F394010

General Info

Members Datasets Scaffolds Average Seq Length
298 222 586 235

Family's Representative Sequence

Representative Sequence 3300002067|JGI24735J21928_10015353|JGI24735J21928_100153532
Length 265
Sequence MHGVHRNHARKTSPWPGGFDDRLVETDESADMAADDQAMTFEESVQAAIELDAPLNERLAVIAAAVRRLNAEFADAVDRLVDRLEKQEAGAMAPARGDAMPGFMLPDDEGKLVGLADILAKGPAVITFQRGHWCPYCRLNAIGIVEAQQEIASLGGQVAVIMPERRKFAKAMKAAVGAEFPFLTDMDNGYALSLNLAIWIGAEMERLMGVAYDLPNYQGNASWFLPIPATFIVGTDGVISDRFVDPDYRRRMDIDDLIAALKRAR

Samples

Sample ID Description Type Environment
1 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
83 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
84 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
87 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
88 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
89 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
90 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
91 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
92 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
93 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
94 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
95 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
103 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
104 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
105 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
106 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
107 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
110 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
111 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
112 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
113 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
114 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
115 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
116 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
117 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
118 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
119 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
120 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
121 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
122 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
123 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
126 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
133 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
140 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
141 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
142 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
143 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
144 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
145 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
146 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
147 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
148 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
150 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
151 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
152 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
153 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
154 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
159 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
160 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
161 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
162 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
163 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
164 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
165 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
166 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
167 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
168 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
169 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
