F394112

General Info

Members Datasets Scaffolds Average Seq Length
298 224 596 138

Family's Representative Sequence

Representative Sequence 3300005440|Ga0070705_101019788|Ga0070705_1010197882
Length 141
Sequence MTIQTHNALVEDPSSLAESILEHIADAVIYADGTGTIRRWNAAAADLFGYGSEEALIPERLRPAHWRGFEAAVTSGALKLSGRPTVTRAVHRTGRRLYVEMTFALVTAHAGGAARGAVAVARDVTERIEQQRADTRGDHIG

Samples

Sample ID Description Type Environment
1 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
62 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
89 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
136 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
137 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
138 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
141 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
147 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
148 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
151 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
157 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
158 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
159 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
160 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
161 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
162 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
163 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
164 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
165 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
168 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
169 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
170 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
171 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
172 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
173 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
174 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
175 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
176 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
177 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
178 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
179 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
180 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
181 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
182 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
194 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
195 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
196 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
197 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
198 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
208 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
209 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
210 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
211 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
212 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
213 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
214 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
215 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
216 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
217 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
218 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
219 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
220 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
221 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
222 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
223 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
224 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.65
Metatranscriptomes 0.34
Isolates 2.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.7
Nodule 2.01
Rhizoplane 6.04
Rhizosphere 80.87
Stem 0
Stem Tuber 0
Unclassified 17.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070705_101019788 3300005440 Bacteria 673
2 rootL2_10040195 3300003322 Bacteria 4109
3 JGI25404J52841_10068911 3300003659 Unclassified 739
4 Ga0065704_10325809 3300005289 Bacteria 845
5 Ga0070683_100001608 3300005329 Bacteria 17476
6 Ga0070670_100920717 3300005331 Unclassified 793
7 Ga0070680_100017498 3300005336 Bacteria 5652
8 Ga0070680_100024977 3300005336 Bacteria 4775
9 Ga0070660_101186841 3300005339 Bacteria 647
10 Ga0070691_10181065 3300005341 Bacteria 1097
11 Ga0070687_101185847 3300005343 Bacteria 562
12 Ga0070669_100267543 3300005353 Bacteria 1366
13 Ga0070671_100352128 3300005355 Bacteria 1257
14 Ga0070674_101039554 3300005356 Unclassified 721
15 Ga0070667_100567514 3300005367 Unclassified 1044
16 Ga0070709_10001494 3300005434 Bacteria 12636
17 Ga0070714_100003138 3300005435 Bacteria 12270
18 Ga0070713_100001397 3300005436 Bacteria 15468
19 Ga0070713_100123955 3300005436 Bacteria 2270
20 Ga0070710_10004580 3300005437 Bacteria 6532
21 Ga0070710_10009519 3300005437 Bacteria 4755
22 Ga0070701_10567356 3300005438 Unclassified 747
23 Ga0070711_100002728 3300005439 Bacteria 10127
24 Ga0070711_100013354 3300005439 Bacteria 5158
25 Ga0070711_100031759 3300005439 Bacteria 3508
26 Ga0070711_101610284 3300005439 Bacteria 568
27 Ga0070694_100978478 3300005444 Bacteria 702
28 Ga0070694_101067355 3300005444 Bacteria 673
29 Ga0070708_100058866 3300005445 Bacteria 3424
30 Ga0070663_100802313 3300005455 Bacteria 807
31 Ga0070681_10036786 3300005458 Bacteria 4915
32 Ga0070681_10317500 3300005458 Bacteria 1467
33 Ga0070706_100767623 3300005467 Bacteria 893
34 Ga0070707_100010540 3300005468 Bacteria 8610
35 Ga0070698_100360936 3300005471 Bacteria 1385
36 Ga0070699_100108972 3300005518 Bacteria 2430
37 Ga0070679_100011783 3300005530 Bacteria 8337
38 Ga0070679_100023003 3300005530 Bacteria 6096
39 Ga0070679_101934276 3300005530 Bacteria 539
40 Ga0070684_100006096 3300005535 Bacteria 9286
41 Ga0070684_100898502 3300005535 Bacteria 830
42 Ga0070684_101547064 3300005535 Bacteria 625
43 Ga0068853_100634432 3300005539 Bacteria 1016
44 Ga0070672_100028966 3300005543 Bacteria 4147
45 Ga0070686_100237125 3300005544 Bacteria 1326
46 Ga0070704_100026958 3300005549 Bacteria 3804
47 Ga0070664_100069153 3300005564 Bacteria 3020
48 Ga0068857_100874989 3300005577 Bacteria 861
49 Ga0068854_100228342 3300005578 Bacteria 1476
50 Ga0068856_102313442 3300005614 Bacteria 545
51 Ga0070702_100652222 3300005615 Bacteria 796
52 Ga0070702_101554384 3300005615 Unclassified 546
53 Ga0068864_100802654 3300005618 Bacteria 925
54 Ga0068864_102453195 3300005618 Bacteria 528
55 Ga0068861_100013072 3300005719 Bacteria 5804
56 Ga0068860_100397563 3300005843 Bacteria 1363
57 Ga0068862_100019758 3300005844 Bacteria 5626
58 Ga0081455_10005326 3300005937 Bacteria 14129
59 Ga0081455_10007669 3300005937 Bacteria 11329
60 Ga0081455_10008743 3300005937 Bacteria 10487
61 Ga0081455_10121347 3300005937 Bacteria 2059
62 Ga0081540_1006409 3300005983 Bacteria 8576
63 Ga0070717_10006100 3300006028 Bacteria 8849
64 Ga0075365_10010782 3300006038 Bacteria 5342
65 Ga0075368_10327236 3300006042 Bacteria 664
66 Ga0075364_10342908 3300006051 Unclassified 1018
67 Ga0070715_10007954 3300006163 Bacteria 3674
68 Ga0070715_10034072 3300006163 Bacteria 2085
69 Ga0070715_10047986 3300006163 Bacteria 1823
