F393801

General Info

Members Datasets Scaffolds Average Seq Length
297 141 594 148

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0002087|Ga0395905_0002087_3878_4417
Length 179
Sequence MIEQAECGGSTNGSTNARVKLQGPASMMREVMADKMTGGCACGRVRYTATIHDQDAYLCHCRMCQRSTGSVSIAFKHVKEDEIEWQEEPDWYNSSPIARRPFCATCGTSLGFAFVKSSGTMDITVASFDDPSRFVPKHHFGVESMHRAWLNTEGLKEMRTDDYQALIDKWVDATGSFPG

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
97 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
98 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
102 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
103 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
104 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
109 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
116 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
117 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
118 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
119 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
120 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
121 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
122 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
123 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
126 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
127 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
128 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
129 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
130 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
131 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
132 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
133 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
134 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
137 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
138 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
139 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
140 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
141 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.35
Nodule 0
Rhizoplane 0.67
Rhizosphere 97.64
Stem 0
Stem Tuber 0
Unclassified 4.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0002087 3300037471 Bacteria 22724
2 JGI24737J22298_10191554 3300001990 Unclassified 604
3 Ga0070658_10016005 3300005327 Bacteria 5999
4 Ga0070658_10137313 3300005327 Bacteria 2041
5 Ga0070658_10221086 3300005327 Bacteria 1602
6 Ga0070658_10625851 3300005327 Bacteria 933
7 Ga0070676_10305405 3300005328 Unclassified 1080
8 Ga0070683_100356323 3300005329 Bacteria 1393
9 Ga0070670_100004546 3300005331 Bacteria 11631
10 Ga0070670_100204995 3300005331 Bacteria 1714
11 Ga0070677_10000207 3300005333 Bacteria 20264
12 Ga0070677_10637523 3300005333 Bacteria 594
13 Ga0070666_10008984 3300005335 Bacteria 6221
14 Ga0070680_100455714 3300005336 Bacteria 1093
15 Ga0068868_100014118 3300005338 Bacteria 5880
16 Ga0070660_100000378 3300005339 Bacteria 29634
17 Ga0070660_100042530 3300005339 Bacteria 3468
18 Ga0070660_100049727 3300005339 Bacteria 3224
19 Ga0070660_100051476 3300005339 Bacteria 3172
