F393974

General Info

Members Datasets Scaffolds Average Seq Length
297 155 594 266

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221620|2644117309
Length 259
Sequence VVAHRGASHEIAEHTLGAYITALDSGAGGLECDVRLTADGHLVCVHDRDLRRTAATKGLVSTMDLADLSDLDFASWKNPWSDLDDEADDDDERGVLTLRKLLETVADYDRRVEMAIETKHPTRYGGLVEKRLVEMLRDFGWDRADAPVRIMSFSFTALQRVERLAPEVQLVQLFDKPNHWPMLRRVVGRDWIMGPGIKMLRQHPRLRDSLARSGRDVHVWTVNKEKDLDLCLDLGVKAVISDKPRFMLDLLDTRFGASE

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
79 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
82 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
83 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
86 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
87 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
88 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
89 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
90 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
91 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
92 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
93 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
94 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
95 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
96 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
99 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
100 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
101 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
102 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
103 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
104 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
105 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
106 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
107 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
108 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
109 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
110 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
111 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
112 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
113 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
119 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
120 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
121 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
122 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
123 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
124 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
125 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
126 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
127 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
128 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
129 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
133 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
134 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
135 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
136 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
137 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
138 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
139 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
140 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
141 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
142 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
143 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
144 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
145 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
146 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
147 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
148 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
149 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
150 2643221620 Nocardioides sp. Root240 Isolate Unclassified
151 2643221590 Nocardioides sp. Root682 Isolate Unclassified
152 2643221604 Nocardioides sp. Root190 Isolate Unclassified
153 2643221617 Nocardioides sp. Root79 Isolate Unclassified
154 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
155 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.64
Metatranscriptomes 0.34
Isolates 2.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.95
Nodule 0
Rhizoplane 15.15
Rhizosphere 53.87
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100001276 3300005329 Bacteria 19154
2 Ga0070690_100114953 3300005330 Bacteria 1800
3 Ga0070680_100212793 3300005336 Bacteria 1631
4 Ga0070682_100029170 3300005337 Bacteria 3321
5 Ga0070682_100198056 3300005337 Bacteria 1415
6 Ga0070660_100012734 3300005339 Bacteria 6013
7 Ga0070660_100195860 3300005339 Bacteria 1638
8 Ga0070692_10132744 3300005345 Bacteria 1401
9 Ga0070674_100408786 3300005356 Bacteria 1111
10 Ga0070659_100030316 3300005366 Bacteria 4186
11 Ga0070659_100083250 3300005366 Bacteria 2557
12 Ga0070667_100042271 3300005367 Bacteria 3824
13 Ga0070667_100134237 3300005367 Bacteria 2163
14 Ga0070701_10260386 3300005438 Bacteria 1051
15 Ga0070700_100285600 3300005441 Bacteria 1198
16 Ga0070708_100073124 3300005445 Bacteria 3089
17 Ga0070678_100245397 3300005456 Bacteria 1499
18 Ga0070685_10306415 3300005466 Bacteria 1072
19 Ga0070698_100001974 3300005471 Bacteria 22807
20 Ga0070684_100005763 3300005535 Bacteria 9523
21 Ga0070684_100374988 3300005535 Bacteria 1310
22 Ga0068855_100249175 3300005563 Bacteria 1981
23 Ga0068857_100018392 3300005577 Bacteria 6131
24 Ga0068856_100245673 3300005614 Bacteria 1805
25 Ga0068864_100093321 3300005618 Bacteria 2659
26 Ga0068866_10160237 3300005718 Bacteria 1311
27 Ga0068863_100210603 3300005841 Bacteria 1872
28 Ga0068860_100000253 3300005843 Bacteria 79802
29 Ga0081539_10019244 3300005985 Bacteria 4683
30 Ga0075365_10013646 3300006038 Bacteria 4870
31 Ga0075365_10023299 3300006038 Bacteria 3892
32 Ga0075365_10025237 3300006038 Bacteria 3761
33 Ga0075365_10070222 3300006038 Bacteria 2355
34 Ga0075365_10084778 3300006038 Bacteria 2151
35 Ga0075365_10158650 3300006038 Bacteria 1575
36 Ga0075365_10172938 3300006038 Bacteria 1508
37 Ga0075365_10182276 3300006038 Bacteria 1468
38 Ga0075365_10194469 3300006038 Bacteria 1420
39 Ga0075365_10272033 3300006038 Bacteria 1191
40 Ga0075368_10000781 3300006042 Bacteria 9792
41 Ga0075368_10006525 3300006042 Bacteria 4080
42 Ga0075368_10015185 3300006042 Bacteria 2852
43 Ga0075368_10024821 3300006042 Bacteria 2298
44 Ga0075363_100000278 3300006048 Bacteria 14859
45 Ga0075363_100015208 3300006048 Bacteria 3778
46 Ga0075363_100016718 3300006048 Bacteria 3628
47 Ga0075363_100031772 3300006048 Bacteria 2739
48 Ga0075363_100191101 3300006048 Bacteria 1168
49 Ga0075364_10001677 3300006051 Bacteria 12163
50 Ga0075364_10010628 3300006051 Bacteria 5568
51 Ga0075364_10018525 3300006051 Bacteria 4359
52 Ga0075364_10030035 3300006051 Bacteria 3487
53 Ga0075364_10052161 3300006051 Bacteria 2672
