0070717_101132752 295
110 3300006028 Ga0070717_10119344 Ga0070717_101193442 295
111 3300006042 Ga0075368_10000726 Ga0075368_1000072610 295
112 3300006175 Ga0070712_100049274 Ga0070712_1000492742 295
113 3300006178 Ga0075367_10000356 Ga0075367_1000035618 295
114 3300013105 Ga0157369_10052842 Ga0157369_100528423 295
115 3300025915 Ga0207693_10252854 Ga0207693_102528542 295
116 3300025928 Ga0207700_10096643 Ga0207700_100966432 295
117 3300026121 Ga0207683_10252829 Ga0207683_102528292 295
118 3300027866 Ga0209813_10012994 Ga0209813_100129941 295
119 3300028800 Ga0265338_10083879 Ga0265338_100838792 295
120 3300031241 Ga0265325_10008740 Ga0265325_100087403 295
121 3300031247 Ga0265340_10055627 Ga0265340_100556272 295
122 3300031595 Ga0265313_10078665 Ga0265313_100786651 295
123 3300031711 Ga0265314_10085485 Ga0265314_100854851 295
124 3300032126 Ga0307415_100046282 Ga0307415_1000462822 295
125 3300035117 Ga0373953_0004125 Ga0373953_0004125_1410_2336 295
126 3300036401 Ga0373937_0119361 Ga0373937_0119361_578_1504 295
127 3300038443 Ga0395901_0166943 Ga0395901_0166943_75_986 295
128 3300046459 Ga0495629_0207862 Ga0495629_0207862_303_1229 295
129 3300047319 Ga0495674_0173039 Ga0495674_0173039_795_1721 295
130 3300048903 Ga0496100_0072598 Ga0496100_0072598_782_1693 295
131 3300048904 Ga0496101_0491992 Ga0496101_0491992_41_949 295
132 3300048911 Ga0496108_0131848 Ga0496108_0131848_1041_1952 295
133 3300048911 Ga0496108_0351021 Ga0496108_0351021_263_1174 295
134 3300048912 Ga0496109_0296966 Ga0496109_0296966_36_947 295
135 3300050494 nmdc:mga06z11_173125_c1 nmdc:mga06z11_173125_c1_175_1089 295
136 3300050495 nmdc:mga04h51_42322_c1 nmdc:mga04h51_42322_c1_290_1204 295
137 3300053077 Ga0495601_0055998 Ga0495601_0055998_1435_2349 295
138 3300053078 Ga0495612_0006828 Ga0495612_0006828_2290_3204 295
139 3300053085 Ga0495619_0004302 Ga0495619_0004302_5737_6663 295
140 3300005434 Ga0070709_10000388 Ga0070709_1000038823 296
141 3300025906 Ga0207699_10000155 Ga0207699_1000015523 296
142 3300025929 Ga0207664_10292858 Ga0207664_102928582 296
143 3300028800 Ga0265338_10000938 Ga0265338_100009384 296
144 3300031251 Ga0265327_10002783 Ga0265327_1000278313 296
145 3300031712 Ga0265342_10183969 Ga0265342_101839692 296
146 3300046511 Ga0495608_0140341 Ga0495608_0140341_493_1419 296
147 3300046516 Ga0495628_0312715 Ga0495628_0312715_168_1070 296
148 3300046678 Ga0495599_0053104 Ga0495599_0053104_678_1604 296
149 3300053077 Ga0495601_0013186 Ga0495601_0013186_1819_2745 296
150 3300005333 Ga0070677_10009897 Ga0070677_100098973 297
151 3300005439 Ga0070711_100011484 Ga0070711_1000114842 297
152 3300005445 Ga0070708_100014544 Ga0070708_1000145446 297
153 3300006163 Ga0070715_10002335 Ga0070715_100023352 297
154 3300006173 Ga0070716_100039786 Ga0070716_1000397862 297
155 3300006175 Ga0070712_100077058 Ga0070712_1000770582 297
156 3300006186 Ga0075369_10000009 Ga0075369_1000000974 297
157 3300025885 Ga0207653_10000426 Ga0207653_1000042615 297
158 3300025915 Ga0207693_10004697 Ga0207693_100046977 297
159 3300025916 Ga0207663_10037327 Ga0207663_100373272 297
160 3300025939 Ga0207665_10023958 Ga0207665_100239582 297
161 3300035083 Ga0373926_0033254 Ga0373926_0033254_748_1677 297
162 3300035089 Ga0373944_0004118 Ga0373944_0004118_865_1794 297
163 3300035113 Ga0373936_0005882 Ga0373936_0005882_3209_4138 297
164 3300035116 Ga0373945_0001580 Ga0373945_0001580_5683_6612 297
165 3300035170 Ga0373943_0008925 Ga0373943_0008925_350_1279 297
166 3300035171 Ga0373946_0000569 Ga0373946_0000569_6706_7635 297
167 3300035692 Ga0373935_0078203 Ga0373935_0078203_737_1666 297
168 3300035695 Ga0373927_0043977 Ga0373927_0043977_100_1029 297
169 3300035725 Ga0373947_0014624 Ga0373947_0014624_3439_4368 297
170 3300037068 Ga0373925_0044900 Ga0373925_0044900_1873_2802 297
171 3300046459 Ga0495629_0012777 Ga0495629_0012777_464_1393 297
172 3300046461 Ga0495641_0018009 Ga0495641_0018009_1542_2483 297