20 Ga0070660_100069058 3300005339 Bacteria 2755
21 Ga0070660_100497525 3300005339 Bacteria 1014
22 Ga0070687_100226988 3300005343 Bacteria 1147
23 Ga0070661_100047739 3300005344 Bacteria 3134
24 Ga0070661_100118331 3300005344 Bacteria 1982
25 Ga0070692_10024671 3300005345 Bacteria 2957
26 Ga0070668_100065059 3300005347 Bacteria 2828
27 Ga0070669_100513740 3300005353 Bacteria 995
28 Ga0070671_100135388 3300005355 Bacteria 2077
29 Ga0070671_100251583 3300005355 Bacteria 1501
30 Ga0070671_100866252 3300005355 Bacteria 788
31 Ga0070674_100005776 3300005356 Bacteria 7180
32 Ga0070674_100060284 3300005356 Bacteria 2645
33 Ga0070674_100131776 3300005356 Bacteria 1865
34 Ga0070673_100039901 3300005364 Bacteria 3598
35 Ga0070673_100057329 3300005364 Bacteria 3077
36 Ga0070688_101069103 3300005365 Unclassified 644
37 Ga0070688_101574224 3300005365 Bacteria 536
38 Ga0070659_101367176 3300005366 Unclassified 629
39 Ga0070667_100000764 3300005367 Bacteria 30578
40 Ga0070667_100067580 3300005367 Bacteria 3039
41 Ga0070663_100032790 3300005455 Bacteria 3584
42 Ga0070663_100079462 3300005455 Bacteria 2407
43 Ga0070663_100125139 3300005455 Bacteria 1947
44 Ga0070662_100157146 3300005457 Bacteria 1776
45 Ga0070681_10133610 3300005458 Bacteria 2412
46 Ga0070685_10092338 3300005466 Bacteria 1834
47 Ga0070679_100104892 3300005530 Bacteria 2813
48 Ga0068853_100452245 3300005539 Bacteria 1208
49 Ga0068853_100517461 3300005539 Bacteria 1128
50 Ga0070672_100021565 3300005543 Bacteria 4717
51 Ga0070672_100380093 3300005543 Bacteria 1208
52 Ga0070686_100187162 3300005544 Bacteria 1475
53 Ga0070665_100000054 3300005548 Bacteria 244426
54 Ga0070665_100013586 3300005548 Bacteria 8190
55 Ga0070665_100310736 3300005548 Bacteria 1580
56 Ga0070665_100490237 3300005548 Bacteria 1240
57 Ga0068855_100000480 3300005563 Bacteria 49187
58 Ga0070664_100002920 3300005564 Bacteria 13834
59 Ga0070664_100013383 3300005564 Bacteria 6683
60 Ga0068852_100248752 3300005616 Bacteria 1702
61 Ga0068859_100186063 3300005617 Bacteria 2161
62 Ga0068864_100184781 3300005618 Bacteria 1907
63 Ga0068866_10018022 3300005718 Bacteria 3187
64 Ga0068851_10021723 3300005834 Bacteria 3117
65 Ga0068863_100124434 3300005841 Bacteria 2460
66 Ga0068858_100006383 3300005842 Bacteria 11487
67 Ga0068860_100198023 3300005843 Bacteria 1946
68 Ga0081539_10011233 3300005985 Bacteria 7120
69 Ga0068871_102184398 3300006358 Bacteria 527
70 Ga0075434_100720339 3300006871 Bacteria 1015
71 Ga0068865_100046480 3300006881 Bacteria 2979
72 Ga0097620_100186068 3300006931 Bacteria 2161
73 Ga0105240_12029865 3300009093 Bacteria 597
74 Ga0111539_10391281 3300009094 Bacteria 1619
75 Ga0105245_12306649 3300009098 Bacteria 592
76 Ga0105242_11042944 3300009176 Bacteria 828
77 Ga0105248_10003028 3300009177 Bacteria 18640
78 Ga0105249_10249261 3300009553 Bacteria 1760
79 Ga0157371_10003143 3300013102 Bacteria 15227
80 Ga0157371_10265687 3300013102 Bacteria 1237
81 Ga0157374_10203129 3300013296 Bacteria 1941
82 Ga0157372_10323263 3300013307 Bacteria 1796
83 Ga0163163_10093571 3300014325 Bacteria 3022