70 Ga0070716_100001872 3300006173 Bacteria 9547
71 Ga0070716_100864819 3300006173 Bacteria 705
72 Ga0070712_100000653 3300006175 Bacteria 20405
73 Ga0070712_100052062 3300006175 Bacteria 2854
74 Ga0097621_100306027 3300006237 Bacteria 1405
75 Ga0097621_100506963 3300006237 Bacteria 1094
76 Ga0068871_100042320 3300006358 Bacteria 3656
77 Ga0068871_101155770 3300006358 Unclassified 725
78 Ga0075428_100242226 3300006844 Bacteria 1945
79 Ga0075431_100811095 3300006847 Unclassified 909
80 Ga0075431_101068664 3300006847 Bacteria 772
81 Ga0075433_11364097 3300006852 Bacteria 614
82 Ga0075434_100669253 3300006871 Unclassified 1056
83 Ga0068865_101421579 3300006881 Bacteria 620
84 Ga0075436_101268515 3300006914 Unclassified 557
85 Ga0099825_1027544 3300006941 Bacteria 2875
86 Ga0099824_1036411 3300006942 Bacteria 1429
87 Ga0075435_101878079 3300007076 Unclassified 526
88 Ga0099794_10008900 3300007265 Bacteria 4185
89 Ga0105240_10067521 3300009093 Bacteria 4432
90 Ga0105240_10518477 3300009093 Bacteria 1323
91 Ga0111539_10188091 3300009094 Bacteria 2410
92 Ga0111539_10994320 3300009094 Bacteria 975
93 Ga0114129_11024388 3300009147 Bacteria 1038
94 Ga0114129_11080524 3300009147 Unclassified 1006
95 Ga0114129_11762285 3300009147 Unclassified 754
96 Ga0114129_13138432 3300009147 Unclassified 539
97 Ga0105243_10555532 3300009148 Unclassified 1098
98 Ga0105241_10933623 3300009174 Bacteria 808
99 Ga0105242_10183192 3300009176 Bacteria 1849
100 Ga0105242_11012590 3300009176 Bacteria 839
101 Ga0105248_10005134 3300009177 Bacteria 14445
102 Ga0105237_10061316 3300009545 Bacteria 3761
103 Ga0105237_10570536 3300009545 Bacteria 1138
104 Ga0105238_10150641 3300009551 Bacteria 2301
105 Ga0105249_10109685 3300009553 Bacteria 2607
106 Ga0105239_10826789 3300010375 Unclassified 1062
107 Ga0105246_10009053 3300011119 Bacteria 6132
108 Ga0105246_11511776 3300011119 Bacteria 631
109 Ga0157369_10156704 3300013105 Bacteria 2405
110 Ga0157374_10794725 3300013296 Unclassified 962
111 Ga0163162_10061636 3300013306 Bacteria 3788
112 Ga0163162_10561695 3300013306 Bacteria 1269
113 Ga0157372_10413428 3300013307 Bacteria 1572
114 Ga0157375_10218229 3300013308 Bacteria 2065
115 Ga0163163_11055883 3300014325 Bacteria 875
116 Ga0157379_11393523 3300014968 Bacteria 679
117 Ga0157376_11778495 3300014969 Unclassified 652
118 Ga0157376_12192221 3300014969 Bacteria 591
119 Ga0163161_10133004 3300017792 Bacteria 1878
120 Ga0163161_10689171 3300017792 Bacteria 850
121 Ga0213874_10017183 3300021377 Bacteria 1937
122 Ga0213876_10144598 3300021384 Bacteria 1264
123 Ga0213871_10072063 3300021441 Unclassified 978
124 Ga0224712_10116498 3300022467 Bacteria 1152
125 Ga0207692_10005269 3300025898 Bacteria 5168
126 Ga0207692_10036065 3300025898 Bacteria 2408
127 Ga0207692_10135339 3300025898 Bacteria 1396
128 Ga0207688_10108630 3300025901 Bacteria 1609
129 Ga0207685_10054315 3300025905 Bacteria 1560
130 Ga0207699_10000906 3300025906 Bacteria 14182
131 Ga0207699_10003241 3300025906 Bacteria 7750
132 Ga0207699_10086259 3300025906 Bacteria 1960
133 Ga0207645_11176315 3300025907 Unclassified 515
134 Ga0207643_10244572 3300025908 Bacteria 1104
135 Ga0207684_10010424 3300025910 Bacteria 8183
136 Ga0207654_10035309 3300025911 Bacteria 2784
137 Ga0207707_10000413 3300025912 Bacteria 44774
138 Ga0207707_10020024 3300025912 Bacteria 5837
139 Ga0207695_11240790 3300025913 Bacteria 626
140 Ga0207671_10461633 3300025914 Bacteria 1012
141 Ga0207693_10001082 3300025915 Bacteria 24450
142 Ga0207693_10002887 3300025915 Bacteria 14864
143 Ga0207693_10018775 3300025915 Bacteria 5503