173 3300046463 Ga0495653_0078245 Ga0495653_0078245_1497_2426 297
174 3300046473 Ga0495582_0018167 Ga0495582_0018167_2441_3370 297
175 3300046476 Ga0495662_0007203 Ga0495662_0007203_3303_4232 297
176 3300046517 Ga0495630_0004764 Ga0495630_0004764_7698_8627 297
177 3300046526 Ga0495666_0055336 Ga0495666_0055336_236_1165 297
178 3300046531 Ga0495665_0002624 Ga0495665_0002624_8409_9338 297
179 3300046533 Ga0495640_0043298 Ga0495640_0043298_479_1408 297
180 3300046642 Ga0495634_0047104 Ga0495634_0047104_975_1904 297
181 3300046681 Ga0495647_0000212 Ga0495647_0000212_6972_7901 297
182 3300046683 Ga0495658_0000264 Ga0495658_0000264_1855_2784 297
183 3300046689 Ga0495613_0182072 Ga0495613_0182072_255_1184 297
184 3300046690 Ga0495624_0000732 Ga0495624_0000732_16373_17302 297
185 3300047315 Ga0495581_0011391 Ga0495581_0011391_2691_3620 297
186 3300047321 Ga0495676_0091842 Ga0495676_0091842_274_1203 297
187 3300047322 Ga0495680_0081971 Ga0495680_0081971_1156_2085 297
188 3300047673 Ga0495593_0020547 Ga0495593_0020547_2441_3370 297
189 3300048089 Ga0495614_0015889 Ga0495614_0015889_350_1279 297
190 3300050492 nmdc:mga0yw44_109051_c1 nmdc:mga0yw44_109051_c1_629_1522 297
191 3300050493 nmdc:mga0k408_126_c1 nmdc:mga0k408_126_c1_13995_14888 297
192 3300050516 nmdc:mga0sz30_1_c1 nmdc:mga0sz30_1_c1_90974_91867 297
193 3300053085 Ga0495619_0080692 Ga0495619_0080692_957_1886 297
194 3300053139 Ga0500568_0015964 Ga0500568_0015964_1706_2599 297
195 3300021388 Ga0213875_10040007 Ga0213875_100400071 298
196 3300025905 Ga0207685_10007894 Ga0207685_100078942 298
197 3300025912 Ga0207707_10011180 Ga0207707_100111804 298
198 3300028800 Ga0265338_10025242 Ga0265338_100252424 298
199 3300031241 Ga0265325_10001157 Ga0265325_1000115718 298
200 3300031247 Ga0265340_10008639 Ga0265340_100086392 298
201 3300031249 Ga0265339_10016014 Ga0265339_100160142 298
202 3300031995 Ga0307409_100469111 Ga0307409_1004691112 298
203 3300037853 Ga0436364_0524765 Ga0436364_0524765_109_1035 298
204 3300048904 Ga0496101_0016860 Ga0496101_0016860_1842_2906 298
205 3300048905 Ga0496102_0029645 Ga0496102_0029645_1112_2176 298
206 3300048905 Ga0496102_0112951 Ga0496102_0112951_462_1415 298
207 3300048907 Ga0496104_0473809 Ga0496104_0473809_57_1010 298
208 3300048909 Ga0496106_0240550 Ga0496106_0240550_138_1091 298
209 3300048910 Ga0496107_0043917 Ga0496107_0043917_2062_3126 298
210 3300048911 Ga0496108_0007402 Ga0496108_0007402_741_1694 298
211 3300048911 Ga0496108_0032458 Ga0496108_0032458_1330_2394 298
212 3300048913 Ga0496110_0065501 Ga0496110_0065501_664_1617 298
213 3300048913 Ga0496110_0085548 Ga0496110_0085548_669_1733 298
214 3300048914 Ga0496111_0030719 Ga0496111_0030719_492_1445 298
215 3300048915 Ga0496112_0081353 Ga0496112_0081353_193_1146 298
216 3300048915 Ga0496112_0149863 Ga0496112_0149863_840_1904 298
217 3300048916 Ga0496113_0009794 Ga0496113_0009794_4653_5606 298
218 3300048917 Ga0496114_0204891 Ga0496114_0204891_135_1088 298
219 3300003320 rootH2_10000244 rootH2_10000244742 299
220 3300005445 Ga0070708_100006729 Ga0070708_1000067292 299
221 3300005467 Ga0070706_100020424 Ga0070706_1000204242 299
222 3300005467 Ga0070706_100186915 Ga0070706_1001869152 299
223 3300005468 Ga0070707_100064634 Ga0070707_1000646343 299
224 3300005471 Ga0070698_100010754 Ga0070698_1000107545 299
225 3300005518 Ga0070699_100026910 Ga0070699_1000269104 299
226 3300005842 Ga0068858_100484433 Ga0068858_1004844332 299
227 3300006042 Ga0075368_10000005 Ga0075368_1000000560 299
228 3300006048 Ga0075363_100000641 Ga0075363_1000006412 299
229 3300006178 Ga0075367_10014067 Ga0075367_100140673 299
230 3300006353 Ga0075370_10043096 Ga0075370_100430962 299
231 3300006358 Ga0068871_100000011 Ga0068871_10000001165 299
232 3300009098 Ga0105245_10000007 Ga0105245_1000000782 299
233 3300013296 Ga0157374_10000014 Ga0157374_1000001482 299
234 3300025910 Ga0207684_10111277 Ga0207684_101112772 299