170 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
171 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
172 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
173 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
174 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
175 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
176 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
177 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
178 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
179 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
180 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
181 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
182 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
183 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
184 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
185 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
186 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
187 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
188 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
189 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
190 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
191 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
192 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
193 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
194 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
195 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
196 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
197 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
198 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
199 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
200 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
201 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
202 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
203 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
204 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
205 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
206 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
207 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
208 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
209 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
210 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
211 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
212 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
213 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
214 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
215 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
216 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
217 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
218 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
219 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
220 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
221 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
222 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 81.21
Metatranscriptomes 0
Isolates 18.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.74
Nodule 14.09
Rhizoplane 6.71
Rhizosphere 62.42
Stem 0
Stem Tuber 0
Unclassified 6.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10015353 3300002067 Bacteria 2390
2 JGI25406J46586_10005452 3300003203 Bacteria 5899
3 JGI25153J46596_10012484 3300003215 Bacteria 3661
4 Ga0070670_100151214 3300005331 Bacteria 2009
5 Ga0070670_100780099 3300005331 Bacteria 862
6 Ga0070666_10236205 3300005335 Bacteria 1292
7 Ga0070680_100021425 3300005336 Bacteria 5138
8 Ga0070682_100018356 3300005337 Bacteria 4088
9 Ga0070660_100112671 3300005339 Bacteria 2166
10 Ga0070674_100501447 3300005356 Bacteria 1011
11 Ga0070709_10030410 3300005434 Bacteria 3241
12 Ga0070709_10346039 3300005434 Bacteria 1097
