F394067

General Info

Members Datasets Scaffolds Average Seq Length
298 167 294 242

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_10536356|Ga0070666_105363561
Length 239
Sequence MRPFGPAFADGDRLEVAGAVVRLRVHARARRVSLRLDRTRREIIATAPTARRLSEAAAFARTRAAWIAARLAELPDAQPLSPGMTLRVFGELVSLTSGAGRARWVSATDLAPARIEAMGEGEGFARAVMLVLRRRALAVLNERTAHYAGRLAAPMPKVAVMDAKGRWGSCKPGSIRYSWRLALAPFEIADYVVAHECAHLLELNHGPRFWAHVTRLVGDPGRYRAWLRAHGAKLHAFGS

Samples

Sample ID Description Type Environment
1 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
2 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
3 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
4 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
57 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
59 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
94 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
95 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
96 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
97 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
98 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
99 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
100 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
101 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
102 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
104 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
114 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
115 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
116 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
117 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
118 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
119 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
120 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
121 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
122 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
123 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
124 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
125 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
126 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
127 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
128 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
129 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
130 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
131 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
132 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
133 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
138 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
139 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
140 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
141 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
142 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
143 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
144 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
149 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
150 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
151 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
152 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
153 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
154 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
155 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
156 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
157 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
158 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
159 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
160 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
161 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
162 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
163 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
164 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
165 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
166 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
167 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.66
Metatranscriptomes 0
Isolates 1.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.09
Nodule 0
Rhizoplane 2.68
Rhizosphere 77.52
Stem 0
Stem Tuber 0
Unclassified 6.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10028527 3300003215 Bacteria 1933
2 Ga0055530_10011201 3300003791 Bacteria 3241
3 Ga0055531_10003394 3300003794 Bacteria 10179
4 Ga0055531_10024005 3300003794 Bacteria 2266
5 Ga0065165_1000896 3300005262 Bacteria 38454
6 Ga0065165_1021273 3300005262 Bacteria 2258
7 Ga0070670_100049919 3300005331 Bacteria 3597
8 Ga0070670_100546889 3300005331 Bacteria 1033
9 Ga0070666_10536356 3300005335 Bacteria 850
10 Ga0070680_100032884 3300005336 Bacteria 4175