144 Ga0207693_10065322 3300025915 Bacteria 2850
145 Ga0207663_10000744 3300025916 Bacteria 14533
146 Ga0207663_10001148 3300025916 Bacteria 12217
147 Ga0207663_10001422 3300025916 Bacteria 11119
148 Ga0207660_10017375 3300025917 Bacteria 4779
149 Ga0207657_10119169 3300025919 Bacteria 2172
150 Ga0207657_11085317 3300025919 Bacteria 612
151 Ga0207649_10733494 3300025920 Bacteria 768
152 Ga0207652_10185723 3300025921 Bacteria 1869
153 Ga0207646_10013600 3300025922 Bacteria 7773
154 Ga0207694_10230055 3300025924 Bacteria 1514
155 Ga0207700_10016908 3300025928 Bacteria 4857
156 Ga0207700_10039301 3300025928 Bacteria 3443
157 Ga0207664_10025372 3300025929 Bacteria 4464
158 Ga0207644_11109527 3300025931 Bacteria 665
159 Ga0207644_11367106 3300025931 Bacteria 595
160 Ga0207706_10154458 3300025933 Bacteria 2019
161 Ga0207686_10108707 3300025934 Bacteria 1866
162 Ga0207686_11544928 3300025934 Bacteria 548
163 Ga0207709_10625226 3300025935 Bacteria 855
164 Ga0207669_11875352 3300025937 Unclassified 512
165 Ga0207704_10100887 3300025938 Bacteria 1924
166 Ga0207665_10000549 3300025939 Bacteria 25317
167 Ga0207665_10157847 3300025939 Bacteria 1629
168 Ga0207691_10093241 3300025940 Bacteria 2697
169 Ga0207711_10046520 3300025941 Bacteria 3708
170 Ga0207661_10006710 3300025944 Bacteria 8142
171 Ga0207679_10068150 3300025945 Bacteria 2672
172 Ga0207667_10631823 3300025949 Bacteria 1078
173 Ga0207712_10766930 3300025961 Bacteria 846
174 Ga0207640_10658902 3300025981 Bacteria 893
175 Ga0207658_12075901 3300025986 Unclassified 517
176 Ga0207703_10496420 3300026035 Unclassified 1145
177 Ga0207639_10235580 3300026041 Bacteria 1589
178 Ga0207678_10416099 3300026067 Bacteria 1165
179 Ga0207702_10863465 3300026078 Bacteria 896
180 Ga0207648_10434758 3300026089 Bacteria 1193
181 Ga0207648_10708433 3300026089 Bacteria 933
182 Ga0207676_10653156 3300026095 Bacteria 1015
183 Ga0207676_10739631 3300026095 Bacteria 956
184 Ga0207674_10840763 3300026116 Bacteria 885
185 Ga0207675_100029144 3300026118 Bacteria 5145
186 Ga0207675_100052851 3300026118 Bacteria 3790
187 Ga0207683_10058140 3300026121 Unclassified 3395
188 Ga0207683_10462244 3300026121 Bacteria 1170
189 Ga0209389_1000032 3300027296 Bacteria 134064
190 Ga0209489_100035 3300027361 Bacteria 168255
191 Ga0209700_100005 3300027363 Bacteria 573969
192 Ga0209588_1006405 3300027671 Bacteria 3419
193 Ga0209588_1006677 3300027671 Bacteria 3365
194 Ga0268265_10523181 3300028380 Bacteria 1121
195 Ga0307515_10267666 3300028794 Bacteria 1435
196 Ga0307509_10029986 3300031507 Bacteria 6022
197 Ga0307408_100095652 3300031548 Bacteria 2252
198 Ga0307516_10350062 3300031730 Bacteria 1143
199 Ga0307416_102286443 3300032002 Bacteria 641
200 Ga0307411_11328940 3300032005 Bacteria 656
201 Ga0373952_0295787 3300035092 Unclassified 503
202 Ga0373960_0167953 3300035121 Unclassified 759
203 Ga0373961_0128645 3300035241 Bacteria 846
204 Ga0373931_0546209 3300035691 Unclassified 752
205 Ga0373927_0450529 3300035695 Unclassified 850
206 Ga0373947_0509842 3300035725 Bacteria 818
207 Ga0373947_0819071 3300035725 Unclassified 636
208 Ga0373937_0215646 3300036401 Bacteria 1806
209 Ga0373937_0587071 3300036401 Bacteria 1058
210 Ga0373937_2072483 3300036401 Bacteria 515
211 Ga0395900_0341156 3300037418 Bacteria 1474
212 Ga0395905_0013818 3300037471 Bacteria 7726
213 Ga0395901_0637776 3300038443 Bacteria 1070
214 Ga0436365_0073906 3300039437 Bacteria 1420
215 Ga0436361_1109002 3300039447 Bacteria 728
216 Ga0436362_0092310 3300039453 Bacteria 1014
217 Ga0436362_0557980 3300039453 Bacteria 728