13 Ga0070714_100486799 3300005435 Bacteria 1175
14 Ga0070708_100693921 3300005445 Bacteria 958
15 Ga0070681_10016111 3300005458 Bacteria 7451
16 Ga0070679_100004347 3300005530 Bacteria 13087
17 Ga0068853_100161367 3300005539 Bacteria 2023
18 Ga0068853_100450918 3300005539 Bacteria 1210
19 Ga0070665_100648692 3300005548 Bacteria 1069
20 Ga0068855_100355238 3300005563 Bacteria 1614
21 Ga0068857_100264433 3300005577 Bacteria 1580
22 Ga0068854_100028719 3300005578 Bacteria 3846
23 Ga0068856_100647026 3300005614 Bacteria 1078
24 Ga0068852_100244339 3300005616 Bacteria 1717
25 Ga0068861_100000266 3300005719 Bacteria 29184
26 Ga0068863_100122123 3300005841 Bacteria 2484
27 Ga0068860_100000360 3300005843 Bacteria 60297
28 Ga0068862_100475396 3300005844 Bacteria 1182
29 Ga0081455_10083173 3300005937 Bacteria 2616
30 Ga0081455_10138264 3300005937 Bacteria 1895
31 Ga0081455_10232818 3300005937 Bacteria 1358
32 Ga0081538_10117029 3300005981 Bacteria 1291
33 Ga0081540_1002933 3300005983 Bacteria 13726
34 Ga0081540_1012903 3300005983 Bacteria 5463
35 Ga0081540_1049446 3300005983 Bacteria 2097
36 Ga0081539_10000921 3300005985 Bacteria 55381
37 Ga0070717_10071498 3300006028 Bacteria 2894
38 Ga0075365_10026151 3300006038 Bacteria 3702
39 Ga0075363_100027456 3300006048 Bacteria 2919
40 Ga0075363_100061520 3300006048 Bacteria 2024
41 Ga0075363_100106751 3300006048 Bacteria 1553
42 Ga0075364_10014434 3300006051 Bacteria 4881
43 Ga0075364_10144719 3300006051 Bacteria 1600
44 Ga0070716_100042863 3300006173 Bacteria 2528
45 Ga0075362_10044777 3300006177 Bacteria 1964
46 Ga0075367_10024561 3300006178 Bacteria 3400
47 Ga0075367_10102334 3300006178 Bacteria 1752
48 Ga0075367_10242732 3300006178 Bacteria 1129
49 Ga0097621_100310298 3300006237 Bacteria 1395
50 Ga0068871_100091993 3300006358 Unclassified 2529
51 Ga0075433_10146805 3300006852 Bacteria 2097
52 Ga0075433_10300527 3300006852 Bacteria 1421
53 Ga0099795_10000141 3300007788 Bacteria 11961
54 Ga0099795_10006562 3300007788 Bacteria 3184
55 Ga0099795_10037076 3300007788 Bacteria 1714
56 Ga0105240_10065042 3300009093 Bacteria 4528
57 Ga0105240_10126237 3300009093 Bacteria 3074
58 Ga0105240_10248538 3300009093 Bacteria 2058
59 Ga0111539_11487268 3300009094 Bacteria 785
60 Ga0105245_10389210 3300009098 Bacteria 1390
61 Ga0114129_10177509 3300009147 Bacteria 2900
62 Ga0114129_10585246 3300009147 Bacteria 1448
63 Ga0105241_10020881 3300009174 Bacteria 4842
64 Ga0105241_10324846 3300009174 Bacteria 1328
65 Ga0105242_10451193 3300009176 Bacteria 1212
66 Ga0105237_10040170 3300009545 Bacteria 4719
67 Ga0105238_10074432 3300009551 Bacteria 3388
68 Ga0105238_10081203 3300009551 Bacteria 3231
69 Ga0105238_10098744 3300009551 Bacteria 2904
70 Ga0099796_10000358 3300010159 Bacteria 7431
71 Ga0099796_10000431 3300010159 Bacteria 6967
72 Ga0099796_10010195 3300010159 Bacteria 2575
73 Ga0105239_10040652 3300010375 Bacteria 5095
74 Ga0105239_10062322 3300010375 Bacteria 4093
75 Ga0105239_10213477 3300010375 Bacteria 2163
76 Ga0105246_10522925 3300011119 Unclassified 1012
77 Ga0105246_10715933 3300011119 Bacteria 879
78 Ga0163163_10337051 3300014325 Unclassified 1563
79 Ga0157380_10000057 3300014326 Bacteria 63054
80 Ga0157379_10241845 3300014968 Bacteria 1637
81 Ga0157376_10044821 3300014969 Unclassified 3638
82 Ga0209758_1004588 3300025297 Bacteria 11382
83 Ga0207680_10375465 3300025903 Bacteria 1002
84 Ga0207647_10026011 3300025904 Bacteria 3834
85 Ga0207707_10000962 3300025912 Bacteria 27734
86 Ga0207695_10062324 3300025913 Bacteria 3850
87 Ga0207695_10162326 3300025913 Bacteria 2165
88 Ga0207671_10196077 3300025914 Bacteria 1576
89 Ga0207660_10033648 3300025917 Bacteria 3548
90 Ga0207652_10060923 3300025921 Bacteria 3258
91 Ga0207694_10293101 3300025924 Bacteria 1338
92 Ga0207700_10515597 3300025928 Unclassified 1059
93 Ga0207664_10350426 3300025929 Bacteria 1307
94 Ga0207667_10545416 3300025949 Bacteria 1173
