F393943

General Info

Members Datasets Scaffolds Average Seq Length
297 206 594 265

Family's Representative Sequence

Representative Sequence 3300050494|nmdc:mga06z11_75551_c1|nmdc:mga06z11_75551_c1_595_1476
Length 293
Sequence MFLTLDLADCRRTTTSPGGHDTMTAPDATTAPRAVGNRLEGRTILVAGAGTQPSDDPDAPVGNGRAISVALAREGATVVCADRDPGAAQATADLVRAEGAEAIVVVGDVSIEEDCAAMVTAGLGADGTGTLHGIVANAGIGRGTGLAHTSAHDWDTTFAVNLRGPFLLAKAAMPLLPEGGSIVFIGSVAGLQPGSRRPAYDASKAGLIGLCRHVALEGARQQVRANVVAPGLIDTVLGRLATEGRPSRGRTPVPLGRQGTAWEVAASTVFLLSDDASYITGHTLVVDGGLALI

Samples

Sample ID Description Type Environment
1 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
113 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
114 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
115 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
116 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
117 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
118 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
119 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
120 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
121 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
122 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
123 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
137 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
138 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
139 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
145 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
149 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
153 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
154 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
155 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
156 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
157 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
160 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
161 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
162 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
163 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
164 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
179 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
180 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
181 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
184 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
185 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
186 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
187 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
190 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
198 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
201 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
202 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
203 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
204 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
205 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
206 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.99
Metatranscriptomes 0.67
Isolates 0.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.02
Nodule 0
Rhizoplane 2.36
Rhizosphere 94.28
Stem 0
Stem Tuber 0
Unclassified 3.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga06z11_75551_c1 3300050494 Bacteria 1794
2 MBSR1b_contig_741326 2162886012 Bacteria 1712
3 Ga0065712_10072910 3300005290 Bacteria 4569
4 Ga0065715_10153677 3300005293 Bacteria 1700
5 Ga0070658_10002066 3300005327 Bacteria 16839
6 Ga0070676_10061328 3300005328 Bacteria 2235