11 Ga0068868_100183109 3300005338 Bacteria 1739
12 Ga0070660_100319157 3300005339 Bacteria 1276
13 Ga0070668_100000715 3300005347 Bacteria 22755
14 Ga0070668_100001002 3300005347 Bacteria 19789
15 Ga0070668_100001725 3300005347 Bacteria 15888
16 Ga0070668_100016393 3300005347 Bacteria 5541
17 Ga0070668_100149294 3300005347 Bacteria 1889
18 Ga0070669_100010942 3300005353 Bacteria 6440
19 Ga0070669_100541960 3300005353 Bacteria 969
20 Ga0070671_100197486 3300005355 Bacteria 1706
21 Ga0070659_100000399 3300005366 Bacteria 32898
22 Ga0070667_100002323 3300005367 Bacteria 16659
23 Ga0070667_100005892 3300005367 Bacteria 10210
24 Ga0070667_100146252 3300005367 Bacteria 2073
25 Ga0070681_10007028 3300005458 Bacteria 10958
26 Ga0070681_10065603 3300005458 Bacteria 3599
27 Ga0070681_10641145 3300005458 Bacteria 977
28 Ga0070679_100014171 3300005530 Bacteria 7650
29 Ga0068853_100005703 3300005539 Bacteria 9794
30 Ga0068853_100320386 3300005539 Bacteria 1437
31 Ga0070665_100000418 3300005548 Bacteria 62048
32 Ga0070665_100018661 3300005548 Bacteria 6953
33 Ga0070665_100096879 3300005548 Bacteria 2955
34 Ga0070665_100153245 3300005548 Bacteria 2307
35 Ga0070665_100291335 3300005548 Bacteria 1635
36 Ga0068855_100013908 3300005563 Bacteria 9705
37 Ga0068855_100742716 3300005563 Bacteria 1047
38 Ga0070664_100142729 3300005564 Bacteria 2110
39 Ga0070664_100528165 3300005564 Bacteria 1090
40 Ga0070664_100579726 3300005564 Bacteria 1039
41 Ga0068854_100643624 3300005578 Bacteria 909
42 Ga0068856_100139983 3300005614 Bacteria 2427
43 Ga0068852_100005865 3300005616 Bacteria 8827
44 Ga0068852_100142190 3300005616 Bacteria 2222
45 Ga0068852_100389774 3300005616 Bacteria 1368
46 Ga0068852_101067991 3300005616 Bacteria 827
47 Ga0068859_100002621 3300005617 Bacteria 18302
48 Ga0068859_100015157 3300005617 Bacteria 7737
49 Ga0068859_100508444 3300005617 Bacteria 1300
50 Ga0068864_100007275 3300005618 Bacteria 9103
51 Ga0068864_100188552 3300005618 Bacteria 1889
52 Ga0068864_100272789 3300005618 Bacteria 1577
53 Ga0068864_100438339 3300005618 Bacteria 1247
54 Ga0068864_100464124 3300005618 Bacteria 1213
55 Ga0068861_100011608 3300005719 Bacteria 6128
56 Ga0068861_100039145 3300005719 Bacteria 3537
57 Ga0068863_100000066 3300005841 Bacteria 117816
58 Ga0068863_100009241 3300005841 Bacteria 9616
59 Ga0068863_100106861 3300005841 Bacteria 2663
60 Ga0068863_100325394 3300005841 Bacteria 1494
61 Ga0068863_100392743 3300005841 Bacteria 1356
62 Ga0068858_100000136 3300005842 Bacteria 77380
63 Ga0068858_100003066 3300005842 Bacteria 16744
64 Ga0068858_100181262 3300005842 Bacteria 1989
65 Ga0068858_100321795 3300005842 Bacteria 1478
66 Ga0068860_100000540 3300005843 Bacteria 46055
67 Ga0068860_100024126 3300005843 Bacteria 5880
68 Ga0068860_100029696 3300005843 Bacteria 5260
69 Ga0068862_100040364 3300005844 Bacteria 3967
70 Ga0068862_100089367 3300005844 Bacteria 2681
71 Ga0068862_100093384 3300005844 Bacteria 2624
72 Ga0070717_10034739 3300006028 Bacteria 4078
73 Ga0075368_10001395 3300006042 Bacteria 7708
74 Ga0075363_100003878 3300006048 Bacteria 6452
75 Ga0075363_100163116 3300006048 Bacteria 1262
76 Ga0075364_10000245 3300006051 Bacteria 26164
77 Ga0075367_10015407 3300006178 Bacteria 4154
78 Ga0075366_10077935 3300006195 Bacteria 1977
79 Ga0075370_10296569 3300006353 Bacteria 961
80 Ga0097620_100002621 3300006931 Bacteria 18302
81 Ga0097620_100015157 3300006931 Bacteria 7737
82 Ga0097620_100508421 3300006931 Bacteria 1300
83 Ga0105240_10006441 3300009093 Bacteria 17258
84 Ga0105240_10066067 3300009093 Bacteria 4489
85 Ga0105240_10196984 3300009093 Bacteria 2364
86 Ga0105240_10260442 3300009093 Bacteria 2001
87 Ga0105240_10278294 3300009093 Bacteria 1923
88 Ga0105240_10809350 3300009093 Bacteria 1014
89 Ga0105240_10892826 3300009093 Bacteria 957
90 Ga0105245_10169900 3300009098 Bacteria 2076
91 Ga0105241_10253838 3300009174 Bacteria 1492
92 Ga0105242_10124589 3300009176 Bacteria 2216
93 Ga0105248_10004095 3300009177 Bacteria 16121
94 Ga0105248_10011018 3300009177 Bacteria 9973
95 Ga0105248_10022729 3300009177 Bacteria 6959
96 Ga0105248_10046545 3300009177 Bacteria 4862
97 Ga0105238_10005674 3300009551 Bacteria 12338
98 Ga0105238_10027177 3300009551 Bacteria 5831
99 Ga0105238_10027667 3300009551 Bacteria 5779
100 Ga0105238_10193662 3300009551 Bacteria 2009
101 Ga0105238_10249889 3300009551 Bacteria 1751
102 Ga0105238_10399928 3300009551 Bacteria 1367
103 Ga0105239_10254110 3300010375 Bacteria 1974
104 Ga0157370_10339155 3300013104 Bacteria 1385
105 Ga0157370_10547733 3300013104 Bacteria 1060
106 Ga0157378_10393653 3300013297 Bacteria 1363
107 Ga0157372_10313499 3300013307 Bacteria 1826
108 Ga0163163_10002724 3300014325 Bacteria 14914
109 Ga0163163_10137342 3300014325 Bacteria 2486