218 Ga0451839_1069957 3300041496 Unclassified 609
219 Ga0450923_081869 3300042125 Bacteria 727
220 Ga0466969_0036082 3300044656 Bacteria 2499
221 Ga0466966_0478833 3300044684 Bacteria 748
222 Ga0466968_0130320 3300044735 Bacteria 1144
223 Ga0466970_0320738 3300044765 Bacteria 876
224 Ga0466970_0499545 3300044765 Bacteria 700
225 Ga0466957_0089234 3300044842 Bacteria 1930
226 Ga0466957_0124309 3300044842 Bacteria 1647
227 Ga0466957_1112519 3300044842 Bacteria 570
228 Ga0466959_0050410 3300045049 Bacteria 3056
229 Ga0466958_0665712 3300045836 Bacteria 678
230 Ga0495603_0355067 3300046455 Unclassified 841
231 Ga0495651_0959103 3300046462 Bacteria 521
232 Ga0495594_0540097 3300046499 Bacteria 662
233 Ga0495608_0315835 3300046511 Bacteria 966
234 Ga0495652_0185392 3300046529 Bacteria 1593
235 Ga0495609_0314449 3300046538 Unclassified 636
236 Ga0495633_0253018 3300046558 Bacteria 804
237 Ga0495667_0095828 3300046559 Bacteria 1921
238 Ga0495656_0510216 3300046615 Bacteria 638
239 Ga0495600_0367797 3300046809 Bacteria 899
240 Ga0495660_0431212 3300046810 Unclassified 573
241 Ga0495676_0518654 3300047321 Bacteria 781
242 Ga0495680_0567570 3300047322 Bacteria 763
243 Ga0495675_0210134 3300047444 Bacteria 1182
244 Ga0495602_0353748 3300048088 Bacteria 1059
245 Ga0496100_0704463 3300048903 Bacteria 788
246 Ga0496102_1097868 3300048905 Unclassified 715
247 Ga0496104_0096396 3300048907 Bacteria 2830
248 Ga0496104_0348826 3300048907 Unclassified 1393
249 Ga0496106_0512580 3300048909 Unclassified 963
250 Ga0496106_1383992 3300048909 Unclassified 544
251 Ga0496108_0215511 3300048911 Bacteria 1667
252 Ga0496108_0657333 3300048911 Unclassified 911
253 Ga0496109_1542107 3300048912 Bacteria 599
254 Ga0496109_1721193 3300048912 Unclassified 561
255 Ga0496112_0133397 3300048915 Bacteria 2454
256 Ga0496112_0196601 3300048915 Unclassified 1977
257 Ga0496112_0263441 3300048915 Unclassified 1673
258 Ga0496113_0746814 3300048916 Unclassified 779
259 Ga0496114_0420928 3300048917 Bacteria 1183
260 Ga0496115_0097960 3300048918 Bacteria 2401
261 Ga0496115_0888742 3300048918 Unclassified 688
262 Ga0496115_1015231 3300048918 Bacteria 633
263 Ga0496121_0070741 3300048924 Bacteria 2809
264 Ga0496124_0140463 3300048927 Unclassified 1907
265 Ga0496126_0106943 3300048929 Bacteria 2441
266 Ga0501038_0482545 3300049574 Bacteria 950
267 nmdc:mga00v17_272622_c1 3300050491 Unclassified 1098
268 nmdc:mga0yw44_17628_c1 3300050492 Bacteria 3891
269 nmdc:mga0yw44_538816_c1 3300050492 Unclassified 792
270 nmdc:mga0yw44_91478_c1 3300050492 Unclassified 1923
271 nmdc:mga05p37_199768_c1 3300050507 Unclassified 2422
272 nmdc:mga05p37_762016_c1 3300050507 Bacteria 1065
273 nmdc:mga09592_655725_c1 3300050508 Unclassified 896
274 nmdc:mga06r32_163856_c1 3300050510 Bacteria 2206
275 nmdc:mga08y16_119399_c1 3300050511 Bacteria 2744
276 nmdc:mga0n895_1149759_c1 3300050512 Bacteria 752
277 nmdc:mga0n895_635604_c1 3300050512 Unclassified 1067
278 nmdc:mga0rr50_1775200_c1 3300050513 Bacteria 519
279 nmdc:mga08x19_892519_c1 3300050514 Bacteria 631
280 nmdc:mga0a205_181852_c1 3300050515 Bacteria 1996
281 Ga0495595_0146035 3300053084 Bacteria 1162
282 Ga0495619_0160849 3300053085 Bacteria 1551
283 Ga0500554_001275 3300053102 Bacteria 4884
284 Ga0500572_000460 3300053111 Bacteria 14133
285 Ga0500559_0001108 3300053136 Bacteria 16237
286 Ga0500603_010320 3300053150 Bacteria 2106
287 Ga0500638_173570 3300053162 Bacteria 937
288 Ga0500639_045221 3300053163 Bacteria 2304
289 Ga0500636_0220956 3300053177 Bacteria 987
290 Ga0500637_0232869 3300053178 Bacteria 1036
291 Ga0500576_097095 3300053725 Bacteria 1210
