F394206

General Info

Members Datasets Scaffolds Average Seq Length
298 217 596 334

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100004495|Ga0075430_1000044956
Length 370
Sequence MTSEIVAPVKTPAAAVNESIDRFRPFSPARCAVVVGCNPVRTVSGSLYGLAYGDALGKSTEFMLMPDIIAAYGPSGPVSLEGDPALVTDDTQMALAVAWALCEAPSLTPADVGPRLRERFLAWANSPDNNRAPGRTCMRACSLLADGRRWQEASVMSSKGCGANMRVTPVGLLPGIDVDTLAGLAQLQAGLTHGHPTGLAAAELTAYAVWALLDGATLAELPAGLRARAYDQRTVYRGDWLGDLWKYFTYDPSAEEYIARGWDECVSVLDRLETALLRPDRTADPCLYTGAGFVAEEALATALLCAIMFADEPVAGLGRAAATSGDSDSIACLAGAFLGAAHGESAWPEEWATQIEYADQLRALSQALTG

Samples

Sample ID Description Type Environment
1 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
9 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
12 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
13 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
14 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
15 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
17 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
18 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
20 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
21 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
22 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
23 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
32 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
33 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
34 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
35 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
36 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
37 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
38 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
39 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
40 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
41 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
42 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
43 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
44 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
45 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
46 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
47 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
48 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
49 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
50 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
51 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
52 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
53 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
54 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
55 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
56 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
57 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
58 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
59 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
60 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
61 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
62 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
63 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
64 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
65 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
66 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
67 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
68 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
69 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
70 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
71 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
72 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
73 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
74 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
75 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
76 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
77 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
78 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
79 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
80 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
81 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
82 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
83 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