54 Ga0075364_10068563 3300006051 Bacteria 2333
55 Ga0075364_10107245 3300006051 Bacteria 1862
56 Ga0075364_10175653 3300006051 Bacteria 1448
57 Ga0075364_10192183 3300006051 Bacteria 1382
58 Ga0075362_10002233 3300006177 Bacteria 6442
59 Ga0075362_10172452 3300006177 Bacteria 1046
60 Ga0075367_10009615 3300006178 Bacteria 5060
61 Ga0075367_10013584 3300006178 Bacteria 4383
62 Ga0075367_10034346 3300006178 Bacteria 2929
63 Ga0075367_10042438 3300006178 Bacteria 2661
64 Ga0075367_10058899 3300006178 Bacteria 2286
65 Ga0075367_10219836 3300006178 Bacteria 1189
66 Ga0075370_10005130 3300006353 Bacteria 6461
67 Ga0075370_10023357 3300006353 Bacteria 3405
68 Ga0075370_10023553 3300006353 Bacteria 3392
69 Ga0075370_10049517 3300006353 Bacteria 2382
70 Ga0068865_100122240 3300006881 Bacteria 1938
71 Ga0111539_10414969 3300009094 Bacteria 1568
72 Ga0111539_10643882 3300009094 Bacteria 1234
73 Ga0105245_10006300 3300009098 Bacteria 10445
74 Ga0105243_10039696 3300009148 Bacteria 3671
75 Ga0105243_10114427 3300009148 Bacteria 2264
76 Ga0105243_10190519 3300009148 Bacteria 1791
77 Ga0105248_10216657 3300009177 Bacteria 2156
78 Ga0105248_10864097 3300009177 Bacteria 1021
79 Ga0105237_10152779 3300009545 Bacteria 2305
80 Ga0105238_10125727 3300009551 Bacteria 2543
81 Ga0105249_10050347 3300009553 Bacteria 3798
82 Ga0105249_10532806 3300009553 Bacteria 1223
83 Ga0105239_10004204 3300010375 Bacteria 17287
84 Ga0105246_10077058 3300011119 Bacteria 2364
85 Ga0157369_10070233 3300013105 Bacteria 3763
86 Ga0157369_10563948 3300013105 Bacteria 1176
87 Ga0163162_10087613 3300013306 Bacteria 3192
88 Ga0163162_10307726 3300013306 Bacteria 1717
89 Ga0157372_10002605 3300013307 Bacteria 19511
90 Ga0157372_10183129 3300013307 Bacteria 2425
91 Ga0157372_10445815 3300013307 Bacteria 1509
92 Ga0157372_10453618 3300013307 Bacteria 1494
93 Ga0157375_10088946 3300013308 Bacteria 3144
94 Ga0157375_10126011 3300013308 Bacteria 2676
95 Ga0163163_10673941 3300014325 Bacteria 1098
96 Ga0157380_10693194 3300014326 Bacteria 1022
97 Ga0157377_10076101 3300014745 Bacteria 1951
98 Ga0157379_10054518 3300014968 Bacteria 3572
99 Ga0224712_10171299 3300022467 Bacteria 974
100 Ga0207688_10012790 3300025901 Bacteria 4562
101 Ga0207688_10099452 3300025901 Bacteria 1678
102 Ga0207705_10147616 3300025909 Bacteria 1760
103 Ga0207657_10025454 3300025919 Bacteria 5457
104 Ga0207659_10352906 3300025926 Bacteria 1221
105 Ga0207690_10125797 3300025932 Bacteria 1869
106 Ga0207690_10197814 3300025932 Bacteria 1524
107 Ga0207709_10054110 3300025935 Bacteria 2473
108 Ga0207669_10207622 3300025937 Bacteria 1427
109 Ga0207691_10368639 3300025940 Bacteria 1227
110 Ga0207711_10147215 3300025941 Bacteria 2122
111 Ga0207661_10057509 3300025944 Bacteria 3127
112 Ga0207661_10064824 3300025944 Bacteria 2963
113 Ga0207679_10076700 3300025945 Bacteria 2540
114 Ga0207712_10119818 3300025961 Bacteria 1989
115 Ga0207668_10392910 3300025972 Bacteria 1171
116 Ga0207658_10050745 3300025986 Bacteria 3054
117 Ga0207658_10141708 3300025986 Bacteria 1946
118 Ga0207708_10102104 3300026075 Bacteria 2220
119 Ga0207708_10473110 3300026075 Bacteria 1047
120 Ga0207702_10280747 3300026078 Bacteria 1574
121 Ga0207676_10119361 3300026095 Bacteria 2221
122 Ga0207674_10002987 3300026116 Bacteria 20973
123 Ga0207674_10713060 3300026116 Bacteria 968
124 Ga0207675_100558793 3300026118 Bacteria 1144
125 Ga0207683_10217906 3300026121 Bacteria 1739