7 Ga0070670_100212158 3300005331 Unclassified 1683
8 Ga0068869_100001082 3300005334 Bacteria 15879
9 Ga0070680_100124925 3300005336 Bacteria 2149
10 Ga0070680_100506603 3300005336 Bacteria 1033
11 Ga0068868_100066309 3300005338 Bacteria 2870
12 Ga0070660_100005353 3300005339 Bacteria 8881
13 Ga0070689_100025232 3300005340 Bacteria 4464
14 Ga0070687_100057989 3300005343 Bacteria 2032
15 Ga0070661_100012450 3300005344 Bacteria 5950
16 Ga0070668_100046908 3300005347 Bacteria 3320
17 Ga0070669_100010712 3300005353 Bacteria 6506
18 Ga0070669_100252702 3300005353 Bacteria 1404
19 Ga0070675_100002472 3300005354 Bacteria 13834
20 Ga0070675_100202746 3300005354 Bacteria 1722
21 Ga0070671_100194875 3300005355 Bacteria 1718
22 Ga0070674_100215791 3300005356 Bacteria 1490
23 Ga0070673_100000998 3300005364 Bacteria 16053
24 Ga0070688_100006483 3300005365 Bacteria 6260
25 Ga0070667_100172521 3300005367 Bacteria 1910
26 Ga0070701_10026017 3300005438 Bacteria 2848
27 Ga0070705_100006509 3300005440 Bacteria 5732
28 Ga0070700_100055513 3300005441 Bacteria 2479
29 Ga0070678_100009125 3300005456 Bacteria 5986
30 Ga0070662_100007616 3300005457 Bacteria 7030
31 Ga0070662_100157512 3300005457 Bacteria 1774
32 Ga0070681_10171934 3300005458 Bacteria 2088
33 Ga0068867_100039786 3300005459 Bacteria 3429
34 Ga0070685_10018386 3300005466 Bacteria 3758
35 Ga0070706_100004608 3300005467 Bacteria 13232
36 Ga0070706_100005155 3300005467 Bacteria 12471
37 Ga0070706_100064904 3300005467 Bacteria 3375
38 Ga0070706_100401159 3300005467 Bacteria 1276
39 Ga0070707_100182080 3300005468 Bacteria 2048
40 Ga0070698_100355104 3300005471 Bacteria 1397
41 Ga0070699_100006173 3300005518 Bacteria 10469
42 Ga0070699_100036104 3300005518 Bacteria 4275
43 Ga0070684_100001445 3300005535 Bacteria 17131
44 Ga0070697_100044312 3300005536 Bacteria 3603
45 Ga0070665_100013614 3300005548 Bacteria 8181
46 Ga0070704_100085736 3300005549 Bacteria 2332
47 Ga0070664_100000604 3300005564 Bacteria 27489
48 Ga0068857_100009893 3300005577 Bacteria 8281
49 Ga0070702_100005722 3300005615 Bacteria 5819
50 Ga0068859_100001971 3300005617 Bacteria 20954
51 Ga0068864_100003446 3300005618 Bacteria 13079
52 Ga0068864_100626101 3300005618 Bacteria 1046
53 Ga0068864_100667360 3300005618 Bacteria 1013
54 Ga0068866_10276861 3300005718 Bacteria 1038
55 Ga0068861_100001164 3300005719 Bacteria 16384
56 Ga0068861_100087879 3300005719 Bacteria 2446
57 Ga0068870_10083277 3300005840 Bacteria 1773
58 Ga0068863_100003146 3300005841 Bacteria 16292
59 Ga0068862_100005680 3300005844 Bacteria 10409
60 Ga0070717_10030840 3300006028 Bacteria 4309
61 Ga0075365_10305661 3300006038 Bacteria 1119
62 Ga0075364_10249502 3300006051 Bacteria 1206
63 Ga0075367_10013024 3300006178 Bacteria 4456
64 Ga0097621_100059865 3300006237 Bacteria 3120
65 Ga0075428_100009410 3300006844 Bacteria 10840
66 Ga0075428_100009500 3300006844 Bacteria 10798
67 Ga0075428_100064312 3300006844 Bacteria 4017
68 Ga0075428_100076330 3300006844 Bacteria 3658
69 Ga0075428_100112982 3300006844 Bacteria 2959
70 Ga0075428_100147954 3300006844 Bacteria 2552
71 Ga0075430_100001164 3300006846 Bacteria 21043
72 Ga0075430_100020940 3300006846 Bacteria 5559
73 Ga0075430_100023321 3300006846 Bacteria 5266
74 Ga0075430_100531447 3300006846 Bacteria 970
75 Ga0075431_100003059 3300006847 Bacteria 16195
76 Ga0075431_100005895 3300006847 Bacteria 12122
77 Ga0075431_100034779 3300006847 Bacteria 5190
78 Ga0075431_100042986 3300006847 Bacteria 4662
79 Ga0075431_100088842 3300006847 Bacteria 3190