84 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
85 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
86 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
87 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
88 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
89 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
90 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
91 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
92 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
93 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
94 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
95 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
96 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
97 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
98 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
99 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
100 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
101 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
102 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
103 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
104 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
105 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
106 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
107 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
108 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
109 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
110 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
111 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
112 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
113 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
114 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
115 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
116 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
117 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
118 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
119 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
120 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
121 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
122 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
123 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
124 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
125 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
126 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
127 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
128 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
129 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
130 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
131 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
132 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
133 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
134 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
137 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
138 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
139 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
141 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
142 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
143 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
144 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
145 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
146 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
147 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
148 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
149 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
150 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
151 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
152 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
153 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
154 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
155 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
156 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
157 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
158 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
159 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
160 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
161 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
162 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
163 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
164 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
165 2558860280 Kutzneria sp. 744 Isolate Unclassified
166 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
167 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
168 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
169 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
170 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
171 2643221647 Streptomyces sp. Root369 Isolate Unclassified
172 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
173 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
174 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
175 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
176 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
177 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
178 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
179 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
180 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
181 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
182 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
183 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
184 2867428634 Streptomyces sp. RP5T Isolate Unclassified
185 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
186 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
187 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
188 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
189 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
190 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
191 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
192 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
193 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
194 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
195 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
196 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
197 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
198 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
199 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
200 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
201 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
202 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
203 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
204 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
205 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
206 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
207 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
208 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
209 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
210 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
211 8002775197 Frankia nepalensis CN7 Isolate Nodule
212 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
213 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
214 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
215 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
216 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
217 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.87
Metatranscriptomes 0.67
Isolates 19.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.36
Nodule 1.01
Rhizoplane 0.67
Rhizosphere 75.17
Stem 0
Stem Tuber 0
Unclassified 0.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075430_100004495 3300006846 Bacteria 11751
2 rootH1_10064095 3300003316 Bacteria 2865
3 rootH1_10024233 3300003323 Bacteria 3812
4 Ga0006562J51391_1052816 3300003578 Bacteria 4130
5 Ga0006562J51391_1069085 3300003578 Bacteria 2230
6 Ga0070658_10005779 3300005327 Bacteria 10032
7 Ga0070668_100000934 3300005347 Bacteria 20357
8 Ga0070713_100083747 3300005436 Bacteria 2727
9 Ga0070713_100376848 3300005436 Bacteria 1321
10 Ga0070684_100100368 3300005535 Bacteria 2584
11 Ga0068853_100006182 3300005539 Bacteria 9481
12 Ga0070665_100502089 3300005548 Bacteria 1224
13 Ga0070664_100009735 3300005564 Bacteria 7791
14 Ga0068857_100062280 3300005577 Bacteria 3316
15 Ga0068857_100119219 3300005577 Bacteria 2375
16 Ga0068851_10044595 3300005834 Bacteria 2239