126 Ga0207683_10407885 3300026121 Bacteria 1250
127 Ga0209813_10008535 3300027866 Bacteria 2593
128 Ga0209813_10100371 3300027866 Bacteria 984
129 Ga0268266_10000555 3300028379 Bacteria 52036
130 Ga0268265_10363887 3300028380 Bacteria 1325
131 Ga0268264_10000220 3300028381 Bacteria 111692
132 Ga0268264_10131957 3300028381 Bacteria 2216
133 Ga0307407_10115758 3300031903 Bacteria 1691
134 Ga0307409_100055681 3300031995 Bacteria 3055
135 Ga0307416_100291541 3300032002 Bacteria 1616
136 Ga0307416_100292223 3300032002 Bacteria 1614
137 Ga0307414_10178638 3300032004 Bacteria 1705
138 Ga0307411_10034181 3300032005 Bacteria 3161
139 Ga0307415_100036424 3300032126 Bacteria 3224
140 Ga0395899_0126461 3300037312 Bacteria 1828
141 Ga0395900_0074827 3300037418 Bacteria 3481
142 Ga0395900_0130097 3300037418 Bacteria 2580
143 Ga0395898_0349464 3300037466 Bacteria 1410
144 Ga0395901_0021309 3300038443 Bacteria 6639
145 Ga0451802_0623196 3300041460 Bacteria 1160
146 Ga0451841_0699201 3300041498 Bacteria 1081
147 Ga0451853_0538758 3300041512 Bacteria 957
148 Ga0451853_1281984 3300041512 Bacteria 2727
149 Ga0439431_0049995 3300041997 Bacteria 1082
150 Ga0439445_0019096 3300042004 Bacteria 1706
151 Ga0439449_0063052 3300042007 Bacteria 1368
152 Ga0450907_012467 3300042146 Bacteria 1415
153 Ga0439446_0007930 3300042156 Bacteria 2805
154 Ga0439434_0008289 3300042435 Bacteria 3047
155 Ga0466965_0043514 3300044683 Bacteria 2217
156 Ga0466963_0414635 3300044694 Bacteria 950
157 Ga0466957_0168005 3300044842 Bacteria 1428
158 Ga0466967_0048941 3300045976 Bacteria 3694
159 Ga0466967_0056117 3300045976 Bacteria 3472
160 Ga0466967_0172282 3300045976 Bacteria 2037
161 Ga0466967_0318080 3300045976 Bacteria 1500
162 Ga0466967_0382297 3300045976 Bacteria 1367
163 Ga0496100_0031949 3300048903 Bacteria 3278
164 Ga0496100_0062115 3300048903 Bacteria 2464
165 Ga0496101_0009826 3300048904 Bacteria 6303
166 Ga0496101_0077891 3300048904 Bacteria 2444
167 Ga0496101_0201530 3300048904 Bacteria 1539
168 Ga0496101_0253476 3300048904 Bacteria 1371
169 Ga0496102_0040462 3300048905 Bacteria 4216
170 Ga0496102_0153985 3300048905 Bacteria 2161
171 Ga0496102_0158071 3300048905 Bacteria 2131
172 Ga0496102_0197296 3300048905 Bacteria 1897
173 Ga0496102_0222797 3300048905 Bacteria 1778
174 Ga0496102_0577769 3300048905 Bacteria 1047
175 Ga0496103_0033861 3300048906 Bacteria 3122
176 Ga0496103_0120384 3300048906 Bacteria 1672
177 Ga0496104_0008876 3300048907 Bacteria 8936
178 Ga0496104_0137634 3300048907 Bacteria 2346
179 Ga0496105_0008404 3300048908 Bacteria 8023
180 Ga0496105_0135929 3300048908 Bacteria 2025
181 Ga0496106_0053132 3300048909 Bacteria 3059
182 Ga0496106_0090254 3300048909 Bacteria 2364
183 Ga0496107_0011360 3300048910 Bacteria 6199
184 Ga0496108_0070029 3300048911 Bacteria 2960
185 Ga0496108_0071325 3300048911 Bacteria 2931
186 Ga0496108_0366678 3300048911 Bacteria 1257
187 Ga0496109_0015409 3300048912 Bacteria 6662
188 Ga0496109_0019812 3300048912 Bacteria 5935
189 Ga0496109_0049952 3300048912 Bacteria 3810
190 Ga0496109_0167682 3300048912 Bacteria 2059
191 Ga0496109_0762010 3300048912 Bacteria 906
192 Ga0496110_0002455 3300048913 Bacteria 13880
193 Ga0496110_0111519 3300048913 Bacteria 2459
194 Ga0496110_0229731 3300048913 Bacteria 1687
195 Ga0496110_0390869 3300048913 Bacteria 1268
196 Ga0496111_0003092 3300048914 Bacteria 10230
197 Ga0496111_0109105 3300048914 Bacteria 2038
