F393902

General Info

Members Datasets Scaffolds Average Seq Length
297 204 594 187

Family's Representative Sequence

Representative Sequence 3300048918|Ga0496115_0184524|Ga0496115_0184524_880_1527
Length 215
Sequence MGIAWGIACRLPLAPGTVGTSINFAPGELMAATVGTQRHRAVLAGVLLAGCAVAVALGVYAHVHDPALKPLFLFGFSGMLQLKTWLATAALVFVVVQLITALWMWGRLPGAGPASPGVSVLHRWSGALAFITLTPVAVHCLWALGFATDSARTLVHSIAGCVFYGAYASKMIGLRVRGLPGWTLPVLGGLVFAALILAWATSAVWFFTRSGLPLT

Samples

Sample ID Description Type Environment
1 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
130 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
131 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
132 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
133 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
134 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
135 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
136 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
137 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
140 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
141 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
142 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
143 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
144 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
145 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
146 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
147 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
148 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
149 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
154 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
155 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
156 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
157 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
158 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
159 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
160 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
176 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
177 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
178 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
179 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
185 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
188 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
189 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
192 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
193 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
194 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
195 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
196 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
198 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
199 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
200 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
201 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
202 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
203 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
204 8002775197 Frankia nepalensis CN7 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.97
Metatranscriptomes 1.01
Isolates 2.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.67
Rhizoplane 12.12