95 Ga0207640_10091931 3300025981 Bacteria 2103
96 Ga0207658_10028422 3300025986 Bacteria 3937
97 Ga0207677_10035777 3300026023 Bacteria 3228
98 Ga0207639_10250483 3300026041 Bacteria 1544
99 Ga0207678_10791692 3300026067 Bacteria 837
100 Ga0207702_10663716 3300026078 Bacteria 1026
101 Ga0207641_10121783 3300026088 Bacteria 2329
102 Ga0207674_10285778 3300026116 Bacteria 1598
103 Ga0207675_100000937 3300026118 Bacteria 29142
104 Ga0207683_10419181 3300026121 Bacteria 1233
105 Ga0209179_1004060 3300027512 Bacteria 2176
106 Ga0207428_10000948 3300027907 Bacteria 32273
107 Ga0268266_10124423 3300028379 Bacteria 2299
108 Ga0268266_10680331 3300028379 Bacteria 991
109 Ga0268264_10000030 3300028381 Bacteria 418542
110 Ga0307509_10114004 3300031507 Bacteria 2699
111 Ga0307508_10256044 3300031616 Bacteria 1346
112 Ga0326468_10008044 3300031889 Bacteria 1013
113 Ga0307416_100064476 3300032002 Bacteria 3006
114 Ga0373932_0047893 3300035112 Bacteria 1258
115 Ga0373953_0003520 3300035117 Bacteria 4890
116 Ga0373954_0179206 3300035118 Unclassified 1039
117 Ga0373954_0193820 3300035118 Bacteria 998
118 Ga0373960_0017175 3300035121 Bacteria 1872
119 Ga0373943_0065027 3300035170 Bacteria 1833
120 Ga0373943_0080701 3300035170 Bacteria 1668
121 Ga0373943_0189248 3300035170 Bacteria 1135
122 Ga0373955_0006374 3300035172 Bacteria 5377
123 Ga0373955_0223015 3300035172 Bacteria 1126
124 Ga0373931_0005935 3300035691 Bacteria 5679
125 Ga0373935_0025457 3300035692 Bacteria 3646
126 Ga0373935_0038814 3300035692 Bacteria 2983
127 Ga0373935_0139083 3300035692 Bacteria 1639
128 Ga0373933_0041982 3300035724 Bacteria 2702
129 Ga0373937_0010618 3300036401 Bacteria 8047
130 Ga0373925_0158541 3300037068 Bacteria 1781
131 Ga0395899_0109722 3300037312 Bacteria 1985
132 Ga0395900_0028340 3300037418 Bacteria 5735
133 Ga0395900_0090884 3300037418 Bacteria 3138
134 Ga0395900_0556622 3300037418 Unclassified 1091
135 Ga0395898_0123067 3300037466 Bacteria 2485
136 Ga0395905_0002795 3300037471 Bacteria 19112
137 Ga0395905_0100456 3300037471 Bacteria 2717
138 Ga0395901_0024199 3300038443 Bacteria 6231
139 Ga0395901_0209984 3300038443 Unclassified 2038
140 Ga0395901_0321184 3300038443 Bacteria 1602
141 Ga0436365_0737080 3300039437 Bacteria 938
142 Ga0436363_1231414 3300039450 Unclassified 1363
143 Ga0436362_0034924 3300039453 Bacteria 1420
144 Ga0439458_0005923 3300042157 Bacteria 2739
145 Ga0439435_0029134 3300042436 Archaea 1488
146 Ga0466964_0040739 3300044706 Bacteria 1877
147 Ga0466967_0387541 3300045976 Bacteria 1358
148 Ga0495617_007371 3300046452 Bacteria 3817
149 Ga0495638_0187161 3300046460 Bacteria 1177
150 Ga0495650_0030318 3300046471 Bacteria 2452
151 Ga0495584_0092242 3300046491 Unclassified 1528
152 Ga0495584_0139739 3300046491 Bacteria 1230
153 Ga0495594_0244262 3300046499 Bacteria 1023
154 Ga0495630_0188810 3300046517 Bacteria 1572
155 Ga0495622_0048993 3300046557 Bacteria 1961
156 Ga0495625_0021472 3300046660 Bacteria 4972
157 Ga0495588_0312487 3300046674 Bacteria 827
158 Ga0495599_0223950 3300046678 Unclassified 1150
159 Ga0495589_0014275 3300046794 Bacteria 4093
160 Ga0495684_0312232 3300047471 Bacteria 1126
161 Ga0496100_0441980 3300048903 Bacteria 996
162 Ga0496101_0134708 3300048904 Bacteria 1879
163 Ga0496101_0218821 3300048904 Unclassified 1477
164 Ga0496102_0052552 3300048905 Bacteria 3713
165 Ga0496102_0379122 3300048905 Unclassified 1331
166 Ga0496102_0397658 3300048905 Bacteria 1296
167 Ga0496104_0118565 3300048907 Bacteria 2541
168 Ga0496104_0339658 3300048907 Bacteria 1415
169 Ga0496104_0383137 3300048907 Bacteria 1319
170 Ga0496106_0364307 3300048909 Bacteria 1161
171 Ga0496107_0062312 3300048910 Bacteria 2702
172 Ga0496107_0111814 3300048910 Unclassified 2008
173 Ga0496107_0133424 3300048910 Bacteria 1834
174 Ga0496110_0905196 3300048913 Bacteria 788
175 Ga0496111_0136317 3300048914 Bacteria 1818
176 Ga0496112_0000018 3300048915 Bacteria 188820