198 Ga0496111_0128524 3300048914 Bacteria 1874
199 Ga0496113_0047234 3300048916 Bacteria 3199
200 Ga0496113_0346269 3300048916 Bacteria 1192
201 Ga0496114_0049859 3300048917 Bacteria 3484
202 Ga0496114_0062696 3300048917 Bacteria 3111
203 Ga0496114_0136103 3300048917 Bacteria 2124
204 Ga0496115_0017597 3300048918 Bacteria 5469
205 Ga0496115_0037652 3300048918 Bacteria 3834
206 Ga0496115_0058676 3300048918 Bacteria 3097
207 Ga0501034_0317077 3300049571 Bacteria 1492
208 Ga0501034_0467200 3300049571 Bacteria 1178
209 Ga0501037_0068414 3300049573 Bacteria 2585
210 Ga0501038_0711333 3300049574 Bacteria 752
211 Ga0501042_0042659 3300049578 Bacteria 3230
212 Ga0501047_0268223 3300049581 Bacteria 1553
213 Ga0501047_0464822 3300049581 Bacteria 1094
214 Ga0501067_0016893 3300049583 Bacteria 4031
215 Ga0501067_0034107 3300049583 Bacteria 2824
216 Ga0501067_0034237 3300049583 Bacteria 2819
217 Ga0501067_0039969 3300049583 Bacteria 2605
218 Ga0501068_0042318 3300049584 Bacteria 2739
219 Ga0501068_0052144 3300049584 Bacteria 2475
220 Ga0501068_0066764 3300049584 Bacteria 2191
221 Ga0501068_0149183 3300049584 Bacteria 1469
222 Ga0501069_0059574 3300049585 Bacteria 2130
223 Ga0501069_0094585 3300049585 Bacteria 1691
224 Ga0501069_0133712 3300049585 Bacteria 1421
225 Ga0501069_0188738 3300049585 Bacteria 1192
226 Ga0501070_0001423 3300049586 Bacteria 21420
227 Ga0501070_0106448 3300049586 Bacteria 2318
228 Ga0501070_0388679 3300049586 Bacteria 1129
229 Ga0501071_0045759 3300049587 Bacteria 3142
230 Ga0501072_0003746 3300049588 Bacteria 11476
231 Ga0501072_0157711 3300049588 Bacteria 1810
232 Ga0501073_0237578 3300049589 Bacteria 1258
233 Ga0501073_0309839 3300049589 Bacteria 1089
234 Ga0501074_0013613 3300049590 Bacteria 5914
235 Ga0501074_0080143 3300049590 Bacteria 2343
236 Ga0501074_0321652 3300049590 Bacteria 1098
237 Ga0501077_0002656 3300049593 Bacteria 10716
238 Ga0501080_0013091 3300049742 Bacteria 7618
239 Ga0501081_0247689 3300049743 Bacteria 1300
240 Ga0501083_0119575 3300049744 Bacteria 1728
241 Ga0501035_0048508 3300049822 Bacteria 3808
242 Ga0501044_0011981 3300049823 Bacteria 9396
243 Ga0501045_0209571 3300049824 Bacteria 1452
244 Ga0501045_0244140 3300049824 Bacteria 1337
245 nmdc:mga03683_52031_c1 3300050489 Bacteria 1711
246 nmdc:mga03n38_17206_c1 3300050490 Bacteria 2827
247 nmdc:mga03n38_189648_c1 3300050490 Bacteria 1058
248 nmdc:mga03n38_203952_c1 3300050490 Bacteria 1025
249 nmdc:mga03n38_235_c1 3300050490 Bacteria 12970
250 nmdc:mga03n38_8924_c1 3300050490 Bacteria 3619
251 nmdc:mga00v17_114147_c1 3300050491 Bacteria 1715
252 nmdc:mga00v17_12036_c1 3300050491 Bacteria 4763
253 nmdc:mga00v17_14582_c1 3300050491 Bacteria 4391
254 nmdc:mga00v17_22926_c1 3300050491 Bacteria 2795
255 nmdc:mga00v17_23384_c1 3300050491 Bacteria 3574
256 nmdc:mga00v17_78932_c1 3300050491 Bacteria 2052
257 nmdc:mga00v17_89685_c1 3300050491 Bacteria 1929
258 nmdc:mga0yw44_158277_c1 3300050492 Bacteria 1482
259 nmdc:mga0yw44_159826_c1 3300050492 Bacteria 1474
260 nmdc:mga0yw44_19394_c1 3300050492 Bacteria 3750
261 nmdc:mga0yw44_260401_c1 3300050492 Bacteria 1156
262 nmdc:mga0yw44_30977_c1 3300050492 Bacteria 3107
263 nmdc:mga0yw44_31008_c1 3300050492 Bacteria 3105
264 nmdc:mga0yw44_3496_c1 3300050492 Bacteria 6988
265 nmdc:mga0yw44_3866_c1 3300050492 Bacteria 6741
266 nmdc:mga0yw44_39069_c1 3300050492 Bacteria 2812
267 nmdc:mga0yw44_428_c1 3300050492 Bacteria 14762