292 Ga0500596_002138 3300053735 Bacteria 3928
293 2824608668 2824600985 Bacteria 8488197
294 2824612745 2824609381 Bacteria 8672835
295 2824659012 2824653114 Bacteria 8493680
296 2847941650 2847939898 Bacteria 8606328
297 2888420872 2888419890 Bacteria 7857137
298 8056685954 8056681323 Bacteria 8472857
299 Ga0070705_101019788
300 rootL2_10040195
301 JGI25404J52841_10068911
302 Ga0065704_10325809
303 Ga0070683_100001608
304 Ga0070670_100920717
305 Ga0070680_100017498
306 Ga0070680_100024977
307 Ga0070660_101186841
308 Ga0070691_10181065
309 Ga0070687_101185847
310 Ga0070669_100267543
311 Ga0070671_100352128
312 Ga0070674_101039554
313 Ga0070667_100567514
314 Ga0070709_10001494
315 Ga0070714_100003138
316 Ga0070713_100001397
317 Ga0070713_100123955
318 Ga0070710_10004580
319 Ga0070710_10009519
320 Ga0070701_10567356
321 Ga0070711_100002728
322 Ga0070711_100013354
323 Ga0070711_100031759
324 Ga0070711_101610284
325 Ga0070694_100978478
326 Ga0070694_101067355
327 Ga0070708_100058866
328 Ga0070663_100802313
329 Ga0070681_10036786
330 Ga0070681_10317500
331 Ga0070706_100767623
332 Ga0070707_100010540
333 Ga0070698_100360936
334 Ga0070699_100108972
335 Ga0070679_100011783
336 Ga0070679_100023003
337 Ga0070679_101934276
338 Ga0070684_100006096
339 Ga0070684_100898502
340 Ga0070684_101547064
341 Ga0068853_100634432
342 Ga0070672_100028966
343 Ga0070686_100237125
344 Ga0070704_100026958
345 Ga0070664_100069153
346 Ga0068857_100874989
347 Ga0068854_100228342
348 Ga0068856_102313442
349 Ga0070702_100652222
350 Ga0070702_101554384
351 Ga0068864_100802654
352 Ga0068864_102453195
353 Ga0068861_100013072
354 Ga0068860_100397563
355 Ga0068862_100019758
356 Ga0081455_10005326
357 Ga0081455_10007669
358 Ga0081455_10008743
359 Ga0081455_10121347
360 Ga0081540_1006409
361 Ga0070717_10006100
362 Ga0075365_10010782
363 Ga0075368_10327236
364 Ga0075364_10342908
365 Ga0070715_10007954
366 Ga0070715_10034072
367 Ga0070715_10047986
368 Ga0070716_100001872
369 Ga0070716_100864819
370 Ga0070712_100000653
371 Ga0070712_100052062
372 Ga0097621_100306027
373 Ga0097621_100506963
374 Ga0068871_100042320
375 Ga0068871_101155770
376 Ga0075428_100242226
377 Ga0075431_100811095
378 Ga0075431_101068664
379 Ga0075433_11364097
380 Ga0075434_100669253
381 Ga0068865_101421579
382 Ga0075436_101268515
383 Ga0099825_1027544
384 Ga0099824_1036411
385 Ga0075435_101878079
386 Ga0099794_10008900
387 Ga0105240_10067521
388 Ga0105240_10518477
389 Ga0111539_10188091
390 Ga0111539_10994320
391 Ga0114129_11024388
392 Ga0114129_11080524
393 Ga0114129_11762285
394 Ga0114129_13138432
395 Ga0105243_10555532
396 Ga0105241_10933623
397 Ga0105242_10183192
398 Ga0105242_11012590
399 Ga0105248_10005134
400 Ga0105237_10061316
401 Ga0105237_10570536
402 Ga0105238_10150641
403 Ga0105249_10109685
404 Ga0105239_10826789
405 Ga0105246_10009053
406 Ga0105246_11511776
407 Ga0157369_10156704
408 Ga0157374_10794725
409 Ga0163162_10061636
410 Ga0163162_10561695
411 Ga0157372_10413428
412 Ga0157375_10218229
413 Ga0163163_11055883
414 Ga0157379_11393523
415 Ga0157376_11778495
416 Ga0157376_12192221
417 Ga0163161_10133004
418 Ga0163161_10689171
419 Ga0213874_10017183
420 Ga0213876_10144598
421 Ga0213871_10072063
422 Ga0224712_10116498
423 Ga0207692_10005269
424 Ga0207692_10036065
425 Ga0207692_10135339
426 Ga0207688_10108630
427 Ga0207685_10054315
428 Ga0207699_10000906
429 Ga0207699_10003241
430 Ga0207699_10086259
431 Ga0207645_11176315
432 Ga0207643_10244572
433 Ga0207684_10010424
434 Ga0207654_10035309
435 Ga0207707_10000413
436 Ga0207707_10020024
437 Ga0207695_11240790
438 Ga0207671_10461633