84 Ga0157380_10058554 3300014326 Bacteria 3071
85 Ga0157380_10278175 3300014326 Bacteria 1530
86 Ga0207688_10185565 3300025901 Bacteria 1242
87 Ga0207688_10485964 3300025901 Unclassified 772
88 Ga0207680_10001490 3300025903 Bacteria 11062
89 Ga0207680_10666484 3300025903 Bacteria 745
90 Ga0207647_10096336 3300025904 Bacteria 1761
91 Ga0207647_10236641 3300025904 Bacteria 1049
92 Ga0207647_10337691 3300025904 Bacteria 854
93 Ga0207645_10286278 3300025907 Unclassified 1095
94 Ga0207645_10337938 3300025907 Bacteria 1006
95 Ga0207705_10000396 3300025909 Bacteria 38250
96 Ga0207705_10005369 3300025909 Bacteria 9581
97 Ga0207705_10011057 3300025909 Bacteria 6543
98 Ga0207705_10074519 3300025909 Bacteria 2464
99 Ga0207705_10085626 3300025909 Bacteria 2302
100 Ga0207705_10111233 3300025909 Bacteria 2024
101 Ga0207662_10231443 3300025918 Bacteria 1207
102 Ga0207657_10004245 3300025919 Bacteria 15178
103 Ga0207657_10070002 3300025919 Bacteria 2974
104 Ga0207657_10150362 3300025919 Bacteria 1897
105 Ga0207657_10497458 3300025919 Bacteria 955
106 Ga0207649_10037564 3300025920 Bacteria 2926
107 Ga0207652_10334966 3300025921 Bacteria 1366
108 Ga0207681_10329810 3300025923 Bacteria 1216
109 Ga0207650_10136288 3300025925 Bacteria 1926
110 Ga0207650_10837273 3300025925 Bacteria 780
111 Ga0207687_11437418 3300025927 Bacteria 592
112 Ga0207644_10090846 3300025931 Bacteria 2276
113 Ga0207644_10109880 3300025931 Bacteria 2084
114 Ga0207644_10197778 3300025931 Bacteria 1584
115 Ga0207690_10026361 3300025932 Bacteria 3659
116 Ga0207706_10062831 3300025933 Bacteria 3270
117 Ga0207669_10002334 3300025937 Bacteria 8083
118 Ga0207669_10043824 3300025937 Unclassified 2623
119 Ga0207669_10128540 3300025937 Bacteria 1736
120 Ga0207691_10008213 3300025940 Bacteria 10029
121 Ga0207691_10109727 3300025940 Bacteria 2455
122 Ga0207691_10281846 3300025940 Bacteria 1430
123 Ga0207711_10000174 3300025941 Bacteria 69263
124 Ga0207661_10318574 3300025944 Bacteria 1397
125 Ga0207679_10032288 3300025945 Bacteria 3673
126 Ga0207679_10047036 3300025945 Bacteria 3132
127 Ga0207667_10011407 3300025949 Bacteria 10329
128 Ga0207651_10002419 3300025960 Bacteria 8920
129 Ga0207651_10043708 3300025960 Bacteria 2993
130 Ga0207668_10343309 3300025972 Bacteria 1246
131 Ga0207668_11384518 3300025972 Unclassified 634
132 Ga0207658_10009714 3300025986 Bacteria 6533
133 Ga0207658_10067691 3300025986 Bacteria 2691
134 Ga0207677_10196339 3300026023 Bacteria 1600
135 Ga0207703_11342071 3300026035 Bacteria 688
136 Ga0207639_10097708 3300026041 Bacteria 2365
137 Ga0207678_10013987 3300026067 Bacteria 7054
138 Ga0207678_10103517 3300026067 Bacteria 2430
139 Ga0207678_10132040 3300026067 Bacteria 2131
140 Ga0207641_10111860 3300026088 Bacteria 2422
141 Ga0207648_11732953 3300026089 Unclassified 586
142 Ga0207676_10404608 3300026095 Bacteria 1276
143 Ga0207675_101824012 3300026118 Bacteria 627
144 Ga0207698_11167376 3300026142 Bacteria 784
145 Ga0209982_1073895 3300027552 Bacteria 559
146 Ga0209971_1087327 3300027682 Bacteria 760
147 Ga0209974_10050465 3300027876 Bacteria 1397
148 Ga0209974_10096980 3300027876 Bacteria 1027