268 nmdc:mga0yw44_8814_c1 3300050492 Bacteria 5050
269 nmdc:mga0yw44_96781_c1 3300050492 Bacteria 1874
270 nmdc:mga0yw44_98907_c1 3300050492 Bacteria 1855
271 nmdc:mga06z11_153874_c1 3300050494 Bacteria 1309
272 nmdc:mga06z11_163241_c1 3300050494 Bacteria 1275
273 nmdc:mga06z11_64016_c1 3300050494 Bacteria 1926
274 nmdc:mga04h51_104800_c1 3300050495 Bacteria 1035
275 nmdc:mga04h51_6712_c1 3300050495 Bacteria 3001
276 nmdc:mga07m45_189730_c1 3300050496 Bacteria 1195
277 nmdc:mga07m45_20465_c1 3300050496 Bacteria 3594
278 nmdc:mga07m45_25234_c1 3300050496 Bacteria 3259
279 nmdc:mga07m45_293073_c1 3300050496 Bacteria 946
280 nmdc:mga07m45_62172_c1 3300050496 Bacteria 2116
281 nmdc:mga07m45_67900_c1 3300050496 Bacteria 2026
282 nmdc:mga08y16_468337_c1 3300050511 Bacteria 1283
283 Ga0495601_0023009 3300053077 Bacteria 3829
284 Ga0495595_0048197 3300053084 Bacteria 1967
285 Ga0495619_0037553 3300053085 Bacteria 3157
286 Ga0500644_0000102 3300053088 Bacteria 54213
287 Ga0500641_0058684 3300053096 Bacteria 1598
288 Ga0500554_065319 3300053102 Bacteria 1175
289 Ga0500556_0000210 3300053104 Bacteria 47478
290 Ga0501084_0415241 3300054114 Bacteria 1137
291 Ga0501082_0379397 3300060353 Bacteria 1233
292 2644117309 2643221620 Bacteria 5134593
293 2643959914 2643221590 Bacteria 5214697
294 2644032678 2643221604 Bacteria 5014917
295 2644100900 2643221617 Bacteria 5139111
296 2812330577 2811994874 Bacteria 5367947
297 2855390398 2855386786 Bacteria 4752232
298 Ga0070683_100001276
299 Ga0070690_100114953
300 Ga0070680_100212793
301 Ga0070682_100029170
302 Ga0070682_100198056
303 Ga0070660_100012734
304 Ga0070660_100195860
305 Ga0070692_10132744
306 Ga0070674_100408786
307 Ga0070659_100030316
308 Ga0070659_100083250
309 Ga0070667_100042271
310 Ga0070667_100134237
311 Ga0070701_10260386
312 Ga0070700_100285600
313 Ga0070708_100073124
314 Ga0070678_100245397
315 Ga0070685_10306415
316 Ga0070698_100001974
317 Ga0070684_100005763
318 Ga0070684_100374988
319 Ga0068855_100249175
320 Ga0068857_100018392
321 Ga0068856_100245673
322 Ga0068864_100093321
323 Ga0068866_10160237
324 Ga0068863_100210603
325 Ga0068860_100000253
326 Ga0081539_10019244
327 Ga0075365_10013646
328 Ga0075365_10023299
329 Ga0075365_10025237
330 Ga0075365_10070222
331 Ga0075365_10084778
332 Ga0075365_10158650
333 Ga0075365_10172938
334 Ga0075365_10182276
335 Ga0075365_10194469
336 Ga0075365_10272033
337 Ga0075368_10000781
338 Ga0075368_10006525
339 Ga0075368_10015185
340 Ga0075368_10024821
341 Ga0075363_100000278
342 Ga0075363_100015208
343 Ga0075363_100016718
344 Ga0075363_100031772
345 Ga0075363_100191101
346 Ga0075364_10001677
347 Ga0075364_10010628
348 Ga0075364_10018525
349 Ga0075364_10030035
350 Ga0075364_10052161
351 Ga0075364_10068563
352 Ga0075364_10107245
353 Ga0075364_10175653
354 Ga0075364_10192183
355 Ga0075362_10002233
356 Ga0075362_10172452
357 Ga0075367_10009615
358 Ga0075367_10013584
359 Ga0075367_10034346
360 Ga0075367_10042438
361 Ga0075367_10058899
362 Ga0075367_10219836
363 Ga0075370_10005130
364 Ga0075370_10023357
365 Ga0075370_10023553
366 Ga0075370_10049517
367 Ga0068865_100122240
368 Ga0111539_10414969
369 Ga0111539_10643882
370 Ga0105245_10006300
371 Ga0105243_10039696
372 Ga0105243_10114427
373 Ga0105243_10190519
374 Ga0105248_10216657
375 Ga0105248_10864097
376 Ga0105237_10152779
377 Ga0105238_10125727
378 Ga0105249_10050347
379 Ga0105249_10532806
380 Ga0105239_10004204
381 Ga0105246_10077058