235 3300025922 Ga0207646_10025013 Ga0207646_100250134 299
236 3300025922 Ga0207646_10340473 Ga0207646_103404731 299
237 3300025927 Ga0207687_10000008 Ga0207687_1000000882 299
238 3300027866 Ga0209813_10000001 Ga0209813_1000000197 299
239 3300028556 Ga0265337_1000731 Ga0265337_10007312 299
240 3300028558 Ga0265326_10011049 Ga0265326_100110493 299
241 3300028563 Ga0265319_1002343 Ga0265319_10023439 299
242 3300028573 Ga0265334_10005457 Ga0265334_100054576 299
243 3300028577 Ga0265318_10025777 Ga0265318_100257772 299
244 3300028653 Ga0265323_10019415 Ga0265323_100194152 299
245 3300028654 Ga0265322_10011069 Ga0265322_100110693 299
246 3300028800 Ga0265338_10000595 Ga0265338_1000059571 299
247 3300028800 Ga0265338_10000727 Ga0265338_100007273 299
248 3300028800 Ga0265338_10002780 Ga0265338_1000278027 299
249 3300028800 Ga0265338_10003468 Ga0265338_100034689 299
250 3300029957 Ga0265324_10002135 Ga0265324_100021355 299
251 3300031240 Ga0265320_10044794 Ga0265320_100447942 299
252 3300031241 Ga0265325_10018502 Ga0265325_100185025 299
253 3300031247 Ga0265340_10018698 Ga0265340_100186982 299
254 3300031249 Ga0265339_10030153 Ga0265339_100301532 299
255 3300031251 Ga0265327_10000017 Ga0265327_1000001718 299
256 3300031251 Ga0265327_10000106 Ga0265327_1000010655 299
257 3300031344 Ga0265316_10030366 Ga0265316_100303662 299
258 3300031595 Ga0265313_10016438 Ga0265313_100164384 299
259 3300031711 Ga0265314_10002147 Ga0265314_100021475 299
260 3300031712 Ga0265342_10046232 Ga0265342_100462322 299
261 3300047471 Ga0495684_0120360 Ga0495684_0120360_1022_1948 299
262 3300048929 Ga0496126_0180596 Ga0496126_0180596_521_1444 299
263 3300050490 nmdc:mga03n38_456_c1 nmdc:mga03n38_456_c1_8883_9791 299
264 3300050493 nmdc:mga0k408_10_c2 nmdc:mga0k408_10_c2_24823_25728 299
265 3300050494 nmdc:mga06z11_12_c1 nmdc:mga06z11_12_c1_94616_95524 299
266 3300050495 nmdc:mga04h51_1_c1 nmdc:mga04h51_1_c1_88376_89284 299
267 3300050496 nmdc:mga07m45_2211_c1 nmdc:mga07m45_2211_c1_4761_5669 299
268 3300053087 Ga0500643_000133 Ga0500643_000133_18976_19881 299
269 3300053092 Ga0500583_0000082 Ga0500583_0000082_12204_13106 299
270 3300053092 Ga0500583_0041105 Ga0500583_0041105_1026_1931 299
271 3300053093 Ga0500651_0123907 Ga0500651_0123907_379_1281 299
272 3300053147 Ga0500589_000013 Ga0500589_000013_56557_57459 299
273 3300053727 Ga0500611_001362 Ga0500611_001362_343_1248 299
274 3300005563 Ga0068855_100000001 Ga0068855_100000001280 300
275 3300009174 Ga0105241_10000003 Ga0105241_10000003588 300
276 3300009545 Ga0105237_10144302 Ga0105237_101443022 300
277 3300025911 Ga0207654_10000002 Ga0207654_10000002619 300
278 3300025949 Ga0207667_10000003 Ga0207667_10000003273 300
279 3300028800 Ga0265338_10002437 Ga0265338_1000243714 300
280 iso_pu_bacteria 2684623035 2686536253 300
281 3300031241 Ga0265325_10041739 Ga0265325_100417391 301
282 3300031344 Ga0265316_10185390 Ga0265316_101853902 301
283 iso_pu_bacteria 2579778521 2579854725 301
284 iso_pu_bacteria 2619618881 2619857579 301
285 iso_pu_bacteria 2619619003 2620350771 301
286 3300053085 Ga0495619_0042746 Ga0495619_0042746_1596_2558 302
287 3300001915 JGI24741J21665_1003577 JGI24741J21665_10035772 304
288 3300005329 Ga0070683_100013587 Ga0070683_1000135874 304
289 3300005614 Ga0068856_100000215 Ga0068856_1000002153 304
290 3300006051 Ga0075364_10039652 Ga0075364_100396522 304
291 3300006178 Ga0075367_10001617 Ga0075367_100016178 304
292 3300006195 Ga0075366_10000590 Ga0075366_100005903 304
293 3300013100 Ga0157373_10002698 Ga0157373_100026983 304
294 3300025944 Ga0207661_10014724 Ga0207661_100147243 304
295 3300026078 Ga0207702_10000569 Ga0207702_1000056938 304
296 3300050491 nmdc:mga00v17_33252_c1 nmdc:mga00v17_33252_c1_503_1432 304
297 3300050493 nmdc:mga0k408_589_c1 nmdc:mga0k408_589_c1_14445_15374 304
298 3300050494 nmdc:mga06z11_1474_c1 nmdc:mga06z11_1474_c1_3475_4404 304