Rhizosphere 83.84
Stem 0
Stem Tuber 0
Unclassified 7.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496115_0184524 3300048918 Bacteria 1724
2 JGI24738J21930_10039200 3300002075 Bacteria 963
3 Ga0070658_10001170 3300005327 Bacteria 22398
4 Ga0070658_10044117 3300005327 Bacteria 3603
5 Ga0070658_10106686 3300005327 Bacteria 2318
6 Ga0070683_100139991 3300005329 Unclassified 2292
7 Ga0070683_100677830 3300005329 Bacteria 987
8 Ga0070690_100110943 3300005330 Bacteria 1830
9 Ga0068869_100009255 3300005334 Bacteria 6386
10 Ga0070666_10019516 3300005335 Bacteria 4378
11 Ga0070680_100002504 3300005336 Bacteria 13608
12 Ga0070680_100301969 3300005336 Bacteria 1358
13 Ga0070680_100579100 3300005336 Bacteria 963
14 Ga0068868_100061936 3300005338 Bacteria 2964
15 Ga0070660_100015548 3300005339 Bacteria 5498
16 Ga0070691_10004430 3300005341 Bacteria 6382
17 Ga0070687_100047010 3300005343 Bacteria 2212
18 Ga0070661_101014334 3300005344 Bacteria 689
19 Ga0070692_10025925 3300005345 Bacteria 2893
20 Ga0070673_100237114 3300005364 Bacteria 1584
21 Ga0070659_100033828 3300005366 Bacteria 3973
22 Ga0070667_100151304 3300005367 Bacteria 2039
23 Ga0070703_10035731 3300005406 Bacteria 1523
24 Ga0070714_100566736 3300005435 Unclassified 1088
25 Ga0070713_100504930 3300005436 Bacteria 1141
26 Ga0070710_10021986 3300005437 Bacteria 3331
27 Ga0070710_10308839 3300005437 Bacteria 1034
28 Ga0070711_100015245 3300005439 Bacteria 4862
29 Ga0070705_100013792 3300005440 Bacteria 4140
30 Ga0070694_100001336 3300005444 Bacteria 14378
31 Ga0070663_100024015 3300005455 Bacteria 4096
32 Ga0070678_100301643 3300005456 Bacteria 1361
33 Ga0070662_100004612 3300005457 Bacteria 8731
34 Ga0070681_10000167 3300005458 Bacteria 50063
35 Ga0070707_100306901 3300005468 Bacteria 1542
36 Ga0070679_100000070 3300005530 Bacteria 76125
37 Ga0070684_100057176 3300005535 Bacteria 3405
38 Ga0070684_100215910 3300005535 Bacteria 1749
39 Ga0070697_100256504 3300005536 Bacteria 1496
40 Ga0068853_100040559 3300005539 Bacteria 3973
41 Ga0070686_100016656 3300005544 Bacteria 4279
42 Ga0070696_100208575 3300005546 Bacteria 1462
43 Ga0070693_100086020 3300005547 Bacteria 1885
44 Ga0070665_100228244 3300005548 Bacteria 1862
45 Ga0070665_100277392 3300005548 Bacteria 1678
46 Ga0070704_100008205 3300005549 Bacteria 6248
47 Ga0068855_100102307 3300005563 Bacteria 3297
48 Ga0068852_100302501 3300005616 Bacteria 1549
49 Ga0068859_100032581 3300005617 Bacteria 5234
50 Ga0068864_100137275 3300005618 Bacteria 2203
51 Ga0068864_100144123 3300005618 Bacteria 2151
52 Ga0068866_10006180 3300005718 Bacteria 4985
53 Ga0068861_100006222 3300005719 Bacteria 8118
54 Ga0068863_100028374 3300005841 Bacteria 5343
55 Ga0068858_100000056 3300005842 Bacteria 118532
56 Ga0068858_100023213 3300005842 Bacteria 5785
57 Ga0068860_100146832 3300005843 Bacteria 2269
58 Ga0068862_100000100 3300005844 Bacteria 103461
59 Ga0068862_100297014 3300005844 Bacteria 1485
60 Ga0081540_1035313 3300005983 Bacteria 2682
61 Ga0070715_10071093 3300006163 Bacteria 1555
62 Ga0070716_100026233 3300006173 Bacteria 3118
63 Ga0097621_100038708 3300006237 Bacteria 3826
64 Ga0068871_100330417 3300006358 Unclassified 1344
65 Ga0075433_10213473 3300006852 Bacteria 1715
66 Ga0075434_100029567 3300006871 Bacteria 5391