177 Ga0496112_0240099 3300048915 Bacteria 1765
178 Ga0496113_0684358 3300048916 Bacteria 819
179 Ga0496114_0244897 3300048917 Bacteria 1577
180 Ga0496124_0547829 3300048927 Bacteria 764
181 Ga0501036_0054463 3300049572 Bacteria 3389
182 Ga0501038_0401299 3300049574 Unclassified 1061
183 Ga0501039_0053645 3300049575 Bacteria 3120
184 Ga0501039_0059916 3300049575 Bacteria 2948
185 Ga0501039_0601328 3300049575 Bacteria 862
186 Ga0501040_0071609 3300049576 Bacteria 2393
187 Ga0501040_0244561 3300049576 Unclassified 1279
188 Ga0501041_0036670 3300049577 Bacteria 2970
189 Ga0501041_0102988 3300049577 Unclassified 1768
190 Ga0501048_0014269 3300049582 Bacteria 5885
191 Ga0501068_0236906 3300049584 Unclassified 1161
192 Ga0501071_0370043 3300049587 Bacteria 1092
193 Ga0501072_0008064 3300049588 Bacteria 7995
194 Ga0501074_0086640 3300049590 Bacteria 2244
195 Ga0501075_0058099 3300049591 Bacteria 2913
196 Ga0501075_0067272 3300049591 Bacteria 2705
197 Ga0501075_0087687 3300049591 Bacteria 2359
198 Ga0501076_0006963 3300049592 Bacteria 8217
199 Ga0501076_0079036 3300049592 Bacteria 2640
200 Ga0501077_0011826 3300049593 Bacteria 5458
201 Ga0501077_0019165 3300049593 Bacteria 4327
202 Ga0501079_0009723 3300049741 Bacteria 7291
203 Ga0501079_0076482 3300049741 Bacteria 2589
204 Ga0501081_0004069 3300049743 Bacteria 9369
205 Ga0501044_0533113 3300049823 Bacteria 1073
206 Ga0501045_0048597 3300049824 Bacteria 3092
207 nmdc:mga03683_58507_c1 3300050489 Bacteria 1624
208 nmdc:mga03n38_25681_c1 3300050490 Bacteria 2423
209 nmdc:mga03n38_32034_c1 3300050490 Bacteria 2223
210 nmdc:mga03n38_34401_c1 3300050490 Bacteria 2164
211 nmdc:mga00v17_42665_c1 3300050491 Bacteria 2729
212 nmdc:mga0yw44_54035_c1 3300050492 Bacteria 2440
213 nmdc:mga06z11_173997_c1 3300050494 Bacteria 1238
214 nmdc:mga06z11_213611_c1 3300050494 Bacteria 1125
215 nmdc:mga06z11_83707_c1 3300050494 Bacteria 1717
216 nmdc:mga05p37_271256_c1 3300050507 Bacteria 934
217 nmdc:mga05p37_518987_c1 3300050507 Bacteria 1363
218 nmdc:mga06r32_163519_c1 3300050510 Bacteria 2208
219 nmdc:mga08y16_79307_c1 3300050511 Bacteria 3422
220 nmdc:mga08y16_911204_c1 3300050511 Bacteria 865
221 Ga0495601_0089660 3300053077 Bacteria 1978
222 Ga0500597_142689 3300053120 Bacteria 1031
223 Ga0500607_018372 3300053121 Bacteria 3971
224 Ga0500604_0006526 3300053151 Bacteria 3085
225 Ga0500604_0057389 3300053151 Bacteria 1215
226 Ga0500620_000219 3300053155 Bacteria 11314
227 Ga0500627_0001011 3300053158 Bacteria 7665
228 Ga0500611_024392 3300053727 Bacteria 1187
229 Ga0501084_0006882 3300054114 Bacteria 9359
230 Ga0501084_0024162 3300054114 Bacteria 5069
231 Ga0501084_0789755 3300054114 Bacteria 800
232 Ga0501082_0017449 3300060353 Bacteria 6184
233 Ga0501082_0022777 3300060353 Bacteria 5395
234 Ga0501082_0199044 3300060353 Bacteria 1743
235 Ga0501082_0851906 3300060353 Bacteria 797
236 Ga0530510_0040680 3300061734 Bacteria 3355
237 Ga0530510_0085345 3300061734 Bacteria 2300
238 2513614090 2513237090 Bacteria 7096802
239 2514421689 2513237305 Bacteria 7293571
240 2599940689 2599185301 Bacteria 6161860
241 2643987634 2643221595 Bacteria 6565519
242 2644157844 2643221627 Bacteria 6761570
243 2723578149 2721755686 Bacteria 7343952
244 2792745443 2791355123 Bacteria 8049106
245 2856315092 2856314179 Bacteria 6477897
246 2856344847 2856342000 Bacteria 7176905
247 2856355234 2856349417 Bacteria 6230045
248 2871496329 2871495908 Bacteria 6935695
249 2874124409 2874123672 Bacteria 7238285
250 2874124530 2874123672 Bacteria 7238285
251 2876374842 2876369609 Bacteria 6807521
252 2878042050 2878035449 Bacteria 6555736
253 2878760558 2878760144 Bacteria 6823465
254 2878767521 2878767105 Bacteria 6898628
255 2881150971 2881147464 Bacteria 7779814
256 2881158515 2881155292 Bacteria 6461656
257 2881166672 2881161766 Bacteria 7127907
258 2881855401 2881853255 Bacteria 6698367