439 Ga0207693_10001082
440 Ga0207693_10002887
441 Ga0207693_10018775
442 Ga0207693_10065322
443 Ga0207663_10000744
444 Ga0207663_10001148
445 Ga0207663_10001422
446 Ga0207660_10017375
447 Ga0207657_10119169
448 Ga0207657_11085317
449 Ga0207649_10733494
450 Ga0207652_10185723
451 Ga0207646_10013600
452 Ga0207694_10230055
453 Ga0207700_10016908
454 Ga0207700_10039301
455 Ga0207664_10025372
456 Ga0207644_11109527
457 Ga0207644_11367106
458 Ga0207706_10154458
459 Ga0207686_10108707
460 Ga0207686_11544928
461 Ga0207709_10625226
462 Ga0207669_11875352
463 Ga0207704_10100887
464 Ga0207665_10000549
465 Ga0207665_10157847
466 Ga0207691_10093241
467 Ga0207711_10046520
468 Ga0207661_10006710
469 Ga0207679_10068150
470 Ga0207667_10631823
471 Ga0207712_10766930
472 Ga0207640_10658902
473 Ga0207658_12075901
474 Ga0207703_10496420
475 Ga0207639_10235580
476 Ga0207678_10416099
477 Ga0207702_10863465
478 Ga0207648_10434758
479 Ga0207648_10708433
480 Ga0207676_10653156
481 Ga0207676_10739631
482 Ga0207674_10840763
483 Ga0207675_100029144
484 Ga0207675_100052851
485 Ga0207683_10058140
486 Ga0207683_10462244
487 Ga0209389_1000032
488 Ga0209489_100035
489 Ga0209700_100005
490 Ga0209588_1006405
491 Ga0209588_1006677
492 Ga0268265_10523181
493 Ga0307515_10267666
494 Ga0307509_10029986
495 Ga0307408_100095652
496 Ga0307516_10350062
497 Ga0307416_102286443
498 Ga0307411_11328940
499 Ga0373952_0295787
500 Ga0373960_0167953
501 Ga0373961_0128645
502 Ga0373931_0546209
503 Ga0373927_0450529
504 Ga0373947_0509842
505 Ga0373947_0819071
506 Ga0373937_0215646
507 Ga0373937_0587071
508 Ga0373937_2072483
509 Ga0395900_0341156
510 Ga0395905_0013818
511 Ga0395901_0637776
512 Ga0436365_0073906
513 Ga0436361_1109002
514 Ga0436362_0092310
515 Ga0436362_0557980
516 Ga0451839_1069957
517 Ga0450923_081869
518 Ga0466969_0036082
519 Ga0466966_0478833
520 Ga0466968_0130320
521 Ga0466970_0320738
522 Ga0466970_0499545
523 Ga0466957_0089234
524 Ga0466957_0124309
525 Ga0466957_1112519
526 Ga0466959_0050410
527 Ga0466958_0665712
528 Ga0495603_0355067
529 Ga0495651_0959103
530 Ga0495594_0540097
531 Ga0495608_0315835
532 Ga0495652_0185392
533 Ga0495609_0314449
534 Ga0495633_0253018
535 Ga0495667_0095828
536 Ga0495656_0510216
537 Ga0495600_0367797
538 Ga0495660_0431212
539 Ga0495676_0518654
540 Ga0495680_0567570
541 Ga0495675_0210134
542 Ga0495602_0353748
543 Ga0496100_0704463
544 Ga0496102_1097868
545 Ga0496104_0096396
546 Ga0496104_0348826
547 Ga0496106_0512580
548 Ga0496106_1383992
549 Ga0496108_0215511
550 Ga0496108_0657333
551 Ga0496109_1542107
552 Ga0496109_1721193
553 Ga0496112_0133397
554 Ga0496112_0196601
555 Ga0496112_0263441
556 Ga0496113_0746814
557 Ga0496114_0420928
558 Ga0496115_0097960
559 Ga0496115_0888742
560 Ga0496115_1015231
561 Ga0496121_0070741
562 Ga0496124_0140463
563 Ga0496126_0106943
564 Ga0501038_0482545
565 nmdc:mga00v17_272622_c1
566 nmdc:mga0yw44_17628_c1
567 nmdc:mga0yw44_538816_c1
568 nmdc:mga0yw44_91478_c1
569 nmdc:mga05p37_199768_c1
570 nmdc:mga05p37_762016_c1
571 nmdc:mga09592_655725_c1
572 nmdc:mga06r32_163856_c1
573 nmdc:mga08y16_119399_c1
574 nmdc:mga0n895_1149759_c1
575 nmdc:mga0n895_635604_c1
576 nmdc:mga0rr50_1775200_c1
577 nmdc:mga08x19_892519_c1
578 nmdc:mga0a205_181852_c1
579 Ga0495595_0146035
580 Ga0495619_0160849
581 Ga0500554_001275
582 Ga0500572_000460
583 Ga0500559_0001108
584 Ga0500603_010320
585 Ga0500638_173570
586 Ga0500639_045221
587 Ga0500636_0220956
588 Ga0500637_0232869
589 Ga0500576_097095
590 Ga0500596_002138
591 2824608668
592 2824612745
593 2824659012
594 2847941650
595 2888420872
596 8056685954