17 Ga0068862_100089502 3300005844 Unclassified 2679
18 Ga0081539_10001780 3300005985 Bacteria 34234
19 Ga0075428_100149629 3300006844 Bacteria 2536
20 Ga0075428_100449245 3300006844 Bacteria 1381
21 Ga0075431_100027529 3300006847 Bacteria 5834
22 Ga0114129_10024978 3300009147 Bacteria 8471
23 Ga0105239_10187691 3300010375 Bacteria 2314
24 Ga0182008_10000679 3300014497 Bacteria 24589
25 Ga0182007_10000941 3300015262 Bacteria 16048
26 Ga0183367_1010 3300015688 Bacteria 416164
27 Ga0207713_1035486 3300025735 Bacteria 2152
28 Ga0207705_10018473 3300025909 Bacteria 4986
29 Ga0207657_10075856 3300025919 Bacteria 2837
30 Ga0207679_10055288 3300025945 Bacteria 2925
31 Ga0207679_10094931 3300025945 Bacteria 2317
32 Ga0207668_10088749 3300025972 Bacteria 2265
33 Ga0207639_10131997 3300026041 Bacteria 2069
34 Ga0207678_10214701 3300026067 Bacteria 1646
35 Ga0207674_10134733 3300026116 Bacteria 2432
36 Ga0307515_10000095 3300028794 Bacteria 208513
37 Ga0307515_10000544 3300028794 Bacteria 88859
38 Ga0307515_10034544 3300028794 Bacteria 8270
39 Ga0307515_10043347 3300028794 Bacteria 6997
40 Ga0307515_10075160 3300028794 Bacteria 4506
41 Ga0307515_10184470 3300028794 Bacteria 2022
42 Ga0307511_10000584 3300030521 Bacteria 39032
43 Ga0307512_10001375 3300030522 Bacteria 34556
44 Ga0307512_10010604 3300030522 Bacteria 8776
45 Ga0307513_10064816 3300031456 Bacteria 3847
46 Ga0307509_10029413 3300031507 Bacteria 6098
47 Ga0307509_10040125 3300031507 Bacteria 5093
48 Ga0307509_10068109 3300031507 Bacteria 3725
49 Ga0307509_10078089 3300031507 Bacteria 3432
50 Ga0307408_100123958 3300031548 Bacteria 2006
51 Ga0307508_10014111 3300031616 Bacteria 7289
52 Ga0307508_10019746 3300031616 Bacteria 6122
53 Ga0307514_10004054 3300031649 Bacteria 13621
54 Ga0307516_10006645 3300031730 Bacteria 13520
55 Ga0307516_10009612 3300031730 Bacteria 10765
56 Ga0307516_10012737 3300031730 Bacteria 9039
57 Ga0307516_10021111 3300031730 Bacteria 6713
58 Ga0307516_10049352 3300031730 Bacteria 4136
59 Ga0307405_10081211 3300031731 Bacteria 2119
60 Ga0307413_10021606 3300031824 Bacteria 3450
61 Ga0307413_10254980 3300031824 Bacteria 1304
62 Ga0307413_10266098 3300031824 Bacteria 1281
63 Ga0307518_10096060 3300031838 Bacteria 2126
64 Ga0307410_10034032 3300031852 Bacteria 3296
65 Ga0307407_10005770 3300031903 Bacteria 5414
66 Ga0307409_100002449 3300031995 Bacteria 9708
67 Ga0307416_100000203 3300032002 Bacteria 31237
68 Ga0307416_100238516 3300032002 Bacteria 1760
69 Ga0307416_100247187 3300032002 Bacteria 1733
70 Ga0307416_100294835 3300032002 Bacteria 1608
71 Ga0307415_100000044 3300032126 Bacteria 53074
72 Ga0307415_100002114 3300032126 Bacteria 9829
73 Ga0307415_100022548 3300032126 Bacteria 3888
74 Ga0307415_100445696 3300032126 Bacteria 1118
75 Ga0307507_10088478 3300033179 Bacteria 2671
76 Ga0307507_10230694 3300033179 Bacteria 1228
77 Ga0307510_10059356 3300033180 Bacteria 3951
78 Ga0307510_10094668 3300033180 Bacteria 2810
79 Ga0307510_10113376 3300033180 Bacteria 2445
80 Ga0373940_0003530 3300035088 Bacteria 3201
81 Ga0373951_0000009 3300035091 Bacteria 77764
82 Ga0373942_0000126 3300035207 Bacteria 17865
83 Ga0395900_0027851 3300037418 Bacteria 5789
84 Ga0395900_0126141 3300037418 Bacteria 2625
85 Ga0395898_0003967 3300037466 Bacteria 16294
86 Ga0395898_0091878 3300037466 Bacteria 2919
87 Ga0439436_0002104 3300041404 Bacteria 5944
88 Ga0439439_0003410 3300041406 Bacteria 3505
89 Ga0439439_0003721 3300041406 Bacteria 3385
90 Ga0451853_0145401 3300041512 Bacteria 2986
91 Ga0451853_0533830 3300041512 Bacteria 4048
92 Ga0439442_014279 3300042002 Bacteria 1634
93 Ga0439449_0007965 3300042007 Bacteria 4025
94 Ga0439457_000036 3300042014 Bacteria 28398
95 Ga0439457_000145 3300042014 Bacteria 18209
96 Ga0439457_024106 3300042014 Bacteria 1346
97 Ga0439462_0002992 3300042015 Bacteria 4011
98 Ga0450894_000736 3300042131 Bacteria 5395
99 Ga0450898_003074 3300042134 Bacteria 2369
100 Ga0450903_000049 3300042138 Bacteria 23582
101 Ga0450908_007298 3300042184 Bacteria 2085
102 Ga0466969_0001153 3300044656 Bacteria 14228
103 Ga0466969_0043096 3300044656 Bacteria 2249
104 Ga0466972_0001790 3300044658 Bacteria 10523
105 Ga0466972_0002902 3300044658 Bacteria 8490
106 Ga0466965_0040335 3300044683 Bacteria 2298