149 Ga0268266_10279784 3300028379 Bacteria 1551
150 Ga0268266_10459044 3300028379 Bacteria 1212
151 Ga0268264_10161038 3300028381 Bacteria 2021
152 Ga0316176_1224042 3300030732 Bacteria 1756
153 Ga0316178_1173969 3300030735 Bacteria 2093
154 Ga0316180_1110192 3300030736 Bacteria 678
155 Ga0307408_100253631 3300031548 Bacteria 1452
156 Ga0307408_100261842 3300031548 Bacteria 1431
157 Ga0307408_100480327 3300031548 Bacteria 1084
158 Ga0307408_100743624 3300031548 Bacteria 885
159 Ga0307405_10023084 3300031731 Bacteria 3529
160 Ga0307405_10073454 3300031731 Bacteria 2208
161 Ga0307405_10141561 3300031731 Bacteria 1678
162 Ga0307405_10332383 3300031731 Bacteria 1165
163 Ga0307405_10509799 3300031731 Bacteria 966
164 Ga0307405_11776939 3300031731 Bacteria 548
165 Ga0307413_10012702 3300031824 Bacteria 4201
166 Ga0307413_10014022 3300031824 Bacteria 4054
167 Ga0307413_10016736 3300031824 Bacteria 3798
168 Ga0307413_10037198 3300031824 Bacteria 2809
169 Ga0307410_10019211 3300031852 Bacteria 4151
170 Ga0307410_10054751 3300031852 Bacteria 2705
171 Ga0307410_10060792 3300031852 Bacteria 2583
172 Ga0307410_10062657 3300031852 Bacteria 2549
173 Ga0307410_10180062 3300031852 Bacteria 1600
174 Ga0307410_10311029 3300031852 Bacteria 1246
175 Ga0307410_10469038 3300031852 Bacteria 1030
176 Ga0307410_10839444 3300031852 Bacteria 784
177 Ga0307406_10043112 3300031901 Bacteria 2820
178 Ga0307406_10089270 3300031901 Bacteria 2070
179 Ga0307406_10518993 3300031901 Bacteria 969
180 Ga0307407_10010641 3300031903 Bacteria 4347
181 Ga0307407_10042407 3300031903 Bacteria 2552
182 Ga0307407_10048570 3300031903 Bacteria 2416
183 Ga0307407_10060722 3300031903 Bacteria 2207
184 Ga0307407_10133577 3300031903 Bacteria 1591
185 Ga0307407_10163942 3300031903 Bacteria 1457
186 Ga0307412_10061313 3300031911 Bacteria 2528
187 Ga0307412_10101571 3300031911 Bacteria 2035
188 Ga0307412_10273998 3300031911 Bacteria 1322
189 Ga0307412_10276939 3300031911 Bacteria 1315
190 Ga0307409_100007226 3300031995 Bacteria 6622
191 Ga0307409_100017326 3300031995 Bacteria 4797
192 Ga0307409_100034188 3300031995 Bacteria 3708
193 Ga0307409_100082104 3300031995 Bacteria 2608
194 Ga0307409_100196268 3300031995 Bacteria 1801
195 Ga0307409_100473136 3300031995 Bacteria 1214
196 Ga0307409_100473373 3300031995 Bacteria 1214
197 Ga0307409_100762098 3300031995 Bacteria 972
198 Ga0307409_101497714 3300031995 Bacteria 702
199 Ga0307409_101536191 3300031995 Bacteria 693
200 Ga0307409_101806065 3300031995 Bacteria 640
201 Ga0307416_100028251 3300032002 Bacteria 4168
202 Ga0307416_100064360 3300032002 Bacteria 3008
203 Ga0307416_100067231 3300032002 Bacteria 2955
204 Ga0307416_100504713 3300032002 Bacteria 1275
205 Ga0307416_100635305 3300032002 Bacteria 1151
206 Ga0307416_100817661 3300032002 Bacteria 1028
207 Ga0307414_10022728 3300032004 Bacteria 3962
208 Ga0307414_10042041 3300032004 Bacteria 3102
209 Ga0307414_10045706 3300032004 Bacteria 3000
210 Ga0307414_10134349 3300032004 Bacteria 1926
211 Ga0307414_10244219 3300032004 Bacteria 1488
212 Ga0307414_11466520 3300032004 Bacteria 635