259 2885318689 2885312484 Bacteria 6415165
260 2885341515 2885334103 Bacteria 7216818
261 2885346488 2885342637 Bacteria 7011821
262 2885354516 2885350715 Bacteria 6787678
263 2888353001 2888350351 Bacteria 7372807
264 2889020172 2889016732 Bacteria 6700763
265 2903541123 2903540706 Bacteria 7062119
266 2906415089 2906414383 Bacteria 6580790
267 2922194170 2922185730 Bacteria 7113964
268 2924767145 2924762789 Bacteria 6561353
269 2937824203 2937822353 Bacteria 7290551
270 2937851184 2937848649 Bacteria 6983481
271 2937994976 2937994558 Bacteria 7036190
272 2958101005 2958100919 Bacteria 6800575
273 2958165456 2958165035 Bacteria 6906348
274 2958174965 2958172287 Bacteria 6716688
275 2961136233 2961127735 Bacteria 7196641
276 2961163914 2961163497 Bacteria 6901077
277 2965018719 2965018300 Bacteria 6883036
278 2965120483 2965119406 Bacteria 6956431
279 2968172320 2968171901 Bacteria 6894245
280 2970527751 2970524798 Bacteria 6840927
281 2970555410 2970554993 Bacteria 6814252
282 2977870941 2977864932 Bacteria 7534097
283 2977923520 2977922695 Bacteria 6956781
284 2977993173 2977986579 Bacteria 6581278
285 2979714540 2979710463 Bacteria 6785254
286 2979751666 2979742915 Bacteria 7301278
287 2987659926 2987659509 Bacteria 6966464
288 2987671110 2987666974 Bacteria 6509233
289 3000140852 3000135777 Bacteria 6891109
290 3004188973 3004188549 Bacteria 6952365
291 3004212853 3004211236 Bacteria 7417683
292 3004223061 3004218560 Bacteria 7421728
293 8006991468 8006984368 Bacteria 9651211
294 JGI24735J21928_10015353
295 JGI25406J46586_10005452
296 JGI25153J46596_10012484
297 Ga0070670_100151214
298 Ga0070670_100780099
299 Ga0070666_10236205
300 Ga0070680_100021425
301 Ga0070682_100018356
302 Ga0070660_100112671
303 Ga0070674_100501447
304 Ga0070709_10030410
305 Ga0070709_10346039
306 Ga0070714_100486799
307 Ga0070708_100693921
308 Ga0070681_10016111
309 Ga0070679_100004347
310 Ga0068853_100161367
311 Ga0068853_100450918
312 Ga0070665_100648692
313 Ga0068855_100355238
314 Ga0068857_100264433
315 Ga0068854_100028719
316 Ga0068856_100647026
317 Ga0068852_100244339
318 Ga0068861_100000266
319 Ga0068863_100122123
320 Ga0068860_100000360
321 Ga0068862_100475396
322 Ga0081455_10083173
323 Ga0081455_10138264
324 Ga0081455_10232818
325 Ga0081538_10117029
326 Ga0081540_1002933
327 Ga0081540_1012903
328 Ga0081540_1049446
329 Ga0081539_10000921
330 Ga0070717_10071498
331 Ga0075365_10026151
332 Ga0075363_100027456
333 Ga0075363_100061520
334 Ga0075363_100106751
335 Ga0075364_10014434
336 Ga0075364_10144719
337 Ga0070716_100042863
338 Ga0075362_10044777
339 Ga0075367_10024561
340 Ga0075367_10102334
341 Ga0075367_10242732
342 Ga0097621_100310298
343 Ga0068871_100091993
344 Ga0075433_10146805
345 Ga0075433_10300527
346 Ga0099795_10000141
347 Ga0099795_10006562
348 Ga0099795_10037076
349 Ga0105240_10065042
350 Ga0105240_10126237
351 Ga0105240_10248538
352 Ga0111539_11487268
353 Ga0105245_10389210
354 Ga0114129_10177509
355 Ga0114129_10585246
356 Ga0105241_10020881
357 Ga0105241_10324846
358 Ga0105242_10451193
359 Ga0105237_10040170
360 Ga0105238_10074432
361 Ga0105238_10081203
362 Ga0105238_10098744
363 Ga0099796_10000358
364 Ga0099796_10000431
365 Ga0099796_10010195
366 Ga0105239_10040652
367 Ga0105239_10062322
368 Ga0105239_10213477
369 Ga0105246_10522925
370 Ga0105246_10715933
371 Ga0163163_10337051
372 Ga0157380_10000057
373 Ga0157379_10241845
374 Ga0157376_10044821
375 Ga0209758_1004588
376 Ga0207680_10375465
377 Ga0207647_10026011
378 Ga0207707_10000962
379 Ga0207695_10062324
380 Ga0207695_10162326
381 Ga0207671_10196077
382 Ga0207660_10033648
383 Ga0207652_10060923
384 Ga0207694_10293101
385 Ga0207700_10515597
386 Ga0207664_10350426
387 Ga0207667_10545416
388 Ga0207640_10091931
389 Ga0207658_10028422
390 Ga0207677_10035777
391 Ga0207639_10250483
392 Ga0207678_10791692
393 Ga0207702_10663716
394 Ga0207641_10121783
395 Ga0207674_10285778