107 Ga0466966_0002049 3300044684 Bacteria 13087
108 Ga0466961_0001282 3300044693 Bacteria 15475
109 Ga0466961_0003749 3300044693 Bacteria 9501
110 Ga0466961_0030515 3300044693 Bacteria 3465
111 Ga0466961_0032629 3300044693 Bacteria 3347
112 Ga0466963_0274139 3300044694 Bacteria 1185
113 Ga0466971_0000390 3300044719 Bacteria 16952
114 Ga0466971_0008235 3300044719 Bacteria 4549
115 Ga0466971_0071875 3300044719 Bacteria 1571
116 Ga0466970_0029689 3300044765 Bacteria 2880
117 Ga0466970_0036535 3300044765 Bacteria 2603
118 Ga0466957_0175284 3300044842 Bacteria 1398
119 Ga0466959_0035951 3300045049 Bacteria 3660
120 Ga0466958_0025766 3300045836 Bacteria 3470
121 Ga0466967_0006359 3300045976 Bacteria 8344
122 Ga0495592_0036605 3300046454 Bacteria 3695
123 Ga0495592_0050658 3300046454 Bacteria 3085
124 Ga0495592_0114192 3300046454 Bacteria 1908
125 Ga0495603_0002198 3300046455 Bacteria 11484
126 Ga0495603_0058884 3300046455 Bacteria 2270
127 Ga0495629_0010156 3300046459 Bacteria 6863
128 Ga0495629_0067594 3300046459 Bacteria 2494
129 Ga0495629_0076766 3300046459 Bacteria 2332
130 Ga0495629_0126396 3300046459 Bacteria 1781
131 Ga0495651_0018017 3300046462 Bacteria 5468
132 Ga0495605_0007596 3300046474 Bacteria 6147
133 Ga0495639_0097690 3300046475 Bacteria 1384
134 Ga0495662_0005040 3300046476 Bacteria 6620
135 Ga0495662_0049270 3300046476 Bacteria 2033
136 Ga0495594_0014807 3300046499 Bacteria 4092
137 Ga0495594_0110602 3300046499 Bacteria 1549
138 Ga0495607_0047361 3300046501 Bacteria 2519
139 Ga0495606_0006425 3300046507 Bacteria 10844
140 Ga0495616_0009613 3300046513 Bacteria 5641
141 Ga0495618_0040614 3300046514 Bacteria 2929
142 Ga0495618_0086662 3300046514 Bacteria 2002
143 Ga0495630_0097280 3300046517 Bacteria 2226
144 Ga0495637_0020729 3300046520 Bacteria 3018
145 Ga0495643_0099066 3300046522 Bacteria 1496
146 Ga0495666_0008711 3300046526 Bacteria 5081
147 Ga0495666_0082811 3300046526 Bacteria 1517
148 Ga0495652_0001620 3300046529 Bacteria 24570
149 Ga0495652_0050913 3300046529 Bacteria 3539
150 Ga0495640_0113168 3300046533 Bacteria 1771
151 Ga0495586_0086710 3300046535 Bacteria 1726
152 Ga0495587_0006754 3300046536 Bacteria 7471
153 Ga0495597_0020674 3300046542 Bacteria 3063
154 Ga0495622_0019418 3300046557 Bacteria 3164
155 Ga0495622_0038948 3300046557 Bacteria 2213
156 Ga0495667_0028534 3300046559 Bacteria 3758
157 Ga0495668_0012167 3300046616 Bacteria 5114
158 Ga0495634_0001367 3300046642 Bacteria 22125
159 Ga0495625_0006079 3300046660 Bacteria 10831
160 Ga0495625_0021785 3300046660 Bacteria 4923
161 Ga0495635_0007997 3300046663 Bacteria 7389
162 Ga0495635_0020280 3300046663 Bacteria 4631
163 Ga0495635_0090660 3300046663 Bacteria 2091
164 Ga0495661_0016492 3300046665 Bacteria 4895
165 Ga0495588_0000421 3300046674 Bacteria 22718
166 Ga0495588_0014155 3300046674 Bacteria 3814
167 Ga0495588_0173005 3300046674 Bacteria 1142
168 Ga0495657_0008917 3300046675 Bacteria 7637
169 Ga0495657_0012100 3300046675 Bacteria 6420
170 Ga0495657_0039823 3300046675 Bacteria 3227
171 Ga0495623_0055244 3300046679 Bacteria 2504
172 Ga0495646_0017435 3300046680 Bacteria 4555
173 Ga0495646_0057200 3300046680 Bacteria 2335
174 Ga0495613_0004703 3300046689 Bacteria 10243
175 Ga0495613_0014171 3300046689 Bacteria 5914
176 Ga0495613_0068153 3300046689 Bacteria 2595
177 Ga0495671_0008163 3300046692 Bacteria 5907
178 Ga0495589_0017473 3300046794 Bacteria 3681
179 Ga0495589_0019311 3300046794 Bacteria 3496
180 Ga0495589_0022940 3300046794 Bacteria 3181
181 Ga0495600_0155668 3300046809 Bacteria 1478
182 Ga0495581_0002415 3300047315 Bacteria 10549
183 Ga0495581_0091694 3300047315 Bacteria 1763
184 Ga0495604_0000467 3300047317 Bacteria 35655
185 Ga0495636_0002199 3300047318 Bacteria 7483
186 Ga0495674_0142380 3300047319 Bacteria 2015
187 Ga0495674_0160187 3300047319 Bacteria 1883
188 Ga0495676_0006825 3300047321 Bacteria 10495
189 Ga0495676_0036682 3300047321 Bacteria 4090
190 Ga0495680_0083269 3300047322 Bacteria 2412
191 Ga0495683_0069209 3300047323 Bacteria 1734
192 Ga0495687_002131 3300047443 Bacteria 16543
193 Ga0495687_003185 3300047443 Bacteria 12198
194 Ga0495675_0004804 3300047444 Bacteria 8214
195 Ga0495675_0010206 3300047444 Bacteria 5860
196 Ga0495677_0010204 3300047445 Bacteria 3454
197 Ga0495685_003457 3300047447 Bacteria 5047