213 Ga0307411_10024986 3300032005 Bacteria 3570
214 Ga0307411_10037093 3300032005 Bacteria 3061
215 Ga0307411_10049994 3300032005 Bacteria 2720
216 Ga0307411_10088462 3300032005 Bacteria 2154
217 Ga0307411_10126080 3300032005 Bacteria 1862
218 Ga0307411_10173552 3300032005 Bacteria 1628
219 Ga0307411_10346410 3300032005 Bacteria 1209
220 Ga0307411_11243870 3300032005 Bacteria 676
221 Ga0307415_100022654 3300032126 Bacteria 3881
222 Ga0307415_100114014 3300032126 Bacteria 2011
223 Ga0307415_100184301 3300032126 Bacteria 1641
224 Ga0307415_100260364 3300032126 Bacteria 1415
225 Ga0307415_100874620 3300032126 Bacteria 826
226 Ga0307415_101055189 3300032126 Bacteria 758
227 Ga0395899_0048262 3300037312 Bacteria 3169
228 Ga0395899_0163429 3300037312 Bacteria 1572
229 Ga0395899_0288466 3300037312 Bacteria 1114
230 Ga0395899_0601675 3300037312 Bacteria 700
231 Ga0395900_0000503 3300037418 Bacteria 54976
232 Ga0395900_0035122 3300037418 Bacteria 5164
233 Ga0395900_0059234 3300037418 Bacteria 3942
234 Ga0395900_0107117 3300037418 Bacteria 2871
235 Ga0395900_0230844 3300037418 Bacteria 1861
236 Ga0395900_1049749 3300037418 Bacteria 733
237 Ga0395900_1769958 3300037418 Bacteria 528
238 Ga0395898_0305355 3300037466 Bacteria 1518
239 Ga0395898_0320364 3300037466 Bacteria 1479
240 Ga0395898_0404063 3300037466 Bacteria 1302
241 Ga0395898_0440244 3300037466 Bacteria 1242
242 Ga0395898_0488879 3300037466 Bacteria 1171
243 Ga0395898_0921783 3300037466 Bacteria 811
244 Ga0395905_0007001 3300037471 Bacteria 11273
245 Ga0395905_0007247 3300037471 Bacteria 11050
246 Ga0395905_0008869 3300037471 Bacteria 9879
247 Ga0395905_0009804 3300037471 Bacteria 9334
248 Ga0395905_0015848 3300037471 Bacteria 7160
249 Ga0395905_0022062 3300037471 Bacteria 6022
250 Ga0395905_0143557 3300037471 Bacteria 2246
251 Ga0395905_0268328 3300037471 Bacteria 1592
252 Ga0395905_0656594 3300037471 Bacteria 951
253 Ga0395905_1082958 3300037471 Bacteria 705
254 Ga0395901_0000520 3300038443 Bacteria 44464
255 Ga0395901_0023161 3300038443 Bacteria 6367
256 Ga0395901_0025058 3300038443 Bacteria 6123
257 Ga0395901_0034643 3300038443 Bacteria 5215
258 Ga0395901_0039080 3300038443 Bacteria 4910
259 Ga0395901_0044476 3300038443 Bacteria 4606
260 Ga0395901_0064917 3300038443 Bacteria 3800
261 Ga0395901_0182985 3300038443 Bacteria 2198
262 Ga0395901_1321921 3300038443 Bacteria 682
263 Ga0436363_1537081 3300039450 Bacteria 2457
264 Ga0450920_104725 3300042122 Unclassified 589
265 Ga0466965_0064699 3300044683 Bacteria 1831
266 Ga0466966_0102672 3300044684 Bacteria 1767
267 Ga0466966_0220525 3300044684 Bacteria 1145
268 Ga0466961_0056173 3300044693 Bacteria 2508
269 Ga0466961_0374206 3300044693 Unclassified 865
270 Ga0466963_0291770 3300044694 Bacteria 1146
271 Ga0466957_0058034 3300044842 Bacteria 2370
272 Ga0466959_0044434 3300045049 Bacteria 3274
273 Ga0466959_0592819 3300045049 Bacteria 746
274 Ga0466958_0289000 3300045836 Bacteria 1051
275 Ga0466967_2390397 3300045976 Bacteria 524
276 Ga0495620_0170808 3300046515 Bacteria 843
277 Ga0495643_0075551 3300046522 Bacteria 1763
