F393771

General Info

Members Datasets Scaffolds Average Seq Length
297 150 594 168

Family's Representative Sequence

Representative Sequence 3300031711|Ga0265314_10220751|Ga0265314_102207513
Length 196
Sequence MVRHLPFLFLADKDCGDAMCVLESERLILRPPRPLDIEAMAVWLSDYDVAKMTSRVPHPYGEEHAEEFLALAPDGRHVFVIERKGDGLFLGMTGLHPADGPKSNYEFGYWLGKPFWGFGYATEAAHRLVRYAFEHLDQQTVQAGWFADNPASGHVLAKLGARHNGSKMRDCRARGRAVLCHDMLLTRADFLRKQAA

Samples

Sample ID Description Type Environment
1 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
59 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
60 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
61 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
93 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
94 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
97 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
98 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
99 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
100 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
101 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
102 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
103 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
104 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
105 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
106 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
115 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
116 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
117 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
121 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
122 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
123 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
124 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
125 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
126 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
127 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
128 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
129 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
140 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
141 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
142 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
143 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
144 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
147 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
148 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
149 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
150 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.04
Nodule 0
Rhizoplane 0
Rhizosphere 93.6
Stem 0
Stem Tuber 0
Unclassified 3.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265314_10220751 3300031711 Bacteria 1106
2 JGI25165J46597_1000047 3300003214 Bacteria 254601
3 JGI25165J46597_1000066 3300003214 Bacteria 199459
4 JGI25153J46596_10000498 3300003215 Bacteria 24974
5 rootH1_10169183 3300003323 Bacteria 1132
6 Ga0070658_10014875 3300005327 Bacteria 6234
7 Ga0070658_10029213 3300005327 Bacteria 4429
8 Ga0070658_10512309 3300005327 Bacteria 1037
9 Ga0070676_10181007 3300005328 Bacteria 1370
10 Ga0070670_100125871 3300005331 Bacteria 2212
11 Ga0070680_100125249 3300005336 Bacteria 2147
12 Ga0068868_100209452 3300005338 Bacteria 1629
13 Ga0068868_100311444 3300005338 Bacteria 1339
14 Ga0070660_100008974 3300005339 Bacteria 7013
15 Ga0070691_10067638 3300005341 Bacteria 1729