198 Ga0495685_004319 3300047447 Bacteria 4583
199 Ga0495685_005300 3300047447 Bacteria 4204
200 Ga0495685_031169 3300047447 Bacteria 1833
201 Ga0495681_0022824 3300047470 Bacteria 3338
202 Ga0495684_0174003 3300047471 Bacteria 1599
203 Ga0495686_0032550 3300047472 Bacteria 3374
204 Ga0495593_0003049 3300047673 Bacteria 10095
205 Ga0495602_0025014 3300048088 Bacteria 5785
206 Ga0495614_0010150 3300048089 Bacteria 4155
207 Ga0495614_0011772 3300048089 Bacteria 3845
208 Ga0495614_0024512 3300048089 Bacteria 2604
209 Ga0496108_0000074 3300048911 Bacteria 108445
210 Ga0496109_0056624 3300048912 Bacteria 3577
211 Ga0495678_033967 3300049459 Bacteria 2102
212 Ga0501033_0057143 3300049570 Bacteria 2884
213 Ga0501047_0063395 3300049581 Bacteria 3566
214 Ga0501047_0063699 3300049581 Bacteria 3556
215 Ga0501070_0515178 3300049586 Bacteria 960
216 Ga0501077_0073447 3300049593 Bacteria 2167
217 Ga0501282_005631 3300049778 Bacteria 1340
218 Ga0501035_0069351 3300049822 Bacteria 3126
219 Ga0501035_0169580 3300049822 Bacteria 1886
220 Ga0501044_0009258 3300049823 Bacteria 10759
221 nmdc:mga03n38_14592_c1 3300050490 Bacteria 3015
222 nmdc:mga06z11_1583_c1 3300050494 Bacteria 8477
223 nmdc:mga07m45_31672_c1 3300050496 Bacteria 2931
224 nmdc:mga05p37_517678_c1 3300050507 Bacteria 1365
225 nmdc:mga09592_128561_c1 3300050508 Bacteria 2179
226 nmdc:mga06r32_40110_c1 3300050510 Bacteria 4444
227 nmdc:mga06r32_8762_c1 3300050510 Bacteria 9114
228 Ga0495601_0037971 3300053077 Bacteria 3010
229 Ga0495612_0021935 3300053078 Bacteria 2560
230 Ga0500644_0008520 3300053088 Bacteria 2710
231 Ga0500646_0000083 3300053090 Bacteria 26729
232 Ga0500583_0004321 3300053092 Bacteria 4617
233 Ga0500651_0042866 3300053093 Bacteria 2851
234 Ga0500560_001443 3300053107 Bacteria 4135
235 Ga0500658_0011967 3300053134 Bacteria 3199
236 Ga0500579_080831 3300053143 Bacteria 1818
237 Ga0500588_0003415 3300053146 Bacteria 3355
238 Ga0500600_0063842 3300053149 Bacteria 2043
239 Ga0500624_002255 3300053157 Bacteria 2647
240 Ga0466962_0000359 3300061719 Bacteria 19575
241 2515496776 2515154088 Bacteria 5526283
242 2515722896 2515154129 Bacteria 5584369
243 2515758912 2515154137 Bacteria 5711575
244 2516085319 2515154202 Bacteria 5471270
245 2516090888 2515154203 Bacteria 5458536
246 2559430288 2558860280 Bacteria 11429938
247 2585303905 2582581313 Bacteria 10042643
248 2585315415 2582581314 Bacteria 11452267
249 2616695971 2616644814 Bacteria 11555299
250 2644014487 2643221601 Bacteria 7493239
251 2644175924 2643221631 Bacteria 8168043
252 2644268380 2643221647 Bacteria 10741251
253 2644405957 2643221673 Bacteria 9196637
254 2785345402 2784746763 Bacteria 9783172
255 2785367483 2784746768 Bacteria 10036182
256 2786668543 2786546132 Bacteria 10419719
257 2812360016 2811994879 Bacteria 9313447
258 2832007428 2832004796 Bacteria 6538017
259 2852638006 2852635781 Bacteria 8251373
260 2855671185 2855670206 Bacteria 7120389
261 2863406663 2863404153 Bacteria 9672205
262 2866066290 2866065130 Bacteria 6518152
263 2867315758 2867312974 Bacteria 7058875
264 2867323776 2867319477 Bacteria 7069771
265 2867433202 2867428634 Bacteria 9590268
266 2877683060 2877676314 Bacteria 9512378
267 2912722066 2912715099 Bacteria 9460473
268 2912725830 2912723979 Bacteria 8557534
269 2919473594 2919468124 Bacteria 9133025
270 2935396389 2935390628 Bacteria 7043367
271 2946051728 2946045630 Bacteria 8527308
272 2946065877 2946064051 Bacteria 8957905
273 2947231525 2947224130 Bacteria 9938529
274 2954010736 2954002825 Bacteria 9173742
275 2954388283 2954380949 Bacteria 10050426
276 2954674819 2954673503 Bacteria 9685905
277 2954689314 2954682443 Bacteria 9862841
278 2954699087 2954691527 Bacteria 10720516
279 2954703132 2954701450 Bacteria 10834262
280 2954718040 2954711539 Bacteria 10867210
281 2954728007 2954721474 Bacteria 10456478
282 2954733797 2954731030 Bacteria 10243860
283 2954746904 2954740390 Bacteria 10229294
284 2954752682 2954749733 Bacteria 10366972
285 2954766018 2954759201 Bacteria 9358192
286 3003000674 3002998708 Bacteria 11715108
287 3006399674 3006393351 Bacteria 6615579
288 3006430405 3006425503 Bacteria 6491253
289 3006487803 3006486233 Bacteria 8157040
290 3006495328 3006493962 Bacteria 8825450
291 8001782030 8001781756 Bacteria 9586736