278 Ga0495663_0029084 3300046525 Bacteria 1629
279 Ga0495663_0080099 3300046525 Bacteria 1051
280 Ga0495621_0001681 3300046539 Bacteria 5807
281 Ga0495621_0039064 3300046539 Bacteria 1658
282 Ga0495633_0014086 3300046558 Bacteria 4192
283 Ga0495633_0077518 3300046558 Bacteria 1548
284 Ga0495659_0238882 3300046664 Bacteria 754
285 Ga0495670_0018012 3300046691 Bacteria 3479
286 Ga0495670_0037751 3300046691 Bacteria 2408
287 Ga0495670_0124351 3300046691 Bacteria 1341
288 Ga0495636_0520079 3300047318 Unclassified 577
289 Ga0495677_0012411 3300047445 Bacteria 3108
290 Ga0496109_0072772 3300048912 Bacteria 3158
291 Ga0496112_0194084 3300048915 Bacteria 1992
292 Ga0501081_1420423 3300049743 Bacteria 527
293 nmdc:mga07m45_436624_c1 3300050496 Bacteria 759
294 nmdc:mga06r32_14508_c1 3300050510 Bacteria 1330
295 Ga0500641_0311435 3300053096 Bacteria 643
296 Ga0500568_0003730 3300053139 Bacteria 8347
297 Ga0500616_0000258 3300053153 Bacteria 81750
298 Ga0395905_0002087
299 JGI24737J22298_10191554
300 Ga0070658_10016005
301 Ga0070658_10137313
302 Ga0070658_10221086
303 Ga0070658_10625851
304 Ga0070676_10305405
305 Ga0070683_100356323
306 Ga0070670_100004546
307 Ga0070670_100204995
308 Ga0070677_10000207
309 Ga0070677_10637523
310 Ga0070666_10008984
311 Ga0070680_100455714
312 Ga0068868_100014118
313 Ga0070660_100000378
314 Ga0070660_100042530
315 Ga0070660_100049727
316 Ga0070660_100051476
317 Ga0070660_100069058
318 Ga0070660_100497525
319 Ga0070687_100226988
320 Ga0070661_100047739
321 Ga0070661_100118331
322 Ga0070692_10024671
323 Ga0070668_100065059
324 Ga0070669_100513740
325 Ga0070671_100135388
326 Ga0070671_100251583
327 Ga0070671_100866252
328 Ga0070674_100005776
329 Ga0070674_100060284
330 Ga0070674_100131776
331 Ga0070673_100039901
332 Ga0070673_100057329
333 Ga0070688_101069103
334 Ga0070688_101574224
335 Ga0070659_101367176
336 Ga0070667_100000764
337 Ga0070667_100067580
338 Ga0070663_100032790
339 Ga0070663_100079462
340 Ga0070663_100125139
341 Ga0070662_100157146
342 Ga0070681_10133610
343 Ga0070685_10092338
344 Ga0070679_100104892
345 Ga0068853_100452245
346 Ga0068853_100517461
347 Ga0070672_100021565
348 Ga0070672_100380093
349 Ga0070686_100187162
350 Ga0070665_100000054
351 Ga0070665_100013586
352 Ga0070665_100310736
353 Ga0070665_100490237
354 Ga0068855_100000480
355 Ga0070664_100002920
356 Ga0070664_100013383
357 Ga0068852_100248752
358 Ga0068859_100186063
359 Ga0068864_100184781
360 Ga0068866_10018022
361 Ga0068851_10021723
362 Ga0068863_100124434
363 Ga0068858_100006383
364 Ga0068860_100198023
365 Ga0081539_10011233
366 Ga0068871_102184398
367 Ga0075434_100720339
368 Ga0068865_100046480
369 Ga0097620_100186068
370 Ga0105240_12029865
371 Ga0111539_10391281
372 Ga0105245_12306649
373 Ga0105242_11042944
374 Ga0105248_10003028
375 Ga0105249_10249261
376 Ga0157371_10003143
377 Ga0157371_10265687
378 Ga0157374_10203129
379 Ga0157372_10323263
380 Ga0163163_10093571
381 Ga0157380_10058554
382 Ga0157380_10278175
383 Ga0207688_10185565
384 Ga0207688_10485964
385 Ga0207680_10001490
386 Ga0207680_10666484