396 Ga0207675_100000937
397 Ga0207683_10419181
398 Ga0209179_1004060
399 Ga0207428_10000948
400 Ga0268266_10124423
401 Ga0268266_10680331
402 Ga0268264_10000030
403 Ga0307509_10114004
404 Ga0307508_10256044
405 Ga0326468_10008044
406 Ga0307416_100064476
407 Ga0373932_0047893
408 Ga0373953_0003520
409 Ga0373954_0179206
410 Ga0373954_0193820
411 Ga0373960_0017175
412 Ga0373943_0065027
413 Ga0373943_0080701
414 Ga0373943_0189248
415 Ga0373955_0006374
416 Ga0373955_0223015
417 Ga0373931_0005935
418 Ga0373935_0025457
419 Ga0373935_0038814
420 Ga0373935_0139083
421 Ga0373933_0041982
422 Ga0373937_0010618
423 Ga0373925_0158541
424 Ga0395899_0109722
425 Ga0395900_0028340
426 Ga0395900_0090884
427 Ga0395900_0556622
428 Ga0395898_0123067
429 Ga0395905_0002795
430 Ga0395905_0100456
431 Ga0395901_0024199
432 Ga0395901_0209984
433 Ga0395901_0321184
434 Ga0436365_0737080
435 Ga0436363_1231414
436 Ga0436362_0034924
437 Ga0439458_0005923
438 Ga0439435_0029134
439 Ga0466964_0040739
440 Ga0466967_0387541
441 Ga0495617_007371
442 Ga0495638_0187161
443 Ga0495650_0030318
444 Ga0495584_0092242
445 Ga0495584_0139739
446 Ga0495594_0244262
447 Ga0495630_0188810
448 Ga0495622_0048993
449 Ga0495625_0021472
450 Ga0495588_0312487
451 Ga0495599_0223950
452 Ga0495589_0014275
453 Ga0495684_0312232
454 Ga0496100_0441980
455 Ga0496101_0134708
456 Ga0496101_0218821
457 Ga0496102_0052552
458 Ga0496102_0379122
459 Ga0496102_0397658
460 Ga0496104_0118565
461 Ga0496104_0339658
462 Ga0496104_0383137
463 Ga0496106_0364307
464 Ga0496107_0062312
465 Ga0496107_0111814
466 Ga0496107_0133424
467 Ga0496110_0905196
468 Ga0496111_0136317
469 Ga0496112_0000018
470 Ga0496112_0240099
471 Ga0496113_0684358
472 Ga0496114_0244897
473 Ga0496124_0547829
474 Ga0501036_0054463
475 Ga0501038_0401299
476 Ga0501039_0053645
477 Ga0501039_0059916
478 Ga0501039_0601328
479 Ga0501040_0071609
480 Ga0501040_0244561
481 Ga0501041_0036670
482 Ga0501041_0102988
483 Ga0501048_0014269
484 Ga0501068_0236906
485 Ga0501071_0370043
486 Ga0501072_0008064
487 Ga0501074_0086640
488 Ga0501075_0058099
489 Ga0501075_0067272
490 Ga0501075_0087687
491 Ga0501076_0006963
492 Ga0501076_0079036
493 Ga0501077_0011826
494 Ga0501077_0019165
495 Ga0501079_0009723
496 Ga0501079_0076482
497 Ga0501081_0004069
498 Ga0501044_0533113
499 Ga0501045_0048597
500 nmdc:mga03683_58507_c1
501 nmdc:mga03n38_25681_c1
502 nmdc:mga03n38_32034_c1
503 nmdc:mga03n38_34401_c1
504 nmdc:mga00v17_42665_c1
505 nmdc:mga0yw44_54035_c1
506 nmdc:mga06z11_173997_c1
507 nmdc:mga06z11_213611_c1
508 nmdc:mga06z11_83707_c1
509 nmdc:mga05p37_271256_c1
510 nmdc:mga05p37_518987_c1
511 nmdc:mga06r32_163519_c1
512 nmdc:mga08y16_79307_c1
513 nmdc:mga08y16_911204_c1
514 Ga0495601_0089660
515 Ga0500597_142689
516 Ga0500607_018372
517 Ga0500604_0006526
518 Ga0500604_0057389
519 Ga0500620_000219
520 Ga0500627_0001011
521 Ga0500611_024392
522 Ga0501084_0006882
523 Ga0501084_0024162
524 Ga0501084_0789755
525 Ga0501082_0017449
526 Ga0501082_0022777
527 Ga0501082_0199044
528 Ga0501082_0851906
529 Ga0530510_0040680
530 Ga0530510_0085345
531 2513614090
532 2514421689
533 2599940689
534 2643987634
535 2644157844
536 2723578149
537 2792745443
538 2856315092
539 2856344847
540 2856355234
541 2871496329
542 2874124409
543 2874124530
544 2876374842
545 2878042050
546 2878760558
547 2878767521
548 2881150971
549 2881158515
550 2881166672
551 2881855401
552 2885318689
553 2885341515
554 2885346488
555 2885354516
556 2888353001
557 2889020172
558 2903541123
559 2906415089
560 2922194170
561 2924767145
562 2937824203
563 2937851184
564 2937994976
565 2958101005
566 2958165456
567 2958174965
568 2961136233
569 2961163914
570 2965018719
571 2965120483
572 2968172320
573 2970527751
574 2970555410
575 2977870941
576 2977923520
577 2977993173
578 2979714540
579 2979751666
580 2987659926
581 2987671110
582 3000140852
583 3004188973
584 3004212853
585 3004223061
586 8006991468