292 8002778647 8002775197 Bacteria 10728764
293 8003858612 8003856774 Bacteria 7675274
294 8008561646 8008558824 Bacteria 10610750
295 8008580465 8008574985 Bacteria 7815457
296 8047710714 8047710418 Bacteria 11023148
297 8048412012 8048406513 Bacteria 8936924
298 8056835395 8056829672 Bacteria 9045328
299 Ga0075430_100004495
300 rootH1_10064095
301 rootH1_10024233
302 Ga0006562J51391_1052816
303 Ga0006562J51391_1069085
304 Ga0070658_10005779
305 Ga0070668_100000934
306 Ga0070713_100083747
307 Ga0070713_100376848
308 Ga0070684_100100368
309 Ga0068853_100006182
310 Ga0070665_100502089
311 Ga0070664_100009735
312 Ga0068857_100062280
313 Ga0068857_100119219
314 Ga0068851_10044595
315 Ga0068862_100089502
316 Ga0081539_10001780
317 Ga0075428_100149629
318 Ga0075428_100449245
319 Ga0075431_100027529
320 Ga0114129_10024978
321 Ga0105239_10187691
322 Ga0182008_10000679
323 Ga0182007_10000941
324 Ga0183367_1010
325 Ga0207713_1035486
326 Ga0207705_10018473
327 Ga0207657_10075856
328 Ga0207679_10055288
329 Ga0207679_10094931
330 Ga0207668_10088749
331 Ga0207639_10131997
332 Ga0207678_10214701
333 Ga0207674_10134733
334 Ga0307515_10000095
335 Ga0307515_10000544
336 Ga0307515_10034544
337 Ga0307515_10043347
338 Ga0307515_10075160
339 Ga0307515_10184470
340 Ga0307511_10000584
341 Ga0307512_10001375
342 Ga0307512_10010604
343 Ga0307513_10064816
344 Ga0307509_10029413
345 Ga0307509_10040125
346 Ga0307509_10068109
347 Ga0307509_10078089
348 Ga0307408_100123958
349 Ga0307508_10014111
350 Ga0307508_10019746
351 Ga0307514_10004054
352 Ga0307516_10006645
353 Ga0307516_10009612
354 Ga0307516_10012737
355 Ga0307516_10021111
356 Ga0307516_10049352
357 Ga0307405_10081211
358 Ga0307413_10021606
359 Ga0307413_10254980
360 Ga0307413_10266098
361 Ga0307518_10096060
362 Ga0307410_10034032
363 Ga0307407_10005770
364 Ga0307409_100002449
365 Ga0307416_100000203
366 Ga0307416_100238516
367 Ga0307416_100247187
368 Ga0307416_100294835
369 Ga0307415_100000044
370 Ga0307415_100002114
371 Ga0307415_100022548
372 Ga0307415_100445696
373 Ga0307507_10088478
374 Ga0307507_10230694
375 Ga0307510_10059356
376 Ga0307510_10094668
377 Ga0307510_10113376
378 Ga0373940_0003530
379 Ga0373951_0000009
380 Ga0373942_0000126
381 Ga0395900_0027851
382 Ga0395900_0126141
383 Ga0395898_0003967
384 Ga0395898_0091878
385 Ga0439436_0002104
386 Ga0439439_0003410
387 Ga0439439_0003721
388 Ga0451853_0145401
389 Ga0451853_0533830
390 Ga0439442_014279
391 Ga0439449_0007965
392 Ga0439457_000036
393 Ga0439457_000145
394 Ga0439457_024106
395 Ga0439462_0002992
396 Ga0450894_000736
397 Ga0450898_003074
398 Ga0450903_000049
399 Ga0450908_007298
400 Ga0466969_0001153
401 Ga0466969_0043096
402 Ga0466972_0001790
403 Ga0466972_0002902
404 Ga0466965_0040335
405 Ga0466966_0002049
406 Ga0466961_0001282
407 Ga0466961_0003749
408 Ga0466961_0030515
409 Ga0466961_0032629
410 Ga0466963_0274139
411 Ga0466971_0000390
412 Ga0466971_0008235
413 Ga0466971_0071875
414 Ga0466970_0029689
415 Ga0466970_0036535
416 Ga0466957_0175284
417 Ga0466959_0035951
418 Ga0466958_0025766
419 Ga0466967_0006359
420 Ga0495592_0036605
421 Ga0495592_0050658
422 Ga0495592_0114192
423 Ga0495603_0002198
424 Ga0495603_0058884
425 Ga0495629_0010156
426 Ga0495629_0067594
427 Ga0495629_0076766
428 Ga0495629_0126396
429 Ga0495651_0018017
430 Ga0495605_0007596
431 Ga0495639_0097690
432 Ga0495662_0005040
433 Ga0495662_0049270
434 Ga0495594_0014807
435 Ga0495594_0110602
436 Ga0495607_0047361
437 Ga0495606_0006425
438 Ga0495616_0009613
439 Ga0495618_0040614
440 Ga0495618_0086662
441 Ga0495630_0097280
442 Ga0495637_0020729
443 Ga0495643_0099066
444 Ga0495666_0008711
445 Ga0495666_0082811
446 Ga0495652_0001620
447 Ga0495652_0050913
448 Ga0495640_0113168
449 Ga0495586_0086710
450 Ga0495587_0006754
451 Ga0495597_0020674
452 Ga0495622_0019418
453 Ga0495622_0038948
454 Ga0495667_0028534
455 Ga0495668_0012167
456 Ga0495634_0001367
457 Ga0495625_0006079
458 Ga0495625_0021785
459 Ga0495635_0007997
460 Ga0495635_0020280
461 Ga0495635_0090660
462 Ga0495661_0016492
463 Ga0495588_0000421
464 Ga0495588_0014155
465 Ga0495588_0173005
466 Ga0495657_0008917
467 Ga0495657_0012100
468 Ga0495657_0039823
469 Ga0495623_0055244
470 Ga0495646_0017435
471 Ga0495646_0057200
472 Ga0495613_0004703
473 Ga0495613_0014171
474 Ga0495613_0068153