110 Ga0163163_10323333 3300014325 Bacteria 1596
111 Ga0163163_10327242 3300014325 Bacteria 1587
112 Ga0157379_10002078 3300014968 Bacteria 16637
113 Ga0157379_10028704 3300014968 Bacteria 4948
114 Ga0157379_10607395 3300014968 Bacteria 1021
115 Ga0163161_10234853 3300017792 Bacteria 1424
116 Ga0213876_10038143 3300021384 Bacteria 2535
117 Ga0213876_10125014 3300021384 Bacteria 1366
118 Ga0209148_1018987 3300025254 Bacteria 1147
119 Ga0209758_1000936 3300025297 Bacteria 39430
120 Ga0209050_1000245 3300025298 Bacteria 116929
121 Ga0209257_1000995 3300025304 Bacteria 38407
122 Ga0209257_1001133 3300025304 Bacteria 34214
123 Ga0207710_10184286 3300025900 Bacteria 1025
124 Ga0207705_10010302 3300025909 Bacteria 6799
125 Ga0207654_10183095 3300025911 Bacteria 1368
126 Ga0207707_10131441 3300025912 Bacteria 2189
127 Ga0207707_10534093 3300025912 Bacteria 998
128 Ga0207695_10000837 3300025913 Bacteria 56634
129 Ga0207695_10005140 3300025913 Bacteria 17526
130 Ga0207695_10005872 3300025913 Bacteria 16108
131 Ga0207695_10013898 3300025913 Bacteria 9570
132 Ga0207695_10046243 3300025913 Bacteria 4614
133 Ga0207660_10001046 3300025917 Bacteria 18312
134 Ga0207660_10035578 3300025917 Bacteria 3458
135 Ga0207660_10112729 3300025917 Bacteria 2049
136 Ga0207657_10004700 3300025919 Bacteria 14417
137 Ga0207657_10010320 3300025919 Bacteria 9326
138 Ga0207657_10324640 3300025919 Bacteria 1216
139 Ga0207652_10001554 3300025921 Bacteria 20200
140 Ga0207652_10066492 3300025921 Bacteria 3124
141 Ga0207681_10008317 3300025923 Bacteria 6344
142 Ga0207681_10510828 3300025923 Bacteria 985
143 Ga0207694_10192461 3300025924 Bacteria 1657
144 Ga0207694_10312537 3300025924 Bacteria 1296
145 Ga0207687_10037343 3300025927 Bacteria 3313
146 Ga0207690_10000695 3300025932 Bacteria 21662
147 Ga0207690_10011651 3300025932 Bacteria 5255
148 Ga0207706_10269313 3300025933 Bacteria 1486
149 Ga0207706_10601933 3300025933 Bacteria 944
150 Ga0207711_10001468 3300025941 Bacteria 21987
151 Ga0207711_10006537 3300025941 Bacteria 9814
152 Ga0207711_10007785 3300025941 Bacteria 8955
153 Ga0207711_10011311 3300025941 Bacteria 7414
154 Ga0207679_10272469 3300025945 Bacteria 1448
155 Ga0207667_10015750 3300025949 Bacteria 8574
156 Ga0207667_10041059 3300025949 Bacteria 4921
157 Ga0207667_10829105 3300025949 Bacteria 920
158 Ga0207668_10001984 3300025972 Bacteria 11973
159 Ga0207668_10002422 3300025972 Bacteria 10912
160 Ga0207668_10188746 3300025972 Bacteria 1631
161 Ga0207668_10226199 3300025972 Bacteria 1505
162 Ga0207640_10424495 3300025981 Bacteria 1089
163 Ga0207658_10004183 3300025986 Bacteria 10056
164 Ga0207658_10049662 3300025986 Bacteria 3083
165 Ga0207703_10000065 3300026035 Bacteria 126087
166 Ga0207703_10003003 3300026035 Bacteria 14304
167 Ga0207703_10122125 3300026035 Bacteria 2237
168 Ga0207639_10004102 3300026041 Bacteria 9823
169 Ga0207641_10000011 3300026088 Bacteria 384362
170 Ga0207641_10014411 3300026088 Bacteria 6478
171 Ga0207641_10068791 3300026088 Bacteria 3037
172 Ga0207641_10243703 3300026088 Bacteria 1676
173 Ga0207676_10002317 3300026095 Bacteria 13658
174 Ga0207676_10193222 3300026095 Bacteria 1793
175 Ga0207675_100023382 3300026118 Bacteria 5748
176 Ga0207675_100065750 3300026118 Bacteria 3389
177 Ga0207683_10271201 3300026121 Bacteria 1550
178 Ga0207698_10037223 3300026142 Bacteria 3581
179 Ga0207698_10134442 3300026142 Bacteria 2119
180 Ga0207698_10228637 3300026142 Bacteria 1687
181 Ga0209981_1000165 3300027378 Bacteria 8118
182 Ga0209999_1002182 3300027543 Bacteria 3426
183 Ga0209983_1003545 3300027665 Bacteria 3319
184 Ga0268266_10000003 3300028379 Bacteria 1701703
185 Ga0268266_10187864 3300028379 Bacteria 1885
186 Ga0268266_10191771 3300028379 Bacteria 1866
187 Ga0268265_10002074 3300028380 Bacteria 15637
188 Ga0268265_10047355 3300028380 Bacteria 3221
189 Ga0268264_10000091 3300028381 Bacteria 233338
190 Ga0268264_10008246 3300028381 Bacteria 8652
191 Ga0268264_10064402 3300028381 Bacteria 3085
192 Ga0307517_10000835 3300028786 Bacteria 53001
193 Ga0307517_10049544 3300028786 Bacteria 4294
194 Ga0307511_10024927 3300030521 Bacteria 5527
195 Ga0265327_10000442 3300031251 Bacteria 75162
196 Ga0265327_10004607 3300031251 Bacteria 12121
197 Ga0265327_10021617 3300031251 Bacteria 3877
198 Ga0307513_10000873 3300031456 Bacteria 43622
199 Ga0307513_10012281 3300031456 Bacteria 10584
200 Ga0307513_10034747 3300031456 Bacteria 5650
201 Ga0307411_10187388 3300032005 Bacteria 1576
202 Ga0307510_10043702 3300033180 Bacteria 4867
203 Ga0373944_0002153 3300035089 Bacteria 5008
204 Ga0373936_0004191 3300035113 Bacteria 5433
205 Ga0373946_0016719 3300035171 Bacteria 2798
206 Ga0373935_0130836 3300035692 Bacteria 1686
207 Ga0373927_0001188 3300035695 Bacteria 19756
208 Ga0373925_0000089 3300037068 Bacteria 98449