382 Ga0157369_10070233
383 Ga0157369_10563948
384 Ga0163162_10087613
385 Ga0163162_10307726
386 Ga0157372_10002605
387 Ga0157372_10183129
388 Ga0157372_10445815
389 Ga0157372_10453618
390 Ga0157375_10088946
391 Ga0157375_10126011
392 Ga0163163_10673941
393 Ga0157380_10693194
394 Ga0157377_10076101
395 Ga0157379_10054518
396 Ga0224712_10171299
397 Ga0207688_10012790
398 Ga0207688_10099452
399 Ga0207705_10147616
400 Ga0207657_10025454
401 Ga0207659_10352906
402 Ga0207690_10125797
403 Ga0207690_10197814
404 Ga0207709_10054110
405 Ga0207669_10207622
406 Ga0207691_10368639
407 Ga0207711_10147215
408 Ga0207661_10057509
409 Ga0207661_10064824
410 Ga0207679_10076700
411 Ga0207712_10119818
412 Ga0207668_10392910
413 Ga0207658_10050745
414 Ga0207658_10141708
415 Ga0207708_10102104
416 Ga0207708_10473110
417 Ga0207702_10280747
418 Ga0207676_10119361
419 Ga0207674_10002987
420 Ga0207674_10713060
421 Ga0207675_100558793
422 Ga0207683_10217906
423 Ga0207683_10407885
424 Ga0209813_10008535
425 Ga0209813_10100371
426 Ga0268266_10000555
427 Ga0268265_10363887
428 Ga0268264_10000220
429 Ga0268264_10131957
430 Ga0307407_10115758
431 Ga0307409_100055681
432 Ga0307416_100291541
433 Ga0307416_100292223
434 Ga0307414_10178638
435 Ga0307411_10034181
436 Ga0307415_100036424
437 Ga0395899_0126461
438 Ga0395900_0074827
439 Ga0395900_0130097
440 Ga0395898_0349464
441 Ga0395901_0021309
442 Ga0451802_0623196
443 Ga0451841_0699201
444 Ga0451853_0538758
445 Ga0451853_1281984
446 Ga0439431_0049995
447 Ga0439445_0019096
448 Ga0439449_0063052
449 Ga0450907_012467
450 Ga0439446_0007930
451 Ga0439434_0008289
452 Ga0466965_0043514
453 Ga0466963_0414635
454 Ga0466957_0168005
455 Ga0466967_0048941
456 Ga0466967_0056117
457 Ga0466967_0172282
458 Ga0466967_0318080
459 Ga0466967_0382297
460 Ga0496100_0031949
461 Ga0496100_0062115
462 Ga0496101_0009826
463 Ga0496101_0077891
464 Ga0496101_0201530
465 Ga0496101_0253476
466 Ga0496102_0040462
467 Ga0496102_0153985
468 Ga0496102_0158071
469 Ga0496102_0197296
470 Ga0496102_0222797
471 Ga0496102_0577769
472 Ga0496103_0033861
473 Ga0496103_0120384
474 Ga0496104_0008876
475 Ga0496104_0137634
476 Ga0496105_0008404
477 Ga0496105_0135929
478 Ga0496106_0053132
479 Ga0496106_0090254
480 Ga0496107_0011360
481 Ga0496108_0070029
482 Ga0496108_0071325
483 Ga0496108_0366678
484 Ga0496109_0015409
485 Ga0496109_0019812
486 Ga0496109_0049952
487 Ga0496109_0167682
488 Ga0496109_0762010
489 Ga0496110_0002455
490 Ga0496110_0111519
491 Ga0496110_0229731
492 Ga0496110_0390869
493 Ga0496111_0003092
494 Ga0496111_0109105
495 Ga0496111_0128524
496 Ga0496113_0047234
497 Ga0496113_0346269
498 Ga0496114_0049859
499 Ga0496114_0062696
500 Ga0496114_0136103
501 Ga0496115_0017597
502 Ga0496115_0037652
503 Ga0496115_0058676
504 Ga0501034_0317077
505 Ga0501034_0467200
506 Ga0501037_0068414
507 Ga0501038_0711333
508 Ga0501042_0042659
509 Ga0501047_0268223
510 Ga0501047_0464822
511 Ga0501067_0016893
512 Ga0501067_0034107
513 Ga0501067_0034237
514 Ga0501067_0039969
515 Ga0501068_0042318
516 Ga0501068_0052144
517 Ga0501068_0066764
518 Ga0501068_0149183
519 Ga0501069_0059574
520 Ga0501069_0094585
521 Ga0501069_0133712
522 Ga0501069_0188738
523 Ga0501070_0001423
524 Ga0501070_0106448
525 Ga0501070_0388679
526 Ga0501071_0045759
527 Ga0501072_0003746
528 Ga0501072_0157711
529 Ga0501073_0237578
530 Ga0501073_0309839
531 Ga0501074_0013613
532 Ga0501074_0080143
533 Ga0501074_0321652