16 Ga0070661_100620438 3300005344 Bacteria 876
17 Ga0070671_100329415 3300005355 Bacteria 1301
18 Ga0070667_100190561 3300005367 Bacteria 1816
19 Ga0070710_10115373 3300005437 Bacteria 1619
20 Ga0070700_100723005 3300005441 Bacteria 794
21 Ga0070663_100532541 3300005455 Bacteria 979
22 Ga0070681_10130636 3300005458 Bacteria 2444
23 Ga0070681_10467715 3300005458 Bacteria 1173
24 Ga0070681_10511869 3300005458 Bacteria 1114
25 Ga0068867_100754999 3300005459 Bacteria 863
26 Ga0070679_100060717 3300005530 Bacteria 3767
27 Ga0070679_100107155 3300005530 Bacteria 2780
28 Ga0070679_101036870 3300005530 Unclassified 764
29 Ga0070684_100006137 3300005535 Bacteria 9262
30 Ga0070684_101174308 3300005535 Bacteria 722
31 Ga0068853_100043235 3300005539 Bacteria 3854
32 Ga0068853_100486713 3300005539 Bacteria 1163
33 Ga0068853_100735317 3300005539 Bacteria 942
34 Ga0070672_100882233 3300005543 Bacteria 790
35 Ga0070665_100001530 3300005548 Bacteria 26749
36 Ga0070665_100034091 3300005548 Bacteria 5119
37 Ga0070665_100347634 3300005548 Bacteria 1488
38 Ga0070704_100947715 3300005549 Bacteria 776
39 Ga0068855_100269570 3300005563 Bacteria 1893
40 Ga0068855_100526221 3300005563 Bacteria 1282
41 Ga0068855_100603445 3300005563 Bacteria 1183
42 Ga0068855_100622119 3300005563 Bacteria 1162
43 Ga0068857_100272574 3300005577 Bacteria 1555
44 Ga0068857_100729993 3300005577 Bacteria 942
45 Ga0068856_100499415 3300005614 Bacteria 1237
46 Ga0068852_101150847 3300005616 Bacteria 796
47 Ga0068859_100491680 3300005617 Bacteria 1322
48 Ga0068858_100026372 3300005842 Bacteria 5401
49 Ga0097621_100479691 3300006237 Bacteria 1124
50 Ga0097621_100539705 3300006237 Bacteria 1060
51 Ga0068871_100067148 3300006358 Bacteria 2941
52 Ga0068871_100099722 3300006358 Bacteria 2432
53 Ga0068871_100420445 3300006358 Bacteria 1193
54 Ga0068865_100023313 3300006881 Bacteria 4051
55 Ga0068865_100037192 3300006881 Bacteria 3286
56 Ga0068865_100877148 3300006881 Bacteria 779
57 Ga0097620_100491659 3300006931 Bacteria 1322
58 Ga0105240_10121174 3300009093 Bacteria 3149
59 Ga0105240_10631113 3300009093 Bacteria 1176
60 Ga0105245_10003180 3300009098 Bacteria 14678
61 Ga0105243_10979821 3300009148 Bacteria 847
62 Ga0105241_10360222 3300009174 Bacteria 1265
63 Ga0105241_11177953 3300009174 Bacteria 725
64 Ga0105241_11377822 3300009174 Bacteria 674
65 Ga0105242_10407187 3300009176 Bacteria 1271
66 Ga0105242_11103257 3300009176 Bacteria 808
67 Ga0105248_10082463 3300009177 Bacteria 3616
68 Ga0105248_11484876 3300009177 Bacteria 767
69 Ga0105248_11889934 3300009177 Bacteria 677
70 Ga0105237_10039441 3300009545 Bacteria 4768
71 Ga0105237_10104536 3300009545 Bacteria 2823
72 Ga0105238_10135126 3300009551 Bacteria 2444
73 Ga0105238_10258778 3300009551 Bacteria 1719
74 Ga0105238_10316919 3300009551 Bacteria 1545
75 Ga0105238_10768306 3300009551 Bacteria 978
76 Ga0105238_11012187 3300009551 Unclassified 852
77 Ga0105238_11226509 3300009551 Bacteria 775
78 Ga0105249_10143032 3300009553 Bacteria 2296
79 Ga0105147_108317 3300009982 Bacteria 881
80 Ga0105239_10013335 3300010375 Bacteria 9132
81 Ga0105239_10732514 3300010375 Bacteria 1131
82 Ga0105239_10838018 3300010375 Bacteria 1054
83 Ga0105239_10917720 3300010375 Bacteria 1005
84 Ga0157370_10064535 3300013104 Bacteria 3467
85 Ga0157378_11859447 3300013297 Bacteria 651
86 Ga0163162_10297554 3300013306 Bacteria 1745
87 Ga0163162_10349349 3300013306 Bacteria 1612
88 Ga0163162_10562024 3300013306 Bacteria 1268