475 Ga0495671_0008163
476 Ga0495589_0017473
477 Ga0495589_0019311
478 Ga0495589_0022940
479 Ga0495600_0155668
480 Ga0495581_0002415
481 Ga0495581_0091694
482 Ga0495604_0000467
483 Ga0495636_0002199
484 Ga0495674_0142380
485 Ga0495674_0160187
486 Ga0495676_0006825
487 Ga0495676_0036682
488 Ga0495680_0083269
489 Ga0495683_0069209
490 Ga0495687_002131
491 Ga0495687_003185
492 Ga0495675_0004804
493 Ga0495675_0010206
494 Ga0495677_0010204
495 Ga0495685_003457
496 Ga0495685_004319
497 Ga0495685_005300
498 Ga0495685_031169
499 Ga0495681_0022824
500 Ga0495684_0174003
501 Ga0495686_0032550
502 Ga0495593_0003049
503 Ga0495602_0025014
504 Ga0495614_0010150
505 Ga0495614_0011772
506 Ga0495614_0024512
507 Ga0496108_0000074
508 Ga0496109_0056624
509 Ga0495678_033967
510 Ga0501033_0057143
511 Ga0501047_0063395
512 Ga0501047_0063699
513 Ga0501070_0515178
514 Ga0501077_0073447
515 Ga0501282_005631
516 Ga0501035_0069351
517 Ga0501035_0169580
518 Ga0501044_0009258
519 nmdc:mga03n38_14592_c1
520 nmdc:mga06z11_1583_c1
521 nmdc:mga07m45_31672_c1
522 nmdc:mga05p37_517678_c1
523 nmdc:mga09592_128561_c1
524 nmdc:mga06r32_40110_c1
525 nmdc:mga06r32_8762_c1
526 Ga0495601_0037971
527 Ga0495612_0021935
528 Ga0500644_0008520
529 Ga0500646_0000083
530 Ga0500583_0004321
531 Ga0500651_0042866
532 Ga0500560_001443
533 Ga0500658_0011967
534 Ga0500579_080831
535 Ga0500588_0003415
536 Ga0500600_0063842
537 Ga0500624_002255
538 Ga0466962_0000359
539 2515496776
540 2515722896
541 2515758912
542 2516085319
543 2516090888
544 2559430288
545 2585303905
546 2585315415
547 2616695971
548 2644014487
549 2644175924
550 2644268380
551 2644405957
552 2785345402
553 2785367483
554 2786668543
555 2812360016
556 2832007428
557 2852638006
558 2855671185
559 2863406663
560 2866066290
561 2867315758
562 2867323776
563 2867433202
564 2877683060
565 2912722066
566 2912725830
567 2919473594
568 2935396389
569 2946051728
570 2946065877
571 2947231525
572 2954010736
573 2954388283
574 2954674819
575 2954689314
576 2954699087
577 2954703132
578 2954718040
579 2954728007
580 2954733797
581 2954746904
582 2954752682
583 2954766018
584 3003000674
585 3006399674
586 3006430405
587 3006487803
588 3006495328
589 8001782030
590 8002778647
591 8003858612
592 8008561646
593 8008580465
594 8047710714
595 8048412012
596 8056835395

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03747

ADP_ribosyl_GH

ADP-ribosylglycohydrolase

45

350

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g9d-assembly2.cif.gz_B crystal structure glycohydrolase 0.834 2 325
2yzw-assembly1.cif.gz_A adp-ribosylglycohydrolase-related protein complex 0.8321 3 324
2wod-assembly2.cif.gz_B crystal structure of the dinitrogenase reductase-activating glycohydrolase (drag) from rhodospirillum rubrum in complex with adp- ribsoyllysine 0.8298 2 324
3o5t-assembly1.cif.gz_A structure of drag-glnz complex with adp 0.8271 3 325
2woe-assembly3.cif.gz_C crystal structure of the d97n variant of dinitrogenase reductase- activating glycohydrolase (drag) from rhodospirillum rubrum in complex with adp-ribose 0.8255 3 324
ID Description Score Start End Superfamily
3g9dB00 Mainly Alpha;Orthogonal Bundle;ADP-ribosylglycohydrolase fold;ADP-ribosylation/Crystallin J1 0.834 2 325 1.10.4080.10
2cwcA00 Mainly Alpha;Orthogonal Bundle;ADP-ribosylglycohydrolase fold;ADP-ribosylation/Crystallin J1 0.8192 3 324 1.10.4080.10
1t5jA00 Mainly Alpha;Orthogonal Bundle;ADP-ribosylglycohydrolase fold;ADP-ribosylation/Crystallin J1 0.8139 3 324 1.10.4080.10
af_A0A2R8Q1N4_3_353_1.10.4080.10 Mainly Alpha;Orthogonal Bundle;ADP-ribosylglycohydrolase fold;ADP-ribosylation/Crystallin J1 0.8112 2 324 1.10.4080.10
af_Q66HT8_10_352_1.10.4080.10 Mainly Alpha;Orthogonal Bundle;ADP-ribosylglycohydrolase fold;ADP-ribosylation/Crystallin J1 0.8092 2 324 1.10.4080.10
ID Description Score Start End GO Terms
AF-A0A4Q7UMW5-F1-model_v4 ADP-ribosylglycohydrolase 0.9847 2 325 GO:0016787
GO:0046872
AF-A0A1N6Y553-F1-model_v4 ADP-ribosylglycohydrolase 0.9834 2 321 GO:0016787
GO:0046872
AF-A0A3N6HQM9-F1-model_v4 deleted 0.9816 55 325
AF-A0A1G6P9J6-F1-model_v4 ADP-ribosylglycohydrolase 0.9815 2 324 GO:0016787
GO:0046872
AF-A0A3N6GF20-F1-model_v4 ADP-ribosyl-[dinitrogen reductase] glycohydrolase (EC 3.2.2.24) 0.9787 2 324 GO:0046872
GO:0047407

Map