67 Ga0097620_100000173 3300006931 Bacteria 62829
68 Ga0097620_100032582 3300006931 Bacteria 5234
69 Ga0075435_100012484 3300007076 Bacteria 6294
70 Ga0105240_10173746 3300009093 Bacteria 2549
71 Ga0105245_10026866 3300009098 Bacteria 5068
72 Ga0105245_10391756 3300009098 Bacteria 1386
73 Ga0105247_10088193 3300009101 Bacteria 1966
74 Ga0105247_10550601 3300009101 Bacteria 848
75 Ga0105247_10777026 3300009101 Bacteria 728
76 Ga0105243_10126545 3300009148 Bacteria 2162
77 Ga0105241_10071691 3300009174 Bacteria 2690
78 Ga0105248_11330413 3300009177 Bacteria 813
79 Ga0105237_10343082 3300009545 Bacteria 1498
80 Ga0105237_10608418 3300009545 Bacteria 1100
81 Ga0105238_10173039 3300009551 Bacteria 2136
82 Ga0105249_10005228 3300009553 Bacteria 11203
83 Ga0105249_10018671 3300009553 Bacteria 6175
84 Ga0105239_10429881 3300010375 Bacteria 1497
85 Ga0105239_10524160 3300010375 Bacteria 1348
86 Ga0157373_10072574 3300013100 Bacteria 2429
87 Ga0157370_10109770 3300013104 Bacteria 2579
88 Ga0157370_10142592 3300013104 Bacteria 2232
89 Ga0157369_10143240 3300013105 Bacteria 2528
90 Ga0157369_10192389 3300013105 Bacteria 2143
91 Ga0157369_10325810 3300013105 Bacteria 1597
92 Ga0157374_10413497 3300013296 Bacteria 1347
93 Ga0157374_10913104 3300013296 Bacteria 896
94 Ga0157378_10129334 3300013297 Bacteria 2336
95 Ga0163162_10005630 3300013306 Bacteria 12104
96 Ga0157372_10449221 3300013307 Bacteria 1502
97 Ga0157372_11142388 3300013307 Bacteria 901
98 Ga0157375_10512718 3300013308 Unclassified 1363
99 Ga0157375_11417219 3300013308 Bacteria 819
100 Ga0163163_10014662 3300014325 Bacteria 7207
101 Ga0163163_10035499 3300014325 Bacteria 4837
102 Ga0157380_10483889 3300014326 Bacteria 1198
103 Ga0157379_10000569 3300014968 Bacteria 29859
104 Ga0157379_10023138 3300014968 Bacteria 5511
105 Ga0163161_10002681 3300017792 Bacteria 12654
106 Ga0206352_10434199 3300020078 Unclassified 667
107 Ga0206353_11573871 3300020082 Bacteria 2624
108 Ga0213876_10107769 3300021384 Bacteria 1478
109 Ga0207692_10449213 3300025898 Bacteria 811
110 Ga0207642_10122823 3300025899 Unclassified 1342
111 Ga0207710_10000008 3300025900 Bacteria 485312
112 Ga0207688_10009433 3300025901 Bacteria 5313
113 Ga0207680_10076665 3300025903 Bacteria 2088
114 Ga0207685_10023969 3300025905 Bacteria 2085
115 Ga0207705_10001051 3300025909 Bacteria 22448
116 Ga0207705_10120339 3300025909 Bacteria 1948
117 Ga0207705_10182199 3300025909 Bacteria 1585
118 Ga0207707_10000153 3300025912 Bacteria 72436
119 Ga0207671_10343604 3300025914 Bacteria 1183
120 Ga0207693_10009870 3300025915 Bacteria 7765
121 Ga0207663_10264191 3300025916 Bacteria 1272
122 Ga0207660_10000090 3300025917 Bacteria 49164
123 Ga0207660_10476319 3300025917 Bacteria 1011
124 Ga0207657_10004182 3300025919 Bacteria 15297
125 Ga0207652_10000520 3300025921 Bacteria 39057
126 Ga0207652_10853671 3300025921 Bacteria 806
127 Ga0207646_10151287 3300025922 Bacteria 2093
128 Ga0207681_10213141 3300025923 Unclassified 1490
129 Ga0207694_10428026 3300025924 Bacteria 1103
130 Ga0207687_10009242 3300025927 Bacteria 6447
131 Ga0207700_10023736 3300025928 Bacteria 4235
132 Ga0207709_10092893 3300025935 Bacteria 1977
133 Ga0207669_10089942 3300025937 Bacteria 1995
134 Ga0207665_10000203 3300025939 Bacteria 39944