89 Ga0163162_11125940 3300013306 Bacteria 890
90 Ga0157372_10983310 3300013307 Bacteria 978
91 Ga0157375_10762465 3300013308 Bacteria 1118
92 Ga0163163_10006118 3300014325 Bacteria 10480
93 Ga0157380_10843434 3300014326 Bacteria 937
94 Ga0157379_10774070 3300014968 Bacteria 904
95 Ga0157379_11621354 3300014968 Unclassified 632
96 Ga0157376_10094019 3300014969 Bacteria 2604
97 Ga0157376_10099692 3300014969 Bacteria 2535
98 Ga0157376_10832020 3300014969 Bacteria 937
99 Ga0157376_11012868 3300014969 Bacteria 853
100 Ga0163161_10058675 3300017792 Bacteria 2797
101 Ga0213876_10023028 3300021384 Bacteria 3291
102 Ga0207427_111663 3300025231 Bacteria 889
103 Ga0209233_1000045 3300025261 Bacteria 473379
104 Ga0209233_1023317 3300025261 Bacteria 1569
105 Ga0209758_1000008 3300025297 Bacteria 1215263
106 Ga0207682_10091685 3300025893 Bacteria 1318
107 Ga0207645_10080540 3300025907 Bacteria 2087
108 Ga0207645_10104809 3300025907 Bacteria 1826
109 Ga0207705_10013994 3300025909 Bacteria 5782
110 Ga0207705_10039294 3300025909 Bacteria 3391
111 Ga0207705_10067451 3300025909 Bacteria 2589
112 Ga0207705_10484681 3300025909 Bacteria 960
113 Ga0207654_10253965 3300025911 Bacteria 1180
114 Ga0207654_10421715 3300025911 Bacteria 931
115 Ga0207707_10044894 3300025912 Bacteria 3852
116 Ga0207707_10078034 3300025912 Bacteria 2891
117 Ga0207695_10007642 3300025913 Bacteria 13697
118 Ga0207695_10032012 3300025913 Bacteria 5760
119 Ga0207695_10296100 3300025913 Bacteria 1510
120 Ga0207695_10354569 3300025913 Bacteria 1354
121 Ga0207671_10384687 3300025914 Bacteria 1115
122 Ga0207660_10088080 3300025917 Bacteria 2295
123 Ga0207660_10543009 3300025917 Bacteria 945
124 Ga0207657_10006000 3300025919 Bacteria 12639
125 Ga0207657_10030468 3300025919 Bacteria 4896
126 Ga0207657_10051314 3300025919 Bacteria 3585
127 Ga0207657_10357466 3300025919 Bacteria 1151
128 Ga0207649_10465799 3300025920 Bacteria 956
129 Ga0207652_10082985 3300025921 Bacteria 2805
130 Ga0207652_10294616 3300025921 Bacteria 1464
131 Ga0207694_10212173 3300025924 Bacteria 1577
132 Ga0207694_10381243 3300025924 Bacteria 1170
133 Ga0207694_10622810 3300025924 Bacteria 908
134 Ga0207694_10798388 3300025924 Bacteria 797
135 Ga0207650_10753468 3300025925 Bacteria 824
136 Ga0207687_10009450 3300025927 Bacteria 6378
137 Ga0207687_10379017 3300025927 Bacteria 1158
138 Ga0207686_10017190 3300025934 Bacteria 4072
139 Ga0207704_10010527 3300025938 Bacteria 4518
140 Ga0207665_10098766 3300025939 Bacteria 2035
141 Ga0207691_10506085 3300025940 Bacteria 1025
142 Ga0207691_10582542 3300025940 Bacteria 948
143 Ga0207691_10957443 3300025940 Unclassified 715
144 Ga0207711_10586204 3300025941 Bacteria 1040
145 Ga0207689_10258415 3300025942 Bacteria 1441
146 Ga0207667_10015436 3300025949 Bacteria 8675
147 Ga0207667_10128134 3300025949 Bacteria 2614
148 Ga0207667_10543083 3300025949 Bacteria 1176
149 Ga0207677_10280861 3300026023 Bacteria 1367
150 Ga0207677_10727035 3300026023 Bacteria 883
151 Ga0207677_11089707 3300026023 Bacteria 728
152 Ga0207703_10007284 3300026035 Bacteria 8795
153 Ga0207703_10631709 3300026035 Bacteria 1015
154 Ga0207639_10491950 3300026041 Bacteria 1119
155 Ga0207639_10625467 3300026041 Bacteria 994
156 Ga0207639_10697736 3300026041 Bacteria 941
157 Ga0207639_10918368 3300026041 Unclassified 818
158 Ga0207678_10589690 3300026067 Bacteria 974
159 Ga0207702_10092173 3300026078 Bacteria 2655
160 Ga0207648_10010545 3300026089 Bacteria 8750