80 Ga0075431_100095823 3300006847 Bacteria 3063
81 Ga0075431_100139481 3300006847 Bacteria 2499
82 Ga0075431_100494036 3300006847 Bacteria 1215
83 Ga0075431_100591090 3300006847 Bacteria 1095
84 Ga0075433_10034160 3300006852 Bacteria 4365
85 Ga0075429_100002874 3300006880 Bacteria 14589
86 Ga0075429_100004258 3300006880 Bacteria 12269
87 Ga0075429_100083445 3300006880 Bacteria 2785
88 Ga0075429_100243584 3300006880 Bacteria 1575
89 Ga0075429_100393673 3300006880 Bacteria 1213
90 Ga0075436_100283169 3300006914 Bacteria 1185
91 Ga0097620_100001971 3300006931 Bacteria 20954
92 Ga0075435_100132428 3300007076 Bacteria 2086
93 Ga0075435_100180624 3300007076 Bacteria 1783
94 Ga0111539_10005375 3300009094 Bacteria 16564
95 Ga0111539_10012103 3300009094 Bacteria 10823
96 Ga0111539_10118956 3300009094 Bacteria 3096
97 Ga0111539_10218275 3300009094 Bacteria 2221
98 Ga0111539_10451503 3300009094 Bacteria 1497
99 Ga0105245_10140225 3300009098 Bacteria 2276
100 Ga0105245_10347183 3300009098 Bacteria 1469
101 Ga0114129_10008587 3300009147 Bacteria 14566
102 Ga0114129_10046168 3300009147 Bacteria 6123
103 Ga0114129_10163638 3300009147 Bacteria 3038
104 Ga0114129_10201988 3300009147 Bacteria 2692
105 Ga0114129_10247908 3300009147 Bacteria 2392
106 Ga0114129_10327193 3300009147 Bacteria 2036
107 Ga0114129_10468710 3300009147 Bacteria 1650
108 Ga0114129_10667674 3300009147 Bacteria 1340
109 Ga0105242_10035068 3300009176 Unclassified 4023
110 Ga0105242_10188733 3300009176 Bacteria 1823
111 Ga0105248_10007148 3300009177 Bacteria 12243
112 Ga0105249_10043294 3300009553 Bacteria 4095
113 Ga0105249_10218055 3300009553 Bacteria 1876
114 Ga0157369_10003007 3300013105 Bacteria 20164
115 Ga0157374_10383414 3300013296 Bacteria 1400
116 Ga0157378_10108044 3300013297 Unclassified 2547
117 Ga0157378_11003775 3300013297 Unclassified 869
118 Ga0163162_10016335 3300013306 Bacteria 7256
119 Ga0163162_10551692 3300013306 Bacteria 1281
120 Ga0157372_10240225 3300013307 Bacteria 2102
121 Ga0157380_10302098 3300014326 Bacteria 1475
122 Ga0157377_10028199 3300014745 Bacteria 3021
123 Ga0157377_10105451 3300014745 Bacteria 1687
124 Ga0163161_10790158 3300017792 Bacteria 797
125 Ga0197907_11381497 3300020069 Bacteria 1469
126 Ga0213876_10015836 3300021384 Bacteria 3990
127 Ga0224712_10034938 3300022467 Bacteria 1852
128 Ga0207642_10260361 3300025899 Bacteria 989
129 Ga0207688_10028218 3300025901 Bacteria 3088
130 Ga0207645_10019563 3300025907 Bacteria 4438
131 Ga0207643_10105496 3300025908 Bacteria 1656
132 Ga0207684_10003870 3300025910 Bacteria 14375
133 Ga0207684_10018712 3300025910 Bacteria 5927
134 Ga0207684_10098830 3300025910 Bacteria 2492
135 Ga0207684_10373743 3300025910 Bacteria 1226
136 Ga0207707_10134280 3300025912 Unclassified 2164
137 Ga0207660_10012861 3300025917 Bacteria 5480
138 Ga0207662_10012568 3300025918 Bacteria 4717
139 Ga0207657_10011220 3300025919 Bacteria 8907
140 Ga0207649_10010239 3300025920 Bacteria 5147
141 Ga0207681_10190189 3300025923 Bacteria 1570
142 Ga0207659_10070379 3300025926 Bacteria 2551
143 Ga0207706_10002609 3300025933 Bacteria 17551
144 Ga0207706_10185551 3300025933 Bacteria 1826
145 Ga0207686_10111685 3300025934 Bacteria 1845
146 Ga0207669_10076071 3300025937 Bacteria 2130
147 Ga0207691_10020265 3300025940 Bacteria 6287
148 Ga0207711_10053363 3300025941 Bacteria 3467
149 Ga0207679_10001459 3300025945 Bacteria 14835
150 Ga0207651_10083754 3300025960 Bacteria 2307
151 Ga0207712_10005886 3300025961 Bacteria 7730
152 Ga0207712_10033209 3300025961 Bacteria 3487