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

161

256

0.9

PF00005

ABC_tran

ABC transporter

82

221

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rvc-assembly1.cif.gz_A structure of atp binding subunit of abc transporter 0.9196 3 220
8eop-assembly1.cif.gz_A cryo-em structure of nanodisc reconstituted human abca7 eq mutant in atp bound closed state 0.9184 2 218
4p33-assembly1.cif.gz_A crystal structure of e. coli lptb-e163q in complex with atp-sodium 0.916 4 217
6xgz-assembly3.cif.gz_E crystal structure of e. coli mlafb abc transport subunits in the monomeric state 0.9124 1 219
6xgz-assembly4.cif.gz_G crystal structure of e. coli mlafb abc transport subunits in the monomeric state 0.912 1 219
ID Description Score Start End Superfamily
af_O86311_2_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9815 2 221 3.40.50.300
af_O53149_2_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9544 3 220 3.40.50.300
af_Q9TXV8_581_832_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9433 3 220 3.40.50.300
af_Q9XW49_440_685_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9398 3 220 3.40.50.300
af_P9WQL7_7_248_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9385 2 218 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2N3Q1I1-F1-model_v4 ABC transporter ATP-binding protein 0.9441 2 217 GO:0005524
GO:0016887
AF-A0A7X0FRN7-F1-model_v4 ABC-2 type transport system ATP-binding protein 0.9426 2 218 GO:0005524
GO:0016887
GO:0046677
AF-A0A2U3CB58-F1-model_v4 ABC transporter domain-containing protein 0.9414 2 218 GO:0005524
GO:0016887
AF-A0A2M9YKK2-F1-model_v4 ABC transporter ATP-binding protein 0.9366 5 217 GO:0005524
GO:0016887
AF-A0A496MVR8-F1-model_v4 ATP-binding cassette domain-containing protein 0.9314 3 217 GO:0005524
GO:0012505
GO:0016887
GO:0046677

Feature Viewer

pLDDT pTM Quality
89.01 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map