209 Ga0395899_0000790 3300037312 Bacteria 30999
210 Ga0395899_0052694 3300037312 Bacteria 3015
211 Ga0395899_0101999 3300037312 Bacteria 2070
212 Ga0395900_0000072 3300037418 Bacteria 187428
213 Ga0395900_0010379 3300037418 Bacteria 9524
214 Ga0395898_0015280 3300037466 Bacteria 7877
215 Ga0395898_0317016 3300037466 Bacteria 1487
216 Ga0395905_0018168 3300037471 Bacteria 6674
217 Ga0395905_0039101 3300037471 Bacteria 4450
218 Ga0395905_0043134 3300037471 Bacteria 4232
219 Ga0395905_0062771 3300037471 Bacteria 3475
220 Ga0395905_0092949 3300037471 Bacteria 2829
221 Ga0395901_0000052 3300038443 Bacteria 165888
222 Ga0395901_0045856 3300038443 Bacteria 4539
223 Ga0395901_0218599 3300038443 Bacteria 1992
224 Ga0436365_1045676 3300039437 Bacteria 1998
225 Ga0436365_1182092 3300039437 Bacteria 4710
226 Ga0466963_0127580 3300044694 Bacteria 1755
227 Ga0466957_0366614 3300044842 Bacteria 980
228 Ga0495629_0023077 3300046459 Bacteria 4434
229 Ga0495583_0003991 3300046506 Bacteria 10890
230 Ga0495620_0017441 3300046515 Bacteria 3579
231 Ga0495620_0032641 3300046515 Bacteria 2370
232 Ga0495628_0279990 3300046516 Bacteria 1239
233 Ga0495643_0012560 3300046522 Bacteria 5106
234 Ga0495652_0345806 3300046529 Bacteria 1067
235 Ga0495654_0108784 3300046530 Bacteria 1267
236 Ga0495609_0021572 3300046538 Bacteria 2972
237 Ga0495597_0066316 3300046542 Bacteria 1564
238 Ga0495645_0137534 3300046543 Bacteria 1707
239 Ga0495622_0002431 3300046557 Bacteria 9037
240 Ga0495611_0174407 3300046648 Bacteria 1005
241 Ga0495625_0013206 3300046660 Bacteria 6650
242 Ga0495625_0362070 3300046660 Bacteria 914
243 Ga0495659_0094634 3300046664 Bacteria 1151
244 Ga0495669_0000014 3300046684 Bacteria 140832
245 Ga0495669_0049989 3300046684 Bacteria 1874
246 Ga0495669_0104098 3300046684 Bacteria 1320
247 Ga0495669_0187022 3300046684 Bacteria 988
248 Ga0495672_0012250 3300047320 Bacteria 5997
249 Ga0495676_0196091 3300047321 Bacteria 1406
250 Ga0495677_0056903 3300047445 Bacteria 1445
251 Ga0495686_0002903 3300047472 Bacteria 15390
252 Ga0495686_0145614 3300047472 Bacteria 1395
253 Ga0495686_0384022 3300047472 Bacteria 757
254 Ga0496100_0275441 3300048903 Bacteria 1253
255 Ga0496101_0076671 3300048904 Bacteria 2463
256 Ga0496102_0117520 3300048905 Bacteria 2482
257 Ga0496108_0285533 3300048911 Bacteria 1437
258 Ga0496112_0062117 3300048915 Bacteria 3684
259 Ga0496112_0216389 3300048915 Bacteria 1872
260 Ga0496113_0218409 3300048916 Bacteria 1519
261 Ga0496115_0009445 3300048918 Bacteria 7246
262 Ga0496116_0040265 3300048919 Bacteria 3220
263 Ga0496117_0028390 3300048920 Bacteria 4335
264 Ga0496118_0008720 3300048921 Bacteria 10419
265 Ga0496121_0000035 3300048924 Bacteria 374316
266 Ga0496125_0098993 3300048928 Bacteria 2156
267 Ga0501032_0244253 3300049569 Unclassified 1166
268 Ga0501047_0031919 3300049581 Bacteria 5083
269 Ga0501047_0036031 3300049581 Bacteria 4781
270 Ga0501048_0325034 3300049582 Bacteria 1096
271 Ga0501035_0255456 3300049822 Bacteria 1487
272 Ga0501044_0004301 3300049823 Bacteria 15971
273 Ga0501044_1072262 3300049823 Bacteria 676
274 nmdc:mga00v17_344_c1 3300050491 Bacteria 26181
275 nmdc:mga0k408_92472_c1 3300050493 Bacteria 1778
276 nmdc:mga07m45_9525_c1 3300050496 Bacteria 5042
277 Ga0500635_0000252 3300053080 Bacteria 22210
278 Ga0500578_0127870 3300053086 Bacteria 1595
279 Ga0500651_0043998 3300053093 Bacteria 2812
280 Ga0500566_0020274 3300053094 Bacteria 3907
281 Ga0500566_0036040 3300053094 Bacteria 2872
282 Ga0500641_0040613 3300053096 Bacteria 1879
283 Ga0500555_002779 3300053103 Bacteria 5023
284 Ga0500595_006101 3300053119 Bacteria 5165
285 Ga0500595_054424 3300053119 Bacteria 1228
286 Ga0500608_003108 3300053122 Bacteria 6163
287 Ga0500614_006259 3300053123 Bacteria 2497
288 Ga0500564_092141 3300053138 Bacteria 1348
289 Ga0500577_0127275 3300053142 Bacteria 1065
290 Ga0500636_0025197 3300053177 Bacteria 3515
291 Ga0500637_0004227 3300053178 Bacteria 6777
292 Ga0500576_082305 3300053725 Bacteria 1356
293 Ga0500645_002274 3300053730 Bacteria 8720
294 Ga0500596_001539 3300053735 Bacteria 4671

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005347 Ga0070668_100016393 Ga0070668_1000163931 206
2 3300005548 Ga0070665_100096879 Ga0070665_1000968792 206
3 3300005563 Ga0068855_100742716 Ga0068855_1007427162 206
4 3300005616 Ga0068852_100142190 Ga0068852_1001421902 206
5 3300005617 Ga0068859_100508444 Ga0068859_1005084442 206
6 3300005841 Ga0068863_100392743 Ga0068863_1003927432 206
7 3300006931 Ga0097620_100508421 Ga0097620_1005084212 206
8 3300026142 Ga0207698_10228637 Ga0207698_102286371 206
9 3300049823 Ga0501044_1072262 Ga0501044_1072262_18_665 214
10 3300026118 Ga0207675_100023382 Ga0207675_1000233825 215
11 3300037312 Ga0395899_0101999 Ga0395899_0101999_1135_1872 218