153 Ga0207668_10002934 3300025972 Bacteria 10009
154 Ga0207658_10128670 3300025986 Bacteria 2031
155 Ga0207677_10022614 3300026023 Bacteria 3867
156 Ga0207703_10006504 3300026035 Bacteria 9329
157 Ga0207708_10002391 3300026075 Bacteria 13777
158 Ga0207708_10064057 3300026075 Bacteria 2808
159 Ga0207648_10195279 3300026089 Bacteria 1794
160 Ga0207676_10000876 3300026095 Bacteria 23356
161 Ga0207674_10164018 3300026116 Bacteria 2176
162 Ga0207675_100012713 3300026118 Bacteria 7867
163 Ga0207675_100016332 3300026118 Bacteria 6929
164 Ga0207675_100325346 3300026118 Bacteria 1502
165 Ga0207683_10006209 3300026121 Bacteria 10239
166 Ga0207428_10014783 3300027907 Bacteria 6762
167 Ga0268266_10029526 3300028379 Bacteria 4661
168 Ga0268265_10001740 3300028380 Bacteria 17519
169 Ga0268265_10004508 3300028380 Bacteria 9639
170 Ga0268265_10451897 3300028380 Bacteria 1200
171 Ga0265337_1003278 3300028556 Bacteria 7073
172 Ga0265338_10001565 3300028800 Bacteria 36898
173 Ga0265330_10006082 3300031235 Bacteria 5979
174 Ga0265332_10000060 3300031238 Bacteria 97745
175 Ga0265328_10005870 3300031239 Bacteria 5238
176 Ga0265320_10000334 3300031240 Bacteria 38405
177 Ga0265320_10028938 3300031240 Bacteria 2872
178 Ga0265325_10001402 3300031241 Bacteria 16987
179 Ga0265329_10008727 3300031242 Bacteria 3825
180 Ga0265340_10063952 3300031247 Bacteria 1755
181 Ga0265339_10209506 3300031249 Bacteria 958
182 Ga0265331_10000191 3300031250 Bacteria 75566
183 Ga0265316_10000158 3300031344 Bacteria 75572
184 Ga0307408_100089342 3300031548 Bacteria 2322
185 Ga0307408_100112739 3300031548 Bacteria 2092
186 Ga0265313_10000915 3300031595 Bacteria 29488
187 Ga0265314_10000259 3300031711 Bacteria 77595
188 Ga0265314_10133594 3300031711 Bacteria 1544
189 Ga0307405_10181937 3300031731 Bacteria 1510
190 Ga0307405_10511083 3300031731 Bacteria 965
191 Ga0307410_10080793 3300031852 Bacteria 2282
192 Ga0326468_10002643 3300031889 Bacteria 1502
193 Ga0307406_10256128 3300031901 Bacteria 1321
194 Ga0307412_10090087 3300031911 Bacteria 2143
195 Ga0307409_100142369 3300031995 Bacteria 2068
196 Ga0307409_100323829 3300031995 Bacteria 1444
197 Ga0307416_100348470 3300032002 Bacteria 1497
198 Ga0307416_101246170 3300032002 Bacteria 849
199 Ga0307411_10384167 3300032005 Bacteria 1156
200 Ga0307415_100267184 3300032126 Bacteria 1399
201 Ga0373930_0050230 3300034816 Bacteria 909
202 Ga0373946_0162642 3300035171 Bacteria 1049
203 Ga0373931_0257495 3300035691 Bacteria 1063
204 Ga0373935_0139327 3300035692 Bacteria 1638
205 Ga0373937_0471056 3300036401 Bacteria 1193
206 Ga0395898_0016433 3300037466 Bacteria 7572
207 Ga0436364_0364613 3300037853 Bacteria 9775
208 Ga0436365_0772011 3300039437 Bacteria 6691
209 Ga0436365_0831899 3300039437 Bacteria 1400
210 Ga0436362_1089291 3300039453 Bacteria 6789
211 Ga0466969_0006648 3300044656 Bacteria 6142
212 Ga0466969_0031464 3300044656 Bacteria 2701
213 Ga0466966_0200480 3300044684 Bacteria 1207
214 Ga0466961_0111668 3300044693 Bacteria 1719
215 Ga0466971_0006878 3300044719 Bacteria 4945
216 Ga0466970_0204059 3300044765 Bacteria 1100
217 Ga0466959_0110169 3300045049 Bacteria 1965
218 Ga0466959_0249305 3300045049 Bacteria 1225
219 Ga0451576_0043180 3300045051 Bacteria 4757
220 Ga0451576_0594540 3300045051 Bacteria 1163
221 Ga0495629_0407562 3300046459 Bacteria 924
222 Ga0495653_0216100 3300046463 Bacteria 1292
223 Ga0495618_0132267 3300046514 Bacteria 1596
224 Ga0495630_0117307 3300046517 Unclassified 2018
225 Ga0495586_0112757 3300046535 Unclassified 1514