161 Ga0207674_10116133 3300026116 Bacteria 2648
162 Ga0207674_10191189 3300026116 Bacteria 1997
163 Ga0207674_10255404 3300026116 Bacteria 1700
164 Ga0207683_10006190 3300026121 Bacteria 10253
165 Ga0207683_10199484 3300026121 Bacteria 1818
166 Ga0207683_10514024 3300026121 Bacteria 1106
167 Ga0207698_10146143 3300026142 Bacteria 2045
168 Ga0207698_10254999 3300026142 Bacteria 1608
169 Ga0268266_10000357 3300028379 Bacteria 70858
170 Ga0268266_10020420 3300028379 Bacteria 5645
171 Ga0268266_10111910 3300028379 Bacteria 2419
172 Ga0268266_10280523 3300028379 Bacteria 1549
173 Ga0265337_1003137 3300028556 Bacteria 7278
174 Ga0265334_10001214 3300028573 Bacteria 12600
175 Ga0265334_10094823 3300028573 Bacteria 1086
176 Ga0265318_10003625 3300028577 Bacteria 7710
177 Ga0265338_10001374 3300028800 Bacteria 39593
178 Ga0265338_10032504 3300028800 Bacteria 5088
179 Ga0265332_10060025 3300031238 Bacteria 1627
180 Ga0265320_10460319 3300031240 Unclassified 562
181 Ga0265325_10000967 3300031241 Bacteria 20649
182 Ga0265325_10060004 3300031241 Bacteria 1934
183 Ga0265339_10067771 3300031249 Bacteria 1908
184 Ga0265339_10131919 3300031249 Bacteria 1277
185 Ga0265331_10032871 3300031250 Bacteria 2567
186 Ga0265331_10062038 3300031250 Bacteria 1764
187 Ga0265331_10235070 3300031250 Bacteria 823
188 Ga0265316_10301041 3300031344 Bacteria 1168
189 Ga0265316_10388423 3300031344 Unclassified 1006
190 Ga0265316_10628508 3300031344 Bacteria 760
191 Ga0265313_10003138 3300031595 Bacteria 13641
192 Ga0265313_10007299 3300031595 Bacteria 7588
193 Ga0265313_10023463 3300031595 Bacteria 3322
194 Ga0265313_10033419 3300031595 Bacteria 2614
195 Ga0265313_10078887 3300031595 Bacteria 1500
196 Ga0265314_10012564 3300031711 Bacteria 6898
197 Ga0265314_10057847 3300031711 Bacteria 2660
198 Ga0265314_10269928 3300031711 Bacteria 967
199 Ga0265342_10161518 3300031712 Bacteria 1238
200 Ga0265342_10178703 3300031712 Bacteria 1163
201 Ga0307516_10007154 3300031730 Bacteria 12884
202 Ga0307516_10053096 3300031730 Bacteria 3965
203 Ga0373941_0072986 3300035115 Bacteria 1143
204 Ga0373931_0007124 3300035691 Bacteria 5259
205 Ga0373937_0367958 3300036401 Bacteria 1363
206 Ga0373937_1263220 3300036401 Bacteria 687
207 Ga0395899_0231411 3300037312 Bacteria 1276
208 Ga0395899_0301054 3300037312 Bacteria 1085
209 Ga0395900_0256650 3300037418 Bacteria 1747
210 Ga0395900_0606987 3300037418 Bacteria 1034
211 Ga0395898_0071001 3300037466 Bacteria 3365
212 Ga0395898_0192293 3300037466 Bacteria 1950
213 Ga0395898_0584166 3300037466 Bacteria 1059
214 Ga0395905_0809798 3300037471 Bacteria 840
215 Ga0395901_0020328 3300038443 Bacteria 6797
216 Ga0395901_0037055 3300038443 Bacteria 5044
217 Ga0436365_0151405 3300039437 Bacteria 11975
218 Ga0436365_1464692 3300039437 Bacteria 1794
219 Ga0436360_0443588 3300039438 Bacteria 3553
220 Ga0436360_1376640 3300039438 Unclassified 713
221 Ga0436362_0335004 3300039453 Bacteria 838
222 Ga0466964_0353594 3300044706 Unclassified 756
223 Ga0466957_0231206 3300044842 Bacteria 1224
224 Ga0466958_0592843 3300045836 Bacteria 721
225 Ga0466967_0910547 3300045976 Bacteria 875
226 Ga0495638_0196363 3300046460 Bacteria 1142
227 Ga0495650_0126086 3300046471 Bacteria 938
228 Ga0495580_0470346 3300046472 Bacteria 842
229 Ga0495628_0750718 3300046516 Unclassified 686
230 Ga0495665_0019961 3300046531 Bacteria 3603
231 Ga0495587_0061942 3300046536 Bacteria 2192
232 Ga0495622_0002481 3300046557 Bacteria 8925