12 3300005458 Ga0070681_10641145 Ga0070681_106411451 219
13 3300025912 Ga0207707_10534093 Ga0207707_105340932 219
14 3300031456 Ga0307513_10000873 Ga0307513_1000087328 223
15 3300005844 Ga0068862_100089367 Ga0068862_1000893672 224
16 3300025917 Ga0207660_10112729 Ga0207660_101127292 224
17 3300037471 Ga0395905_0018168 Ga0395905_0018168_2532_3269 224
18 3300049569 Ga0501032_0244253 Ga0501032_0244253_55_792 229
19 3300005355 Ga0070671_100197486 Ga0070671_1001974862 230
20 3300046506 Ga0495583_0003991 Ga0495583_0003991_5108_5845 230
21 3300047472 Ga0495686_0384022 Ga0495686_0384022_14_706 230
22 3300048928 Ga0496125_0098993 Ga0496125_0098993_813_1535 230
23 3300053094 Ga0500566_0036040 Ga0500566_0036040_1947_2645 230
24 3300009098 Ga0105245_10169900 Ga0105245_101699002 231
25 3300009551 Ga0105238_10193662 Ga0105238_101936622 231
26 3300025927 Ga0207687_10037343 Ga0207687_100373432 231
27 3300027378 Ga0209981_1000165 Ga0209981_10001658 231
28 3300027543 Ga0209999_1002182 Ga0209999_10021822 231
29 3300027665 Ga0209983_1003545 Ga0209983_10035453 231
30 3300035089 Ga0373944_0002153 Ga0373944_0002153_1785_2516 231
31 3300035171 Ga0373946_0016719 Ga0373946_0016719_1925_2656 231
32 3300035692 Ga0373935_0130836 Ga0373935_0130836_916_1647 231
33 3300035695 Ga0373927_0001188 Ga0373927_0001188_7312_8043 231
34 3300037068 Ga0373925_0000089 Ga0373925_0000089_86003_86734 231
35 3300005564 Ga0070664_100528165 Ga0070664_1005281652 232
36 3300005618 Ga0068864_100272789 Ga0068864_1002727892 232
37 3300025949 Ga0207667_10829105 Ga0207667_108291051 232
38 3300026095 Ga0207676_10193222 Ga0207676_101932222 232
39 3300009093 Ga0105240_10066067 Ga0105240_100660672 233
40 3300009176 Ga0105242_10124589 Ga0105242_101245892 233
41 3300025913 Ga0207695_10005140 Ga0207695_1000514010 233
42 3300035113 Ga0373936_0004191 Ga0373936_0004191_2656_3405 233
43 3300005336 Ga0070680_100032884 Ga0070680_1000328844 234
44 3300005458 Ga0070681_10007028 Ga0070681_1000702812 234
45 3300005458 Ga0070681_10065603 Ga0070681_100656032 234
46 3300005530 Ga0070679_100014171 Ga0070679_1000141714 234
47 3300005548 Ga0070665_100018661 Ga0070665_1000186614 234
48 3300005563 Ga0068855_100013908 Ga0068855_1000139084 234
49 3300005616 Ga0068852_100005865 Ga0068852_1000058654 234
50 3300009093 Ga0105240_10196984 Ga0105240_101969842 234
51 3300009093 Ga0105240_10892826 Ga0105240_108928261 234
52 3300009551 Ga0105238_10249889 Ga0105238_102498892 234
53 3300009551 Ga0105238_10399928 Ga0105238_103999282 234
54 3300013104 Ga0157370_10547733 Ga0157370_105477331 234
55 3300013307 Ga0157372_10313499 Ga0157372_103134992 234
56 3300025912 Ga0207707_10131441 Ga0207707_101314412 234
57 3300025913 Ga0207695_10000837 Ga0207695_1000083720 234
58 3300025913 Ga0207695_10013898 Ga0207695_100138983 234
59 3300025917 Ga0207660_10035578 Ga0207660_100355782 234
60 3300025921 Ga0207652_10066492 Ga0207652_100664922 234
61 3300025924 Ga0207694_10312537 Ga0207694_103125372 234
62 3300025949 Ga0207667_10041059 Ga0207667_100410592 234
63 3300026142 Ga0207698_10037223 Ga0207698_100372232 234
64 3300028379 Ga0268266_10191771 Ga0268266_101917712 234
65 3300037312 Ga0395899_0052694 Ga0395899_0052694_1972_2709 234
66 3300037418 Ga0395900_0010379 Ga0395900_0010379_7113_7850 234
67 3300037466 Ga0395898_0015280 Ga0395898_0015280_2782_3519 234
68 3300037471 Ga0395905_0043134 Ga0395905_0043134_758_1495 234
69 3300037471 Ga0395905_0062771 Ga0395905_0062771_1687_2424 234
70 3300038443 Ga0395901_0218599 Ga0395901_0218599_207_944 234
71 3300005335 Ga0070666_10536356 Ga0070666_105363561 239
72 iso_pu_bacteria 2643221598 2643998737 241
73 iso_pu_bacteria 2643221614 2644087307 241
74 iso_pu_bacteria 2643221661 2644344649 241
75 iso_pu_bacteria 2643221666 2644366667 241
76 3300005331 Ga0070670_100049919 Ga0070670_1000499192 243
77 3300005347 Ga0070668_100001002 Ga0070668_1000010027 243
78 3300005367 Ga0070667_100002323 Ga0070667_1000023235 243
79 3300005617 Ga0068859_100015157 Ga0068859_1000151575 243
80 3300005618 Ga0068864_100464124 Ga0068864_1004641242 243
81 3300005719 Ga0068861_100011608 Ga0068861_1000116085 243
82 3300005841 Ga0068863_100106861 Ga0068863_1001068612 243
83 3300005842 Ga0068858_100181262 Ga0068858_1001812622 243
84 3300005843 Ga0068860_100029696 Ga0068860_1000296962 243
85 3300005844 Ga0068862_100093384 Ga0068862_1000933842 243
86 3300006931 Ga0097620_100015157 Ga0097620_1000151573 243
87 3300025972 Ga0207668_10001984 Ga0207668_100019848 243
88 3300025986 Ga0207658_10049662 Ga0207658_100496623 243
89 3300026035 Ga0207703_10122125 Ga0207703_101221252 243
90 3300026088 Ga0207641_10068791 Ga0207641_100687912 243
91 3300028380 Ga0268265_10047355 Ga0268265_100473552 243
92 3300028381 Ga0268264_10008246 Ga0268264_1000824610 243