135 Ga0207689_10002491 3300025942 Bacteria 17104
136 Ga0207661_10104789 3300025944 Unclassified 2382
137 Ga0207667_10216696 3300025949 Bacteria 1961
138 Ga0207667_10275804 3300025949 Bacteria 1719
139 Ga0207651_10049834 3300025960 Bacteria 2840
140 Ga0207712_10009483 3300025961 Bacteria 6158
141 Ga0207712_10067684 3300025961 Bacteria 2557
142 Ga0207668_10026264 3300025972 Bacteria 3779
143 Ga0207640_10046385 3300025981 Bacteria 2796
144 Ga0207677_10728581 3300026023 Bacteria 882
145 Ga0207703_10000014 3300026035 Bacteria 304317
146 Ga0207703_10841555 3300026035 Bacteria 877
147 Ga0207639_10239013 3300026041 Bacteria 1578
148 Ga0207678_10070428 3300026067 Bacteria 2999
149 Ga0207708_10030388 3300026075 Bacteria 4095
150 Ga0207702_10477899 3300026078 Bacteria 1212
151 Ga0207641_10247249 3300026088 Bacteria 1664
152 Ga0207676_10133963 3300026095 Bacteria 2111
153 Ga0207676_10173078 3300026095 Bacteria 1883
154 Ga0207675_100002252 3300026118 Bacteria 19189
155 Ga0207683_10007530 3300026121 Bacteria 9332
156 Ga0207698_10127116 3300026142 Bacteria 2170
157 Ga0268266_10246192 3300028379 Bacteria 1652
158 Ga0268265_10000110 3300028380 Bacteria 103447
159 Ga0268264_10270933 3300028381 Bacteria 1586
160 Ga0307409_100964379 3300031995 Bacteria 869
161 Ga0307416_100590951 3300032002 Bacteria 1189
162 Ga0307414_10474548 3300032004 Bacteria 1102
163 Ga0373950_0013158 3300034818 Bacteria 1376
164 Ga0373938_0001403 3300034957 Bacteria 3856
165 Ga0373951_0046518 3300035091 Unclassified 1058
166 Ga0373932_0045989 3300035112 Bacteria 1278
167 Ga0373939_0004075 3300035114 Bacteria 3442
168 Ga0373941_0005529 3300035115 Bacteria 2979
169 Ga0373942_0012706 3300035207 Bacteria 2016
170 Ga0373962_0055824 3300035242 Bacteria 1148
171 Ga0373931_0010592 3300035691 Bacteria 4433
172 Ga0395900_0006356 3300037418 Bacteria 12318
173 Ga0395900_0167337 3300037418 Bacteria 2240
174 Ga0436365_0967439 3300039437 Bacteria 1482
175 Ga0466969_0038173 3300044656 Bacteria 2418
176 Ga0466969_0163600 3300044656 Bacteria 1022
177 Ga0466972_0220640 3300044658 Bacteria 887
178 Ga0466965_0037975 3300044683 Bacteria 2365
179 Ga0466965_0217264 3300044683 Bacteria 1018
180 Ga0466965_0304064 3300044683 Bacteria 866
181 Ga0466961_0008041 3300044693 Bacteria 6721
182 Ga0466961_0015513 3300044693 Bacteria 4888
183 Ga0466961_0022670 3300044693 Bacteria 4039
184 Ga0466961_0751097 3300044693 Unclassified 583
185 Ga0466963_0016954 3300044694 Bacteria 4538
186 Ga0466963_0017911 3300044694 Bacteria 4421
187 Ga0466963_0026597 3300044694 Bacteria 3701
188 Ga0466963_0076274 3300044694 Bacteria 2263
189 Ga0466963_0139984 3300044694 Bacteria 1676
190 Ga0466963_0178286 3300044694 Bacteria 1483
191 Ga0466963_0336839 3300044694 Bacteria 1062
192 Ga0466963_0338048 3300044694 Archaea 1060
193 Ga0466963_0486317 3300044694 Unclassified 871
194 Ga0466964_0035586 3300044706 Bacteria 1992
195 Ga0466964_0068087 3300044706 Bacteria 1498
196 Ga0466964_0140367 3300044706 Bacteria 1110
197 Ga0466964_0628922 3300044706 Bacteria 592
198 Ga0466971_0023146 3300044719 Bacteria 2769
199 Ga0466971_0034687 3300044719 Bacteria 2261
200 Ga0466970_0062750 3300044765 Bacteria 1992
201 Ga0466970_0079615 3300044765 Bacteria 1769
202 Ga0466970_0206831 3300044765 Unclassified 1093