387 Ga0207647_10096336
388 Ga0207647_10236641
389 Ga0207647_10337691
390 Ga0207645_10286278
391 Ga0207645_10337938
392 Ga0207705_10000396
393 Ga0207705_10005369
394 Ga0207705_10011057
395 Ga0207705_10074519
396 Ga0207705_10085626
397 Ga0207705_10111233
398 Ga0207662_10231443
399 Ga0207657_10004245
400 Ga0207657_10070002
401 Ga0207657_10150362
402 Ga0207657_10497458
403 Ga0207649_10037564
404 Ga0207652_10334966
405 Ga0207681_10329810
406 Ga0207650_10136288
407 Ga0207650_10837273
408 Ga0207687_11437418
409 Ga0207644_10090846
410 Ga0207644_10109880
411 Ga0207644_10197778
412 Ga0207690_10026361
413 Ga0207706_10062831
414 Ga0207669_10002334
415 Ga0207669_10043824
416 Ga0207669_10128540
417 Ga0207691_10008213
418 Ga0207691_10109727
419 Ga0207691_10281846
420 Ga0207711_10000174
421 Ga0207661_10318574
422 Ga0207679_10032288
423 Ga0207679_10047036
424 Ga0207667_10011407
425 Ga0207651_10002419
426 Ga0207651_10043708
427 Ga0207668_10343309
428 Ga0207668_11384518
429 Ga0207658_10009714
430 Ga0207658_10067691
431 Ga0207677_10196339
432 Ga0207703_11342071
433 Ga0207639_10097708
434 Ga0207678_10013987
435 Ga0207678_10103517
436 Ga0207678_10132040
437 Ga0207641_10111860
438 Ga0207648_11732953
439 Ga0207676_10404608
440 Ga0207675_101824012
441 Ga0207698_11167376
442 Ga0209982_1073895
443 Ga0209971_1087327
444 Ga0209974_10050465
445 Ga0209974_10096980
446 Ga0268266_10279784
447 Ga0268266_10459044
448 Ga0268264_10161038
449 Ga0316176_1224042
450 Ga0316178_1173969
451 Ga0316180_1110192
452 Ga0307408_100253631
453 Ga0307408_100261842
454 Ga0307408_100480327
455 Ga0307408_100743624
456 Ga0307405_10023084
457 Ga0307405_10073454
458 Ga0307405_10141561
459 Ga0307405_10332383
460 Ga0307405_10509799
461 Ga0307405_11776939
462 Ga0307413_10012702
463 Ga0307413_10014022
464 Ga0307413_10016736
465 Ga0307413_10037198
466 Ga0307410_10019211
467 Ga0307410_10054751
468 Ga0307410_10060792
469 Ga0307410_10062657
470 Ga0307410_10180062
471 Ga0307410_10311029
472 Ga0307410_10469038
473 Ga0307410_10839444
474 Ga0307406_10043112
475 Ga0307406_10089270
476 Ga0307406_10518993
477 Ga0307407_10010641
478 Ga0307407_10042407
479 Ga0307407_10048570
480 Ga0307407_10060722
481 Ga0307407_10133577
482 Ga0307407_10163942
483 Ga0307412_10061313
484 Ga0307412_10101571
485 Ga0307412_10273998
486 Ga0307412_10276939
487 Ga0307409_100007226
488 Ga0307409_100017326
489 Ga0307409_100034188
490 Ga0307409_100082104
491 Ga0307409_100196268
492 Ga0307409_100473136
493 Ga0307409_100473373
494 Ga0307409_100762098
495 Ga0307409_101497714
496 Ga0307409_101536191
497 Ga0307409_101806065
498 Ga0307416_100028251
499 Ga0307416_100064360
500 Ga0307416_100067231
501 Ga0307416_100504713
502 Ga0307416_100635305
503 Ga0307416_100817661
504 Ga0307414_10022728
505 Ga0307414_10042041
506 Ga0307414_10045706
507 Ga0307414_10134349
508 Ga0307414_10244219
509 Ga0307414_11466520
510 Ga0307411_10024986
511 Ga0307411_10037093
512 Ga0307411_10049994
513 Ga0307411_10088462
514 Ga0307411_10126080
515 Ga0307411_10173552
516 Ga0307411_10346410
517 Ga0307411_11243870
518 Ga0307415_100022654
519 Ga0307415_100114014