93 3300005616 Ga0068852_100389774 Ga0068852_1003897742 244
94 3300009093 Ga0105240_10809350 Ga0105240_108093502 244
95 3300009551 Ga0105238_10005674 Ga0105238_100056749 244
96 3300026142 Ga0207698_10134442 Ga0207698_101344422 244
97 3300003794 Ga0055531_10024005 Ga0055531_100240052 245
98 3300005331 Ga0070670_100546889 Ga0070670_1005468892 245
99 3300005338 Ga0068868_100183109 Ga0068868_1001831092 245
100 3300005339 Ga0070660_100319157 Ga0070660_1003191572 245
101 3300005347 Ga0070668_100000715 Ga0070668_10000071524 245
102 3300005347 Ga0070668_100001725 Ga0070668_10000172517 245
103 3300005347 Ga0070668_100149294 Ga0070668_1001492942 245
104 3300005353 Ga0070669_100010942 Ga0070669_1000109426 245
105 3300005353 Ga0070669_100541960 Ga0070669_1005419602 245
106 3300005366 Ga0070659_100000399 Ga0070659_10000039914 245
107 3300005367 Ga0070667_100005892 Ga0070667_10000589212 245
108 3300005367 Ga0070667_100146252 Ga0070667_1001462522 245
109 3300005539 Ga0068853_100005703 Ga0068853_1000057037 245
110 3300005539 Ga0068853_100320386 Ga0068853_1003203862 245
111 3300005548 Ga0070665_100000418 Ga0070665_10000041859 245
112 3300005548 Ga0070665_100153245 Ga0070665_1001532453 245
113 3300005548 Ga0070665_100291335 Ga0070665_1002913352 245
114 3300005564 Ga0070664_100142729 Ga0070664_1001427292 245
115 3300005564 Ga0070664_100579726 Ga0070664_1005797262 245
116 3300005578 Ga0068854_100643624 Ga0068854_1006436241 245
117 3300005614 Ga0068856_100139983 Ga0068856_1001399832 245
118 3300005616 Ga0068852_101067991 Ga0068852_1010679911 245
119 3300005617 Ga0068859_100002621 Ga0068859_10000262112 245
120 3300005618 Ga0068864_100007275 Ga0068864_1000072752 245
121 3300005618 Ga0068864_100188552 Ga0068864_1001885522 245
122 3300005618 Ga0068864_100438339 Ga0068864_1004383392 245
123 3300005719 Ga0068861_100039145 Ga0068861_1000391453 245
124 3300005841 Ga0068863_100000066 Ga0068863_10000006691 245
125 3300005841 Ga0068863_100009241 Ga0068863_1000092414 245
126 3300005841 Ga0068863_100325394 Ga0068863_1003253943 245
127 3300005842 Ga0068858_100000136 Ga0068858_10000013678 245
128 3300005842 Ga0068858_100003066 Ga0068858_10000306614 245
129 3300005842 Ga0068858_100321795 Ga0068858_1003217952 245
130 3300005843 Ga0068860_100000540 Ga0068860_1000005406 245
131 3300005843 Ga0068860_100024126 Ga0068860_1000241263 245
132 3300005844 Ga0068862_100040364 Ga0068862_1000403642 245
133 3300006028 Ga0070717_10034739 Ga0070717_100347394 245
134 3300006042 Ga0075368_10001395 Ga0075368_100013953 245
135 3300006048 Ga0075363_100003878 Ga0075363_1000038782 245
136 3300006048 Ga0075363_100163116 Ga0075363_1001631162 245
137 3300006051 Ga0075364_10000245 Ga0075364_100002452 245
138 3300006178 Ga0075367_10015407 Ga0075367_100154073 245
139 3300006195 Ga0075366_10077935 Ga0075366_100779353 245
140 3300006353 Ga0075370_10296569 Ga0075370_102965692 245
141 3300006931 Ga0097620_100002621 Ga0097620_10000262112 245
142 3300009093 Ga0105240_10006441 Ga0105240_1000644110 245
143 3300009093 Ga0105240_10260442 Ga0105240_102604422 245
144 3300009093 Ga0105240_10278294 Ga0105240_102782942 245
145 3300009177 Ga0105248_10004095 Ga0105248_100040955 245
146 3300009177 Ga0105248_10011018 Ga0105248_100110187 245
147 3300009177 Ga0105248_10022729 Ga0105248_100227293 245
148 3300009177 Ga0105248_10046545 Ga0105248_100465452 245
149 3300009551 Ga0105238_10027667 Ga0105238_100276677 245
150 3300010375 Ga0105239_10254110 Ga0105239_102541102 245
151 3300013104 Ga0157370_10339155 Ga0157370_103391552 245
152 3300013297 Ga0157378_10393653 Ga0157378_103936532 245
153 3300014325 Ga0163163_10002724 Ga0163163_1000272414 245
154 3300014325 Ga0163163_10137342 Ga0163163_101373422 245
155 3300014325 Ga0163163_10323333 Ga0163163_103233332 245
156 3300014325 Ga0163163_10327242 Ga0163163_103272422 245
157 3300014968 Ga0157379_10002078 Ga0157379_1000207810 245
158 3300014968 Ga0157379_10028704 Ga0157379_100287042 245
159 3300014968 Ga0157379_10607395 Ga0157379_106073951 245
160 3300017792 Ga0163161_10234853 Ga0163161_102348531 245
161 3300021384 Ga0213876_10038143 Ga0213876_100381432 245
162 3300021384 Ga0213876_10125014 Ga0213876_101250141 245
163 3300025254 Ga0209148_1018987 Ga0209148_10189872 245
164 3300025304 Ga0209257_1001133 Ga0209257_10011339 245
165 3300025900 Ga0207710_10184286 Ga0207710_101842862 245
166 3300025909 Ga0207705_10010302 Ga0207705_100103022 245
167 3300025913 Ga0207695_10005872 Ga0207695_100058728 245
168 3300025913 Ga0207695_10046243 Ga0207695_100462434 245
169 3300025917 Ga0207660_10001046 Ga0207660_100010466 245
170 3300025919 Ga0207657_10004700 Ga0207657_1000470011 245
171 3300025919 Ga0207657_10010320 Ga0207657_100103203 245
172 3300025919 Ga0207657_10324640 Ga0207657_103246401 245
173 3300025921 Ga0207652_10001554 Ga0207652_100015544 245