203 Ga0466970_0228831 3300044765 Bacteria 1039
204 Ga0466957_0040463 3300044842 Bacteria 2815
205 Ga0466957_0366492 3300044842 Bacteria 980
206 Ga0466960_0264498 3300044901 Bacteria 959
207 Ga0466959_0054887 3300045049 Bacteria 2910
208 Ga0466959_0084948 3300045049 Bacteria 2278
209 Ga0466959_0128121 3300045049 Bacteria 1800
210 Ga0466959_0275137 3300045049 Bacteria 1157
211 Ga0466959_0617899 3300045049 Unclassified 728
212 Ga0466958_0011974 3300045836 Bacteria 4901
213 Ga0466958_0111931 3300045836 Bacteria 1704
214 Ga0466958_0214154 3300045836 Unclassified 1228
215 Ga0466967_0002714 3300045976 Bacteria 11186
216 Ga0466967_0016291 3300045976 Bacteria 5856
217 Ga0466967_0062876 3300045976 Bacteria 3296
218 Ga0466967_0101622 3300045976 Bacteria 2628
219 Ga0466967_0170711 3300045976 Bacteria 2046
220 Ga0466967_0412497 3300045976 Bacteria 1315
221 Ga0466967_0429104 3300045976 Bacteria 1289
222 Ga0495641_0030163 3300046461 Bacteria 2604
223 Ga0495608_0137242 3300046511 Bacteria 1562
224 Ga0495630_0435272 3300046517 Bacteria 1005
225 Ga0495648_0025861 3300046524 Bacteria 3964
226 Ga0495635_0519372 3300046663 Bacteria 783
227 Ga0495635_0564406 3300046663 Unclassified 745
228 Ga0495613_0584828 3300046689 Bacteria 744
229 Ga0495624_0279463 3300046690 Bacteria 1008
230 Ga0495680_0353452 3300047322 Bacteria 1023
231 Ga0496101_0355507 3300048904 Bacteria 1151
232 Ga0496102_1086951 3300048905 Bacteria 720
233 Ga0496103_0265895 3300048906 Bacteria 1103
234 Ga0496104_0039071 3300048907 Bacteria 4442
235 Ga0496104_0098181 3300048907 Bacteria 2803
236 Ga0496104_0217216 3300048907 Bacteria 1824
237 Ga0496105_0028889 3300048908 Bacteria 4537
238 Ga0496105_0258870 3300048908 Unclassified 1408
239 Ga0496106_0184489 3300048909 Bacteria 1657
240 Ga0496107_0142182 3300048910 Bacteria 1774
241 Ga0496107_0579009 3300048910 Unclassified 830
242 Ga0496108_0030293 3300048911 Bacteria 4484
243 Ga0496108_0041248 3300048911 Bacteria 3852
244 Ga0496108_0410476 3300048911 Bacteria 1183
245 Ga0496108_1367045 3300048911 Bacteria 593
246 Ga0496109_0009407 3300048912 Bacteria 8328
247 Ga0496109_0012913 3300048912 Bacteria 7222
248 Ga0496109_0232061 3300048912 Bacteria 1736
249 Ga0496110_0091838 3300048913 Bacteria 2716
250 Ga0496110_0135230 3300048913 Bacteria 2227
251 Ga0496110_0502061 3300048913 Bacteria 1104
252 Ga0496111_0010717 3300048914 Bacteria 6166
253 Ga0496111_0790276 3300048914 Unclassified 687
254 Ga0496112_0122988 3300048915 Bacteria 2565
255 Ga0496112_0380848 3300048915 Bacteria 1352
256 Ga0496112_1409146 3300048915 Bacteria 611
257 Ga0496113_0047789 3300048916 Bacteria 3181
258 Ga0496113_0138287 3300048916 Bacteria 1915
259 Ga0496114_0011276 3300048917 Bacteria 7137
260 Ga0496114_0113861 3300048917 Bacteria 2319
261 Ga0496114_0368684 3300048917 Unclassified 1271
262 Ga0496114_0406151 3300048917 Bacteria 1206
263 Ga0496115_0103791 3300048918 Bacteria 2332
264 Ga0496115_0127124 3300048918 Bacteria 2100
265 Ga0496115_0163216 3300048918 Bacteria 1842
266 Ga0496119_0009784 3300048922 Bacteria 8157
267 Ga0496121_0010326 3300048924 Bacteria 10554
268 Ga0496124_0436477 3300048927 Bacteria 897
269 Ga0496126_0000055 3300048929 Bacteria 297958
270 Ga0496126_0685889 3300048929 Bacteria 798