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

96

242

0.91

PF08534

Redoxin

Redoxin

95

261

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cx4-assembly4.cif.gz_H crystal structure of a bacterioferritin comigratory protein peroxiredoxin from the aeropyrum pernix k1 (form-2 crystal) 0.9104 96 264
5epf-assembly1.cif.gz_A crystal structure of peroxidoxin bcpb from mycobacterium tuberculosis 0.8772 94 265
5enu-assembly2.cif.gz_B crystal structure of an alkyl hyroperoxide reductase from burkholderia ambifaria 0.8695 92 263
2ywn-assembly1.cif.gz_A crystal structure of peroxiredoxin-like protein from sulfolobus tokodaii 0.8627 94 265
2cx4-assembly4.cif.gz_H crystal structure of a bacterioferritin comigratory protein peroxiredoxin from the aeropyrum pernix k1 (form-2 crystal) 0.8625 96 264
ID Description Score Start End Superfamily
2cx4E00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8931 97 264 3.40.30.10
af_Q55E48_3_135_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.88 94 243 3.40.30.10
af_P0AE52_4_156_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8776 95 265 3.40.30.10
5epfA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.877 94 265 3.40.30.10
5id2B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8679 92 264 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A529U707-F1-model_v4 Redoxin domain-containing protein 0.9961 133 265 GO:0016491
AF-A0A531LNA8-F1-model_v4 AhpC/TSA family protein 0.9902 158 265
AF-A0A529U707-F1-model_v4 Redoxin domain-containing protein 0.9887 133 265 GO:0016491
AF-A0A531LNA8-F1-model_v4 AhpC/TSA family protein 0.9812 158 265
AF-A0A252DWE0-F1-model_v4 deleted 0.9698 77 262

Map