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13188

PAS_8

PAS domain

16

81

0.83

PF13426

PAS_9

PAS domain

25

126

0.82

PF00989

PAS

PAS fold

15

124

0.81

PF08448

PAS_4

PAS fold

21

129

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vb6-assembly1.cif.gz_B crystal structure of the heme pas sensor domain of ec dos (oxygen-bound form) 0.9149 6 119
1d06-assembly1.cif.gz_A structural basis of dimerization and sensory mechanisms of oxygen-sensing domain of rhizobium meliloti fixl determined at 1.4a resolution 0.8989 9 121
1vb6-assembly1.cif.gz_A crystal structure of the heme pas sensor domain of ec dos (oxygen-bound form) 0.893 6 119
1vb6-assembly1.cif.gz_B crystal structure of the heme pas sensor domain of ec dos (oxygen-bound form) 0.8918 6 119
2vv6-assembly1.cif.gz_A bjfixlh in ferric form 0.887 14 121
ID Description Score Start End Superfamily
af_I1KMQ9_125_227_3.30.450.20 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.9121 16 120 3.30.450.20
1ew0A00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.8974 9 121 3.30.450.20
1xj6A00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.8935 16 121 3.30.450.20
af_I1KMQ9_125_227_3.30.450.20 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.8874 16 120 3.30.450.20
5iu1A00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.882 14 118 3.30.450.20
ID Description Score Start End GO Terms
AF-A0A2W7G6E6-F1-model_v4 deleted 0.9954 6 134
AF-A0A7X6PW00-F1-model_v4 PAS domain S-box protein 0.9924 6 132
AF-A0A6P2FZ11-F1-model_v4 Oxygen sensor protein DosP (EC 3.1.4.52) 0.9895 6 132 GO:0071111
AF-A0A5H2Y3G1-F1-model_v4 PAS domain-containing protein 0.9893 3 119
AF-A0A522IA76-F1-model_v4 PAS domain S-box protein 0.9882 6 133

Map