271 Ga0501031_0036423 3300049568 Bacteria 3209
272 Ga0501033_0141282 3300049570 Bacteria 1740
273 Ga0501036_0077865 3300049572 Bacteria 2805
274 Ga0501037_0129934 3300049573 Bacteria 1806
275 Ga0501038_0039877 3300049574 Bacteria 4106
276 Ga0501070_0074354 3300049586 Bacteria 2813
277 Ga0501071_0019568 3300049587 Bacteria 4698
278 Ga0501072_0067511 3300049588 Bacteria 2822
279 Ga0501074_0406055 3300049590 Bacteria 966
280 Ga0501075_0030879 3300049591 Bacteria 3973
281 Ga0501081_0569972 3300049743 Bacteria 846
282 Ga0501045_0321867 3300049824 Bacteria 1151
283 nmdc:mga0n895_24036_c1 3300050512 Bacteria 5737
284 nmdc:mga08x19_113271_c1 3300050514 Bacteria 1811
285 nmdc:mga0a205_306724_c1 3300050515 Bacteria 1460
286 Ga0495595_0541998 3300053084 Bacteria 594
287 Ga0495619_0631243 3300053085 Unclassified 732
288 Ga0587128_060646 3300059630 Bacteria 714
289 Ga0501082_0077670 3300060353 Bacteria 2863
290 Ga0466962_0005017 3300061719 Bacteria 6365
291 Ga0466962_0138522 3300061719 Unclassified 1178
292 2644526999 2643221694 Bacteria 4392972
293 2644670268 2643221722 Bacteria 4247614
294 2686537464 2684623035 Bacteria 8032739
295 2689994798 2687453743 Bacteria 8361025
296 2895881789 2895880812 Bacteria 11255272
297 8002782975 8002775197 Bacteria 10728764
298 Ga0496115_0184524
299 JGI24738J21930_10039200
300 Ga0070658_10001170
301 Ga0070658_10044117
302 Ga0070658_10106686
303 Ga0070683_100139991
304 Ga0070683_100677830
305 Ga0070690_100110943
306 Ga0068869_100009255
307 Ga0070666_10019516
308 Ga0070680_100002504
309 Ga0070680_100301969
310 Ga0070680_100579100
311 Ga0068868_100061936
312 Ga0070660_100015548
313 Ga0070691_10004430
314 Ga0070687_100047010
315 Ga0070661_101014334
316 Ga0070692_10025925
317 Ga0070673_100237114
318 Ga0070659_100033828
319 Ga0070667_100151304
320 Ga0070703_10035731
321 Ga0070714_100566736
322 Ga0070713_100504930
323 Ga0070710_10021986
324 Ga0070710_10308839
325 Ga0070711_100015245
326 Ga0070705_100013792
327 Ga0070694_100001336
328 Ga0070663_100024015
329 Ga0070678_100301643
330 Ga0070662_100004612
331 Ga0070681_10000167
332 Ga0070707_100306901
333 Ga0070679_100000070
334 Ga0070684_100057176
335 Ga0070684_100215910
336 Ga0070697_100256504
337 Ga0068853_100040559
338 Ga0070686_100016656
339 Ga0070696_100208575
340 Ga0070693_100086020
341 Ga0070665_100228244
342 Ga0070665_100277392
343 Ga0070704_100008205
344 Ga0068855_100102307
345 Ga0068852_100302501
346 Ga0068859_100032581
347 Ga0068864_100137275
348 Ga0068864_100144123
349 Ga0068866_10006180
350 Ga0068861_100006222
351 Ga0068863_100028374
352 Ga0068858_100000056
353 Ga0068858_100023213
354 Ga0068860_100146832
355 Ga0068862_100000100
356 Ga0068862_100297014
357 Ga0081540_1035313
358 Ga0070715_10071093
359 Ga0070716_100026233
360 Ga0097621_100038708
361 Ga0068871_100330417
362 Ga0075433_10213473
363 Ga0075434_100029567
364 Ga0097620_100000173
365 Ga0097620_100032582
366 Ga0075435_100012484
367 Ga0105240_10173746
368 Ga0105245_10026866
369 Ga0105245_10391756
370 Ga0105247_10088193
371 Ga0105247_10550601
372 Ga0105247_10777026
373 Ga0105243_10126545
374 Ga0105241_10071691
375 Ga0105248_11330413
376 Ga0105237_10343082
377 Ga0105237_10608418
378 Ga0105238_10173039
379 Ga0105249_10005228
380 Ga0105249_10018671
381 Ga0105239_10429881
382 Ga0105239_10524160