174 3300025923 Ga0207681_10008317 Ga0207681_100083172 245
175 3300025923 Ga0207681_10510828 Ga0207681_105108282 245
176 3300025932 Ga0207690_10000695 Ga0207690_1000069512 245
177 3300025932 Ga0207690_10011651 Ga0207690_100116515 245
178 3300025933 Ga0207706_10269313 Ga0207706_102693132 245
179 3300025933 Ga0207706_10601933 Ga0207706_106019332 245
180 3300025941 Ga0207711_10001468 Ga0207711_100014687 245
181 3300025941 Ga0207711_10006537 Ga0207711_100065374 245
182 3300025941 Ga0207711_10007785 Ga0207711_100077854 245
183 3300025941 Ga0207711_10011311 Ga0207711_1001131110 245
184 3300025945 Ga0207679_10272469 Ga0207679_102724692 245
185 3300025949 Ga0207667_10015750 Ga0207667_100157506 245
186 3300025972 Ga0207668_10002422 Ga0207668_1000242212 245
187 3300025972 Ga0207668_10188746 Ga0207668_101887462 245
188 3300025972 Ga0207668_10226199 Ga0207668_102261992 245
189 3300025981 Ga0207640_10424495 Ga0207640_104244952 245
190 3300025986 Ga0207658_10004183 Ga0207658_100041832 245
191 3300026035 Ga0207703_10000065 Ga0207703_1000006511 245
192 3300026035 Ga0207703_10003003 Ga0207703_100030038 245
193 3300026041 Ga0207639_10004102 Ga0207639_100041028 245
194 3300026088 Ga0207641_10000011 Ga0207641_10000011298 245
195 3300026088 Ga0207641_10014411 Ga0207641_100144116 245
196 3300026088 Ga0207641_10243703 Ga0207641_102437032 245
197 3300026095 Ga0207676_10002317 Ga0207676_100023176 245
198 3300026118 Ga0207675_100065750 Ga0207675_1000657504 245
199 3300026121 Ga0207683_10271201 Ga0207683_102712012 245
200 3300028379 Ga0268266_10000003 Ga0268266_100000031126 245
201 3300028379 Ga0268266_10187864 Ga0268266_101878642 245
202 3300028380 Ga0268265_10002074 Ga0268265_1000207415 245
203 3300028381 Ga0268264_10000091 Ga0268264_10000091193 245
204 3300028381 Ga0268264_10064402 Ga0268264_100644022 245
205 3300028786 Ga0307517_10000835 Ga0307517_1000083521 245
206 3300028786 Ga0307517_10049544 Ga0307517_100495442 245
207 3300031251 Ga0265327_10004607 Ga0265327_100046075 245
208 3300031251 Ga0265327_10021617 Ga0265327_100216174 245
209 3300031456 Ga0307513_10012281 Ga0307513_1001228111 245
210 3300031456 Ga0307513_10034747 Ga0307513_100347474 245
211 3300033180 Ga0307510_10043702 Ga0307510_100437024 245
212 3300037312 Ga0395899_0000790 Ga0395899_0000790_3460_4221 245
213 3300037418 Ga0395900_0000072 Ga0395900_0000072_562_1323 245
214 3300037466 Ga0395898_0317016 Ga0395898_0317016_93_854 245
215 3300037471 Ga0395905_0039101 Ga0395905_0039101_3472_4233 245
216 3300037471 Ga0395905_0092949 Ga0395905_0092949_1712_2449 245
217 3300038443 Ga0395901_0000052 Ga0395901_0000052_125510_126271 245
218 3300038443 Ga0395901_0045856 Ga0395901_0045856_472_1212 245
219 3300039437 Ga0436365_1045676 Ga0436365_1045676_1062_1808 245
220 3300039437 Ga0436365_1182092 Ga0436365_1182092_2276_3016 245
221 3300044694 Ga0466963_0127580 Ga0466963_0127580_799_1536 245
222 3300044842 Ga0466957_0366614 Ga0466957_0366614_28_765 245
223 3300046459 Ga0495629_0023077 Ga0495629_0023077_783_1523 245
224 3300046515 Ga0495620_0017441 Ga0495620_0017441_420_1160 245
225 3300046516 Ga0495628_0279990 Ga0495628_0279990_311_1048 245
226 3300046522 Ga0495643_0012560 Ga0495643_0012560_2675_3415 245
227 3300046529 Ga0495652_0345806 Ga0495652_0345806_183_920 245
228 3300046530 Ga0495654_0108784 Ga0495654_0108784_115_855 245
229 3300046538 Ga0495609_0021572 Ga0495609_0021572_1638_2378 245
230 3300046542 Ga0495597_0066316 Ga0495597_0066316_598_1338 245
231 3300046543 Ga0495645_0137534 Ga0495645_0137534_551_1288 245
232 3300046557 Ga0495622_0002431 Ga0495622_0002431_1056_1796 245
233 3300046648 Ga0495611_0174407 Ga0495611_0174407_25_768 245
234 3300046660 Ga0495625_0013206 Ga0495625_0013206_60_797 245
235 3300046660 Ga0495625_0362070 Ga0495625_0362070_50_787 245
236 3300046664 Ga0495659_0094634 Ga0495659_0094634_231_968 245
237 3300046684 Ga0495669_0000014 Ga0495669_0000014_48163_48903 245
238 3300046684 Ga0495669_0049989 Ga0495669_0049989_456_1253 245
239 3300046684 Ga0495669_0104098 Ga0495669_0104098_302_1039 245
240 3300046684 Ga0495669_0187022 Ga0495669_0187022_200_937 245
241 3300047320 Ga0495672_0012250 Ga0495672_0012250_2682_3419 245
242 3300047321 Ga0495676_0196091 Ga0495676_0196091_98_838 245
243 3300047445 Ga0495677_0056903 Ga0495677_0056903_366_1106 245
244 3300047472 Ga0495686_0145614 Ga0495686_0145614_225_965 245
245 3300048903 Ga0496100_0275441 Ga0496100_0275441_73_810 245
246 3300048904 Ga0496101_0076671 Ga0496101_0076671_997_1734 245
247 3300048905 Ga0496102_0117520 Ga0496102_0117520_311_1051 245
248 3300048911 Ga0496108_0285533 Ga0496108_0285533_512_1249 245
249 3300048915 Ga0496112_0062117 Ga0496112_0062117_1535_2272 245
250 3300048915 Ga0496112_0216389 Ga0496112_0216389_526_1263 245