226 Ga0495621_0001984 3300046539 Bacteria 5384
227 Ga0495634_0290957 3300046642 Bacteria 990
228 Ga0495657_0134957 3300046675 Bacteria 1543
229 Ga0495657_0143761 3300046675 Bacteria 1485
230 Ga0495658_0098490 3300046683 Unclassified 1742
231 Ga0495581_0072060 3300047315 Bacteria 1999
232 Ga0495676_0358936 3300047321 Bacteria 973
233 Ga0495680_0067765 3300047322 Bacteria 2728
234 Ga0495684_0187323 3300047471 Bacteria 1532
235 Ga0496104_0295352 3300048907 Bacteria 1533
236 Ga0496104_0607459 3300048907 Bacteria 1004
237 Ga0496109_0000324 3300048912 Bacteria 44591
238 Ga0496109_0528780 3300048912 Bacteria 1113
239 Ga0496111_0032309 3300048914 Unclassified 3731
240 Ga0496112_0000906 3300048915 Bacteria 21374
241 Ga0496113_0345988 3300048916 Bacteria 1192
242 Ga0501033_0061185 3300049570 Bacteria 2775
243 Ga0501036_0094837 3300049572 Bacteria 2522
244 Ga0501037_0097255 3300049573 Bacteria 2127
245 Ga0501039_0067681 3300049575 Bacteria 2773
246 Ga0501040_0002399 3300049576 Bacteria 12060
247 Ga0501041_0040558 3300049577 Bacteria 2826
248 Ga0501042_0012384 3300049578 Bacteria 5776
249 Ga0501043_0177211 3300049579 Bacteria 1662
250 Ga0501068_0043269 3300049584 Bacteria 2709
251 Ga0501071_0123338 3300049587 Bacteria 1921
252 Ga0501072_0039585 3300049588 Bacteria 3700
253 Ga0501073_0165248 3300049589 Bacteria 1533
254 Ga0501074_0064245 3300049590 Bacteria 2643
255 Ga0501075_0122560 3300049591 Bacteria 1978
256 Ga0501077_0066822 3300049593 Bacteria 2280
257 Ga0501079_0029811 3300049741 Bacteria 4190
258 Ga0501081_0006339 3300049743 Bacteria 7671
259 Ga0501083_0131365 3300049744 Bacteria 1642
260 Ga0501035_0195749 3300049822 Bacteria 1736
261 Ga0501045_0008504 3300049824 Bacteria 7154
262 nmdc:mga0yw44_174086_c1 3300050492 Bacteria 1414
263 nmdc:mga05p37_167394_c1 3300050507 Bacteria 2682
264 nmdc:mga05p37_283898_c1 3300050507 Bacteria 1973
265 nmdc:mga05p37_307993_c1 3300050507 Bacteria 1878
266 nmdc:mga05p37_35141_c1 3300050507 Bacteria 6144
267 nmdc:mga05p37_662431_c1 3300050507 Bacteria 1167
268 nmdc:mga05p37_9905_c1 3300050507 Bacteria 11310
269 nmdc:mga09592_1097_c1 3300050508 Bacteria 21484
270 nmdc:mga09592_33716_c1 3300050508 Bacteria 4277
271 nmdc:mga0qj67_13109_c1 3300050509 Bacteria 6261
272 nmdc:mga0qj67_17501_c1 3300050509 Bacteria 5450
273 nmdc:mga0qj67_20876_c1 3300050509 Bacteria 5018
274 nmdc:mga0qj67_75842_c1 3300050509 Bacteria 2688
275 nmdc:mga0qj67_8009_c1 3300050509 Bacteria 7816
276 nmdc:mga0qj67_95058_c1 3300050509 Bacteria 2398
277 nmdc:mga06r32_175435_c1 3300050510 Bacteria 2127
278 nmdc:mga06r32_213336_c1 3300050510 Bacteria 1918
279 nmdc:mga06r32_319576_c1 3300050510 Bacteria 1538
280 nmdc:mga06r32_38110_c1 3300050510 Bacteria 4552
281 nmdc:mga06r32_3986_c1 3300050510 Bacteria 13228
282 nmdc:mga06r32_69088_c1 3300050510 Bacteria 3414
283 nmdc:mga08y16_219094_c1 3300050511 Bacteria 1970
284 nmdc:mga08y16_266710_c1 3300050511 Bacteria 1768
285 nmdc:mga0n895_65712_c1 3300050512 Bacteria 3591
286 nmdc:mga0rr50_393200_c1 3300050513 Bacteria 1170
287 nmdc:mga08x19_346386_c1 3300050514 Bacteria 1037
288 nmdc:mga0a205_268097_c1 3300050515 Bacteria 1585
289 nmdc:mga0a205_497162_c1 3300050515 Bacteria 1077
290 Ga0495619_0096412 3300053085 Bacteria 2008
291 Ga0500637_0012518 3300053178 Bacteria 4423
292 Ga0501084_0000052 3300054114 Bacteria 92225
293 Ga0501084_0015582 3300054114 Bacteria 6304
294 Ga0501082_0136391 3300060353 Bacteria 2129
295 Ga0466962_0003678 3300061719 Bacteria 7309
296 Ga0530510_0006283 3300061734 Bacteria 8268