534 Ga0501077_0002656
535 Ga0501080_0013091
536 Ga0501081_0247689
537 Ga0501083_0119575
538 Ga0501035_0048508
539 Ga0501044_0011981
540 Ga0501045_0209571
541 Ga0501045_0244140
542 nmdc:mga03683_52031_c1
543 nmdc:mga03n38_17206_c1
544 nmdc:mga03n38_189648_c1
545 nmdc:mga03n38_203952_c1
546 nmdc:mga03n38_235_c1
547 nmdc:mga03n38_8924_c1
548 nmdc:mga00v17_114147_c1
549 nmdc:mga00v17_12036_c1
550 nmdc:mga00v17_14582_c1
551 nmdc:mga00v17_22926_c1
552 nmdc:mga00v17_23384_c1
553 nmdc:mga00v17_78932_c1
554 nmdc:mga00v17_89685_c1
555 nmdc:mga0yw44_158277_c1
556 nmdc:mga0yw44_159826_c1
557 nmdc:mga0yw44_19394_c1
558 nmdc:mga0yw44_260401_c1
559 nmdc:mga0yw44_30977_c1
560 nmdc:mga0yw44_31008_c1
561 nmdc:mga0yw44_3496_c1
562 nmdc:mga0yw44_3866_c1
563 nmdc:mga0yw44_39069_c1
564 nmdc:mga0yw44_428_c1
565 nmdc:mga0yw44_8814_c1
566 nmdc:mga0yw44_96781_c1
567 nmdc:mga0yw44_98907_c1
568 nmdc:mga06z11_153874_c1
569 nmdc:mga06z11_163241_c1
570 nmdc:mga06z11_64016_c1
571 nmdc:mga04h51_104800_c1
572 nmdc:mga04h51_6712_c1
573 nmdc:mga07m45_189730_c1
574 nmdc:mga07m45_20465_c1
575 nmdc:mga07m45_25234_c1
576 nmdc:mga07m45_293073_c1
577 nmdc:mga07m45_62172_c1
578 nmdc:mga07m45_67900_c1
579 nmdc:mga08y16_468337_c1
580 Ga0495601_0023009
581 Ga0495595_0048197
582 Ga0495619_0037553
583 Ga0500644_0000102
584 Ga0500641_0058684
585 Ga0500554_065319
586 Ga0500556_0000210
587 Ga0501084_0415241
588 Ga0501082_0379397
589 2644117309
590 2643959914
591 2644032678
592 2644100900
593 2812330577
594 2855390398

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03009

GDPD

Glycerophosphoryl diester phosphodiesterase family

4

245

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qvq-assembly1.cif.gz_D the structure of an oleispira antarctica phosphodiesterase olei02445 in complex with the product sn-glycerol-3-phosphate 0.8646 9 264
1vd6-assembly1.cif.gz_A crystal structure of glycerophosphoryl diester phosphodiesterase complexed with glycerol 0.8613 8 260
1vd6-assembly1.cif.gz_A crystal structure of glycerophosphoryl diester phosphodiesterase complexed with glycerol 0.8432 8 260
2otd-assembly4.cif.gz_D the crystal structure of the glycerophosphodiester phosphodiesterase from shigella flexneri 2a 0.8385 8 259
3qvq-assembly1.cif.gz_D the structure of an oleispira antarctica phosphodiesterase olei02445 in complex with the product sn-glycerol-3-phosphate 0.8355 9 264
ID Description Score Start End Superfamily
af_P9WMU3_1_270_3.20.20.190 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase 0.8669 5 265 3.20.20.190
1v8eA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase 0.8609 9 260 3.20.20.190
3qvqC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase 0.8514 8 264 3.20.20.190
1v8eA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase 0.8428 9 260 3.20.20.190
2otdA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase 0.8412 11 254 3.20.20.190
ID Description Score Start End GO Terms
AF-A1SD21-F1-model_v4 Glycerophosphoryl diester phosphodiesterase 0.95 7 265 GO:0006629
GO:0008081
AF-A0A4Q4ZML5-F1-model_v4 Glycerophosphodiester phosphodiesterase 0.9498 8 264 GO:0006629
GO:0008081
AF-A0A1I1F4B8-F1-model_v4 Glycerophosphoryl diester phosphodiesterase 0.9414 5 263 GO:0006629
GO:0008081
AF-A0A4Q4ZML5-F1-model_v4 Glycerophosphodiester phosphodiesterase 0.9356 8 264 GO:0006629
GO:0008081
AF-A1SD21-F1-model_v4 Glycerophosphoryl diester phosphodiesterase 0.9257 7 265 GO:0006629
GO:0008081

Map