251 3300048916 Ga0496113_0218409 Ga0496113_0218409_766_1503 245
252 3300048918 Ga0496115_0009445 Ga0496115_0009445_1909_2664 245
253 3300048919 Ga0496116_0040265 Ga0496116_0040265_1618_2358 245
254 3300048920 Ga0496117_0028390 Ga0496117_0028390_1390_2130 245
255 3300048921 Ga0496118_0008720 Ga0496118_0008720_7976_8716 245
256 3300048924 Ga0496121_0000035 Ga0496121_0000035_265303_266043 245
257 3300049581 Ga0501047_0031919 Ga0501047_0031919_2891_3634 245
258 3300049581 Ga0501047_0036031 Ga0501047_0036031_1214_1954 245
259 3300049582 Ga0501048_0325034 Ga0501048_0325034_205_951 245
260 3300049822 Ga0501035_0255456 Ga0501035_0255456_273_1019 245
261 3300049823 Ga0501044_0004301 Ga0501044_0004301_4233_4979 245
262 3300050491 nmdc:mga00v17_344_c1 nmdc:mga00v17_344_c1_233_973 245
263 3300050493 nmdc:mga0k408_92472_c1 nmdc:mga0k408_92472_c1_445_1185 245
264 3300050496 nmdc:mga07m45_9525_c1 nmdc:mga07m45_9525_c1_2919_3659 245
265 3300053080 Ga0500635_0000252 Ga0500635_0000252_8092_8832 245
266 3300053086 Ga0500578_0127870 Ga0500578_0127870_428_1168 245
267 3300053093 Ga0500651_0043998 Ga0500651_0043998_551_1291 245
268 3300053094 Ga0500566_0020274 Ga0500566_0020274_1870_2610 245
269 3300053096 Ga0500641_0040613 Ga0500641_0040613_882_1619 245
270 3300053103 Ga0500555_002779 Ga0500555_002779_2511_3251 245
271 3300053119 Ga0500595_006101 Ga0500595_006101_2992_3732 245
272 3300053119 Ga0500595_054424 Ga0500595_054424_246_986 245
273 3300053122 Ga0500608_003108 Ga0500608_003108_3788_4528 245
274 3300053123 Ga0500614_006259 Ga0500614_006259_1635_2375 245
275 3300053138 Ga0500564_092141 Ga0500564_092141_450_1190 245
276 3300053142 Ga0500577_0127275 Ga0500577_0127275_27_767 245
277 3300053177 Ga0500636_0025197 Ga0500636_0025197_2141_2881 245
278 3300053178 Ga0500637_0004227 Ga0500637_0004227_1984_2724 245
279 3300053725 Ga0500576_082305 Ga0500576_082305_272_1012 245
280 3300053735 Ga0500596_001539 Ga0500596_001539_3772_4512 245
281 3300030521 Ga0307511_10024927 Ga0307511_100249272 246
282 3300031251 Ga0265327_10000442 Ga0265327_100004428 246
283 3300046515 Ga0495620_0032641 Ga0495620_0032641_1317_2057 246
284 3300009174 Ga0105241_10253838 Ga0105241_102538382 247
285 3300009551 Ga0105238_10027177 Ga0105238_100271775 247
286 3300025911 Ga0207654_10183095 Ga0207654_101830952 247
287 3300025924 Ga0207694_10192461 Ga0207694_101924612 247
288 3300003215 JGI25153J46596_10028527 JGI25153J46596_100285272 250
289 3300003791 Ga0055530_10011201 Ga0055530_100112012 250
290 3300003794 Ga0055531_10003394 Ga0055531_100033945 250
291 3300005262 Ga0065165_1000896 Ga0065165_10008967 250
292 3300005262 Ga0065165_1021273 Ga0065165_10212731 250
293 3300025297 Ga0209758_1000936 Ga0209758_100093615 250
294 3300025298 Ga0209050_1000245 Ga0209050_100024589 250
295 3300025304 Ga0209257_1000995 Ga0209257_100099537 250
296 3300032005 Ga0307411_10187388 Ga0307411_101873882 250
297 3300047472 Ga0495686_0002903 Ga0495686_0002903_7091_7843 250
298 3300053730 Ga0500645_002274 Ga0500645_002274_720_1472 250

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01863

YgjP-like

YgjP-like, metallopeptidase domain

30

230

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cqb-assembly1.cif.gz_A crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 0.7846 143 211
4jiu-assembly1.cif.gz_A crystal structure of the metallopeptidase zymogen of pyrococcus abyssi abylysin 0.7826 145 241
3cqb-assembly1.cif.gz_B crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 0.7662 145 211
4qhj-assembly1.cif.gz_B crystal structure of methanocaldococcus jannaschii selecase mutant i100f+h107f 0.7628 139 240
4jix-assembly1.cif.gz_A crystal structure of the metallopeptidase zymogen of methanocaldococcus jannaschii jannalysin 0.7453 145 242
ID Description Score Start End Superfamily
af_P23894_64_157_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.8616 145 211 3.30.2010.10
af_P07604_370_445_1.10.8.60 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.8283 138 164 1.10.8.60
af_Q59076_58_147_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.7936 145 211 3.30.2010.10
af_P9WHS5_62_152_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.7931 145 211 3.30.2010.10
4jiuA00 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.7826 145 241 3.30.2010.10
ID Description Score Start End GO Terms
AF-A0A1E4GS57-F1-model_v4 Metal-dependent hydrolase 0.9496 38 250 GO:0016787
AF-A0A1E4GS57-F1-model_v4 Metal-dependent hydrolase 0.9453 38 250 GO:0016787
AF-A0A2W5QKJ9-F1-model_v4 deleted 0.9342 62 250
AF-A0A2W5QKJ9-F1-model_v4 deleted 0.9246 62 250
AF-A0A0N0JVT9-F1-model_v4 YgjP-like metallopeptidase domain-containing protein 0.9166 109 250

Feature Viewer

pLDDT pTM Quality
91.57 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map