520 Ga0307415_100184301
521 Ga0307415_100260364
522 Ga0307415_100874620
523 Ga0307415_101055189
524 Ga0395899_0048262
525 Ga0395899_0163429
526 Ga0395899_0288466
527 Ga0395899_0601675
528 Ga0395900_0000503
529 Ga0395900_0035122
530 Ga0395900_0059234
531 Ga0395900_0107117
532 Ga0395900_0230844
533 Ga0395900_1049749
534 Ga0395900_1769958
535 Ga0395898_0305355
536 Ga0395898_0320364
537 Ga0395898_0404063
538 Ga0395898_0440244
539 Ga0395898_0488879
540 Ga0395898_0921783
541 Ga0395905_0007001
542 Ga0395905_0007247
543 Ga0395905_0008869
544 Ga0395905_0009804
545 Ga0395905_0015848
546 Ga0395905_0022062
547 Ga0395905_0143557
548 Ga0395905_0268328
549 Ga0395905_0656594
550 Ga0395905_1082958
551 Ga0395901_0000520
552 Ga0395901_0023161
553 Ga0395901_0025058
554 Ga0395901_0034643
555 Ga0395901_0039080
556 Ga0395901_0044476
557 Ga0395901_0064917
558 Ga0395901_0182985
559 Ga0395901_1321921
560 Ga0436363_1537081
561 Ga0450920_104725
562 Ga0466965_0064699
563 Ga0466966_0102672
564 Ga0466966_0220525
565 Ga0466961_0056173
566 Ga0466961_0374206
567 Ga0466963_0291770
568 Ga0466957_0058034
569 Ga0466959_0044434
570 Ga0466959_0592819
571 Ga0466958_0289000
572 Ga0466967_2390397
573 Ga0495620_0170808
574 Ga0495643_0075551
575 Ga0495663_0029084
576 Ga0495663_0080099
577 Ga0495621_0001681
578 Ga0495621_0039064
579 Ga0495633_0014086
580 Ga0495633_0077518
581 Ga0495659_0238882
582 Ga0495670_0018012
583 Ga0495670_0037751
584 Ga0495670_0124351
585 Ga0495636_0520079
586 Ga0495677_0012411
587 Ga0496109_0072772
588 Ga0496112_0194084
589 Ga0501081_1420423
590 nmdc:mga07m45_436624_c1
591 nmdc:mga06r32_14508_c1
592 Ga0500641_0311435
593 Ga0500568_0003730
594 Ga0500616_0000258

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

57

144

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.8589 1 128
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.7895 5 105
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.776 1 128
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.7376 5 105
5m45-assembly2.cif.gz_L structure of acetone carboxylase purified from xanthobacter autotrophicus 0.7056 67 83
ID Description Score Start End Superfamily
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.8797 3 133 3.90.1590.10
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.8675 3 133 3.90.1590.10
af_Q54X87_13_141_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8253 5 102 2.170.150.70
3facD00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.7602 5 105 2.170.150.70
af_Q54VC9_11_133_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.7408 7 108 2.170.150.70
ID Description Score Start End GO Terms
AF-A0A840BSY3-F1-model_v4 CENP-V/GFA domain-containing protein 0.9607 2 147 GO:0016846
GO:0046872
AF-A0A0Q7ABI7-F1-model_v4 CENP-V/GFA domain-containing protein 0.9524 3 148 GO:0016846
GO:0046872
AF-A0A840BSY3-F1-model_v4 CENP-V/GFA domain-containing protein 0.9418 2 147 GO:0016846
GO:0046872
AF-A0A017T0A1-F1-model_v4 Gfa-like protein 0.9372 16 129 GO:0016846
GO:0046872
AF-A0A4R3R7B5-F1-model_v4 CENP-V/GFA domain-containing protein 0.9344 3 129 GO:0016846
GO:0046872

Map