383 Ga0157373_10072574
384 Ga0157370_10109770
385 Ga0157370_10142592
386 Ga0157369_10143240
387 Ga0157369_10192389
388 Ga0157369_10325810
389 Ga0157374_10413497
390 Ga0157374_10913104
391 Ga0157378_10129334
392 Ga0163162_10005630
393 Ga0157372_10449221
394 Ga0157372_11142388
395 Ga0157375_10512718
396 Ga0157375_11417219
397 Ga0163163_10014662
398 Ga0163163_10035499
399 Ga0157380_10483889
400 Ga0157379_10000569
401 Ga0157379_10023138
402 Ga0163161_10002681
403 Ga0206352_10434199
404 Ga0206353_11573871
405 Ga0213876_10107769
406 Ga0207692_10449213
407 Ga0207642_10122823
408 Ga0207710_10000008
409 Ga0207688_10009433
410 Ga0207680_10076665
411 Ga0207685_10023969
412 Ga0207705_10001051
413 Ga0207705_10120339
414 Ga0207705_10182199
415 Ga0207707_10000153
416 Ga0207671_10343604
417 Ga0207693_10009870
418 Ga0207663_10264191
419 Ga0207660_10000090
420 Ga0207660_10476319
421 Ga0207657_10004182
422 Ga0207652_10000520
423 Ga0207652_10853671
424 Ga0207646_10151287
425 Ga0207681_10213141
426 Ga0207694_10428026
427 Ga0207687_10009242
428 Ga0207700_10023736
429 Ga0207709_10092893
430 Ga0207669_10089942
431 Ga0207665_10000203
432 Ga0207689_10002491
433 Ga0207661_10104789
434 Ga0207667_10216696
435 Ga0207667_10275804
436 Ga0207651_10049834
437 Ga0207712_10009483
438 Ga0207712_10067684
439 Ga0207668_10026264
440 Ga0207640_10046385
441 Ga0207677_10728581
442 Ga0207703_10000014
443 Ga0207703_10841555
444 Ga0207639_10239013
445 Ga0207678_10070428
446 Ga0207708_10030388
447 Ga0207702_10477899
448 Ga0207641_10247249
449 Ga0207676_10133963
450 Ga0207676_10173078
451 Ga0207675_100002252
452 Ga0207683_10007530
453 Ga0207698_10127116
454 Ga0268266_10246192
455 Ga0268265_10000110
456 Ga0268264_10270933
457 Ga0307409_100964379
458 Ga0307416_100590951
459 Ga0307414_10474548
460 Ga0373950_0013158
461 Ga0373938_0001403
462 Ga0373951_0046518
463 Ga0373932_0045989
464 Ga0373939_0004075
465 Ga0373941_0005529
466 Ga0373942_0012706
467 Ga0373962_0055824
468 Ga0373931_0010592
469 Ga0395900_0006356
470 Ga0395900_0167337
471 Ga0436365_0967439
472 Ga0466969_0038173
473 Ga0466969_0163600
474 Ga0466972_0220640
475 Ga0466965_0037975
476 Ga0466965_0217264
477 Ga0466965_0304064
478 Ga0466961_0008041
479 Ga0466961_0015513
480 Ga0466961_0022670
481 Ga0466961_0751097
482 Ga0466963_0016954
483 Ga0466963_0017911
484 Ga0466963_0026597
485 Ga0466963_0076274
486 Ga0466963_0139984
487 Ga0466963_0178286
488 Ga0466963_0336839
489 Ga0466963_0338048
490 Ga0466963_0486317
491 Ga0466964_0035586
492 Ga0466964_0068087
493 Ga0466964_0140367
494 Ga0466964_0628922
495 Ga0466971_0023146
496 Ga0466971_0034687
497 Ga0466970_0062750
498 Ga0466970_0079615
499 Ga0466970_0206831
500 Ga0466970_0228831
501 Ga0466957_0040463
502 Ga0466957_0366492
503 Ga0466960_0264498
504 Ga0466959_0054887
505 Ga0466959_0084948
506 Ga0466959_0128121
507 Ga0466959_0275137
508 Ga0466959_0617899
509 Ga0466958_0011974
510 Ga0466958_0111931
511 Ga0466958_0214154
512 Ga0466967_0002714
513 Ga0466967_0016291
514 Ga0466967_0062876
515 Ga0466967_0101622
516 Ga0466967_0170711
517 Ga0466967_0412497
518 Ga0466967_0429104
519 Ga0495641_0030163
520 Ga0495608_0137242
521 Ga0495630_0435272
522 Ga0495648_0025861
523 Ga0495635_0519372
524 Ga0495635_0564406
525 Ga0495613_0584828
526 Ga0495624_0279463