297 8056830815 8056829672 Bacteria 9045328
298 nmdc:mga06z11_75551_c1
299 MBSR1b_contig_741326
300 Ga0065712_10072910
301 Ga0065715_10153677
302 Ga0070658_10002066
303 Ga0070676_10061328
304 Ga0070670_100212158
305 Ga0068869_100001082
306 Ga0070680_100124925
307 Ga0070680_100506603
308 Ga0068868_100066309
309 Ga0070660_100005353
310 Ga0070689_100025232
311 Ga0070687_100057989
312 Ga0070661_100012450
313 Ga0070668_100046908
314 Ga0070669_100010712
315 Ga0070669_100252702
316 Ga0070675_100002472
317 Ga0070675_100202746
318 Ga0070671_100194875
319 Ga0070674_100215791
320 Ga0070673_100000998
321 Ga0070688_100006483
322 Ga0070667_100172521
323 Ga0070701_10026017
324 Ga0070705_100006509
325 Ga0070700_100055513
326 Ga0070678_100009125
327 Ga0070662_100007616
328 Ga0070662_100157512
329 Ga0070681_10171934
330 Ga0068867_100039786
331 Ga0070685_10018386
332 Ga0070706_100004608
333 Ga0070706_100005155
334 Ga0070706_100064904
335 Ga0070706_100401159
336 Ga0070707_100182080
337 Ga0070698_100355104
338 Ga0070699_100006173
339 Ga0070699_100036104
340 Ga0070684_100001445
341 Ga0070697_100044312
342 Ga0070665_100013614
343 Ga0070704_100085736
344 Ga0070664_100000604
345 Ga0068857_100009893
346 Ga0070702_100005722
347 Ga0068859_100001971
348 Ga0068864_100003446
349 Ga0068864_100626101
350 Ga0068864_100667360
351 Ga0068866_10276861
352 Ga0068861_100001164
353 Ga0068861_100087879
354 Ga0068870_10083277
355 Ga0068863_100003146
356 Ga0068862_100005680
357 Ga0070717_10030840
358 Ga0075365_10305661
359 Ga0075364_10249502
360 Ga0075367_10013024
361 Ga0097621_100059865
362 Ga0075428_100009410
363 Ga0075428_100009500
364 Ga0075428_100064312
365 Ga0075428_100076330
366 Ga0075428_100112982
367 Ga0075428_100147954
368 Ga0075430_100001164
369 Ga0075430_100020940
370 Ga0075430_100023321
371 Ga0075430_100531447
372 Ga0075431_100003059
373 Ga0075431_100005895
374 Ga0075431_100034779
375 Ga0075431_100042986
376 Ga0075431_100088842
377 Ga0075431_100095823
378 Ga0075431_100139481
379 Ga0075431_100494036
380 Ga0075431_100591090
381 Ga0075433_10034160
382 Ga0075429_100002874
383 Ga0075429_100004258
384 Ga0075429_100083445
385 Ga0075429_100243584
386 Ga0075429_100393673
387 Ga0075436_100283169
388 Ga0097620_100001971
389 Ga0075435_100132428
390 Ga0075435_100180624
391 Ga0111539_10005375
392 Ga0111539_10012103
393 Ga0111539_10118956
394 Ga0111539_10218275
395 Ga0111539_10451503
396 Ga0105245_10140225
397 Ga0105245_10347183
398 Ga0114129_10008587
399 Ga0114129_10046168
400 Ga0114129_10163638
401 Ga0114129_10201988
402 Ga0114129_10247908
403 Ga0114129_10327193
404 Ga0114129_10468710
405 Ga0114129_10667674
406 Ga0105242_10035068
407 Ga0105242_10188733
408 Ga0105248_10007148
409 Ga0105249_10043294
410 Ga0105249_10218055
411 Ga0157369_10003007
412 Ga0157374_10383414
413 Ga0157378_10108044
414 Ga0157378_11003775
415 Ga0163162_10016335
416 Ga0163162_10551692
417 Ga0157372_10240225
418 Ga0157380_10302098
419 Ga0157377_10028199
420 Ga0157377_10105451
421 Ga0163161_10790158
422 Ga0197907_11381497
423 Ga0213876_10015836
424 Ga0224712_10034938
425 Ga0207642_10260361
426 Ga0207688_10028218
427 Ga0207645_10019563
428 Ga0207643_10105496
429 Ga0207684_10003870
430 Ga0207684_10018712
431 Ga0207684_10098830
432 Ga0207684_10373743
433 Ga0207707_10134280
434 Ga0207660_10012861
435 Ga0207662_10012568
436 Ga0207657_10011220
437 Ga0207649_10010239
438 Ga0207681_10190189
439 Ga0207659_10070379
440 Ga0207706_10002609
441 Ga0207706_10185551
442 Ga0207686_10111685
443 Ga0207669_10076071
444 Ga0207691_10020265
445 Ga0207711_10053363
446 Ga0207679_10001459
447 Ga0207651_10083754
448 Ga0207712_10005886
449 Ga0207712_10033209
450 Ga0207668_10002934
451 Ga0207658_10128670
452 Ga0207677_10022614
453 Ga0207703_10006504
454 Ga0207708_10002391
455 Ga0207708_10064057
456 Ga0207648_10195279
457 Ga0207676_10000876
458 Ga0207674_10164018
459 Ga0207675_100012713
460 Ga0207675_100016332
461 Ga0207675_100325346
462 Ga0207683_10006209
463 Ga0207428_10014783
464 Ga0268266_10029526
465 Ga0268265_10001740
466 Ga0268265_10004508
467 Ga0268265_10451897
468 Ga0265337_1003278
469 Ga0265338_10001565
470 Ga0265330_10006082
471 Ga0265332_10000060
472 Ga0265328_10005870
473 Ga0265320_10000334
474 Ga0265320_10028938
475 Ga0265325_10001402
476 Ga0265329_10008727
477 Ga0265340_10063952
478 Ga0265339_10209506
479 Ga0265331_10000191
480 Ga0265316_10000158
481 Ga0307408_100089342
482 Ga0307408_100112739
483 Ga0265313_10000915
484 Ga0265314_10000259
485 Ga0265314_10133594
486 Ga0307405_10181937
487 Ga0307405_10511083
488 Ga0307410_10080793
489 Ga0326468_10002643
490 Ga0307406_10256128
491 Ga0307412_10090087
492 Ga0307409_100142369
493 Ga0307409_100323829
494 Ga0307416_100348470
495 Ga0307416_101246170
496 Ga0307411_10384167
497 Ga0307415_100267184
498 Ga0373930_0050230
499 Ga0373946_0162642
500 Ga0373931_0257495
501 Ga0373935_0139327
502 Ga0373937_0471056
503 Ga0395898_0016433
504 Ga0436364_0364613
505 Ga0436365_0772011
506 Ga0436365_0831899
507 Ga0436362_1089291
508 Ga0466969_0006648
509 Ga0466969_0031464
510 Ga0466966_0200480
511 Ga0466961_0111668
512 Ga0466971_0006878
513 Ga0466970_0204059
514 Ga0466959_0110169
515 Ga0466959_0249305
516 Ga0451576_0043180
517 Ga0451576_0594540
518 Ga0495629_0407562
519 Ga0495653_0216100
520 Ga0495618_0132267
521 Ga0495630_0117307
522 Ga0495586_0112757
523 Ga0495621_0001984
524 Ga0495634_0290957
525 Ga0495657_0134957
526 Ga0495657_0143761
527 Ga0495658_0098490
528 Ga0495581_0072060
529 Ga0495676_0358936
530 Ga0495680_0067765
531 Ga0495684_0187323
532 Ga0496104_0295352
533 Ga0496104_0607459
534 Ga0496109_0000324
535 Ga0496109_0528780
536 Ga0496111_0032309
537 Ga0496112_0000906
538 Ga0496113_0345988
539 Ga0501033_0061185
540 Ga0501036_0094837
541 Ga0501037_0097255
542 Ga0501039_0067681
543 Ga0501040_0002399
544 Ga0501041_0040558
545 Ga0501042_0012384
546 Ga0501043_0177211
547 Ga0501068_0043269
548 Ga0501071_0123338
549 Ga0501072_0039585
550 Ga0501073_0165248
551 Ga0501074_0064245
552 Ga0501075_0122560
553 Ga0501077_0066822
554 Ga0501079_0029811
555 Ga0501081_0006339
556 Ga0501083_0131365
557 Ga0501035_0195749
558 Ga0501045_0008504
559 nmdc:mga0yw44_174086_c1
560 nmdc:mga05p37_167394_c1
561 nmdc:mga05p37_283898_c1
562 nmdc:mga05p37_307993_c1
563 nmdc:mga05p37_35141_c1
564 nmdc:mga05p37_662431_c1
565 nmdc:mga05p37_9905_c1
566 nmdc:mga09592_1097_c1
567 nmdc:mga09592_33716_c1
568 nmdc:mga0qj67_13109_c1
569 nmdc:mga0qj67_17501_c1
570 nmdc:mga0qj67_20876_c1
571 nmdc:mga0qj67_75842_c1
572 nmdc:mga0qj67_8009_c1
573 nmdc:mga0qj67_95058_c1
574 nmdc:mga06r32_175435_c1
575 nmdc:mga06r32_213336_c1
576 nmdc:mga06r32_319576_c1
577 nmdc:mga06r32_38110_c1
578 nmdc:mga06r32_3986_c1
579 nmdc:mga06r32_69088_c1
580 nmdc:mga08y16_219094_c1
581 nmdc:mga08y16_266710_c1
582 nmdc:mga0n895_65712_c1
583 nmdc:mga0rr50_393200_c1
584 nmdc:mga08x19_346386_c1
585 nmdc:mga0a205_268097_c1
586 nmdc:mga0a205_497162_c1
587 Ga0495619_0096412
588 Ga0500637_0012518
589 Ga0501084_0000052
590 Ga0501084_0015582
591 Ga0501082_0136391
592 Ga0466962_0003678
593 Ga0530510_0006283
594 8056830815