527 Ga0495680_0353452
528 Ga0496101_0355507
529 Ga0496102_1086951
530 Ga0496103_0265895
531 Ga0496104_0039071
532 Ga0496104_0098181
533 Ga0496104_0217216
534 Ga0496105_0028889
535 Ga0496105_0258870
536 Ga0496106_0184489
537 Ga0496107_0142182
538 Ga0496107_0579009
539 Ga0496108_0030293
540 Ga0496108_0041248
541 Ga0496108_0410476
542 Ga0496108_1367045
543 Ga0496109_0009407
544 Ga0496109_0012913
545 Ga0496109_0232061
546 Ga0496110_0091838
547 Ga0496110_0135230
548 Ga0496110_0502061
549 Ga0496111_0010717
550 Ga0496111_0790276
551 Ga0496112_0122988
552 Ga0496112_0380848
553 Ga0496112_1409146
554 Ga0496113_0047789
555 Ga0496113_0138287
556 Ga0496114_0011276
557 Ga0496114_0113861
558 Ga0496114_0368684
559 Ga0496114_0406151
560 Ga0496115_0103791
561 Ga0496115_0127124
562 Ga0496115_0163216
563 Ga0496119_0009784
564 Ga0496121_0010326
565 Ga0496124_0436477
566 Ga0496126_0000055
567 Ga0496126_0685889
568 Ga0501031_0036423
569 Ga0501033_0141282
570 Ga0501036_0077865
571 Ga0501037_0129934
572 Ga0501038_0039877
573 Ga0501070_0074354
574 Ga0501071_0019568
575 Ga0501072_0067511
576 Ga0501074_0406055
577 Ga0501075_0030879
578 Ga0501081_0569972
579 Ga0501045_0321867
580 nmdc:mga0n895_24036_c1
581 nmdc:mga08x19_113271_c1
582 nmdc:mga0a205_306724_c1
583 Ga0495595_0541998
584 Ga0495619_0631243
585 Ga0587128_060646
586 Ga0501082_0077670
587 Ga0466962_0005017
588 Ga0466962_0138522
589 2644526999
590 2644670268
591 2686537464
592 2689994798
593 2895881789
594 8002782975

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20139

DUF6529

Family of unknown function (DUF6529)

42

214

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6s37-assembly1.cif.gz_B ligand binding domain of the p. putida receptor pcay_pp in complex with salicylic acid 0.503 56 179
6s37-assembly1.cif.gz_B ligand binding domain of the p. putida receptor pcay_pp in complex with salicylic acid 0.4867 56 179
6db1-assembly1.cif.gz_B 2.0 angstrom resolution crystal structure of n-terminal ligand-binding domain of putative methyl-accepting chemotaxis protein from salmonella enterica 0.4663 54 179
2l7n-assembly1.cif.gz_A solution structure of the r5 domain of talin 0.4647 12 176
1sj7-assembly2.cif.gz_B crystal structure of talin rod 482-655 0.4602 7 171
ID Description Score Start End Superfamily
af_Q2FXX6_1_89_1.20.58.400 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;t-snare proteins 0.6062 54 119 1.20.58.400
af_A0A0G2KRM1_87_218_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.5965 58 179 1.20.120.350
af_I1KYI2_192_382_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.5813 44 185 2.60.120.200
af_A2ARP9_99_229_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.578 65 175 1.20.120.350
af_B6UBB1_195_391_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5703 48 184 1.20.120.1770
ID Description Score Start End GO Terms
AF-A0A417XU59-F1-model_v4 Uncharacterized protein 0.8985 15 186 GO:0016020
AF-A0A4R0INK2-F1-model_v4 Cytochrome b561 domain-containing protein 0.8959 13 188 GO:0016020
AF-A0A7V9BM61-F1-model_v4 Uncharacterized protein 0.8946 15 185 GO:0016020
AF-A0A7Y6CIM5-F1-model_v4 Yip1 domain-containing protein 0.8931 14 186 GO:0016020
AF-A0A5B8CA89-F1-model_v4 Uncharacterized protein 0.8886 15 188 GO:0016020

Map