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

59

245

0.95

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

60

291

0.94

PF08659

KR

KR domain

61

233

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3edm-assembly1.cif.gz_D crystal structure of a short chain dehydrogenase from agrobacterium tumefaciens 0.9538 24 271
3o38-assembly1.cif.gz_B crystal structure of a short chain dehydrogenase from mycobacterium smegmatis 0.9525 21 271
3edm-assembly1.cif.gz_C crystal structure of a short chain dehydrogenase from agrobacterium tumefaciens 0.9475 24 271
4mow-assembly1.cif.gz_C crystal structure of a putative glucose 1-dehydrogenase from burkholderia cenocepacia j2315 0.9473 24 273
6ixm-assembly1.cif.gz_B crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. ca49 complexed with nad 0.9466 23 277
ID Description Score Start End Superfamily
6ixmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9466 23 277 3.40.50.720
6ixmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9427 23 277 3.40.50.720
5t5qC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9424 25 274 3.40.50.720
3v2gA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9409 25 273 3.40.50.720
4mowD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9399 24 273 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A534R4B1-F1-model_v4 SDR family oxidoreductase 0.9776 46 278
AF-A0A3C1L4U9-F1-model_v4 Oxidoreductase 0.9753 23 278 GO:0016491
AF-A0A7W5DFJ6-F1-model_v4 NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family)/alkylhydroperoxidase family enzyme 0.9739 14 278 GO:0016616
GO:0051920
AF-A0A2P1VKP9-F1-model_v4 deleted 0.9732 14 275
AF-A0A150ZIJ2-F1-model_v4 deleted 0.9725 17 277

Map