233 Ga0495669_0196098 3300046684 Bacteria 964
234 Ga0496121_0000342 3300048924 Bacteria 97267
235 Ga0501033_0021557 3300049570 Bacteria 4861
236 Ga0501033_0021827 3300049570 Bacteria 4831
237 Ga0501033_0026413 3300049570 Bacteria 4371
238 Ga0501033_0314123 3300049570 Bacteria 1101
239 Ga0501033_0474281 3300049570 Bacteria 867
240 Ga0501034_0456420 3300049571 Bacteria 1195
241 Ga0501034_0941557 3300049571 Bacteria 750
242 Ga0501034_1255953 3300049571 Bacteria 618
243 Ga0501036_0073577 3300049572 Bacteria 2889
244 Ga0501036_0285784 3300049572 Bacteria 1380
245 Ga0501036_1051086 3300049572 Bacteria 666
246 Ga0501037_0037237 3300049573 Bacteria 3586
247 Ga0501037_0243600 3300049573 Bacteria 1260
248 Ga0501037_0385795 3300049573 Bacteria 962
249 Ga0501037_0722952 3300049573 Bacteria 661
250 Ga0501038_0268872 3300049574 Bacteria 1345
251 Ga0501039_1283829 3300049575 Bacteria 565
252 Ga0501043_0437631 3300049579 Bacteria 984
253 Ga0501043_0518244 3300049579 Bacteria 889
254 Ga0501043_1111292 3300049579 Unclassified 558
255 Ga0501046_0011955 3300049580 Bacteria 7405
256 Ga0501046_0012497 3300049580 Bacteria 7226
257 Ga0501047_0002340 3300049581 Bacteria 18119
258 Ga0501047_0010038 3300049581 Bacteria 8952
259 Ga0501047_0031123 3300049581 Bacteria 5147
260 Ga0501047_0045091 3300049581 Bacteria 4262
261 Ga0501047_0065482 3300049581 Bacteria 3503
262 Ga0501047_0158295 3300049581 Bacteria 2137
263 Ga0501047_0219213 3300049581 Bacteria 1759
264 Ga0501047_0222632 3300049581 Bacteria 1743
265 Ga0501047_0430387 3300049581 Bacteria 1150
266 Ga0501048_0118957 3300049582 Bacteria 1867
267 Ga0501048_0266110 3300049582 Bacteria 1218
268 Ga0501048_0311795 3300049582 Bacteria 1120
269 Ga0501068_0222821 3300049584 Bacteria 1199
270 Ga0501070_0353808 3300049586 Bacteria 1192
271 Ga0501073_0075416 3300049589 Bacteria 2348
272 Ga0501073_0365654 3300049589 Bacteria 996
273 Ga0501074_0239097 3300049590 Bacteria 1292
274 Ga0501080_0062760 3300049742 Bacteria 3458
275 Ga0501080_0290764 3300049742 Bacteria 1484
276 Ga0501080_0761299 3300049742 Bacteria 851
277 Ga0501083_0258939 3300049744 Bacteria 1132
278 Ga0501035_0012962 3300049822 Bacteria 7694
279 Ga0501035_0083978 3300049822 Bacteria 2809
280 Ga0501035_0101593 3300049822 Bacteria 2523
281 Ga0501035_0142726 3300049822 Bacteria 2081
282 Ga0501035_0613710 3300049822 Bacteria 885
283 Ga0501035_0646202 3300049822 Bacteria 858
284 Ga0501035_1177955 3300049822 Bacteria 595
285 Ga0501044_0039450 3300049823 Bacteria 4927
286 Ga0501044_0067318 3300049823 Bacteria 3649
287 Ga0501044_0085404 3300049823 Bacteria 3189
288 Ga0501044_0202606 3300049823 Bacteria 1942
289 Ga0501044_0752778 3300049823 Bacteria 856
290 Ga0501044_0802898 3300049823 Bacteria 820
291 Ga0501044_0852018 3300049823 Bacteria 788
292 Ga0500641_0040832 3300053096 Bacteria 1875
293 Ga0500595_002013 3300053119 Bacteria 10416
294 Ga0500595_041374 3300053119 Bacteria 1481
295 Ga0500595_157897 3300053119 Bacteria 632
296 Ga0500559_0197201 3300053136 Bacteria 949
297 Ga0466962_0433316 3300061719 Bacteria 661
298 Ga0265314_10220751
299 JGI25165J46597_1000047
300 JGI25165J46597_1000066
301 JGI25153J46596_10000498
302 rootH1_10169183
303 Ga0070658_10014875
304 Ga0070658_10029213
305 Ga0070658_10512309
306 Ga0070676_10181007
307 Ga0070670_100125871
308 Ga0070680_100125249
309 Ga0068868_100209452
310 Ga0068868_100311444
311 Ga0070660_100008974
312 Ga0070691_10067638
313 Ga0070661_100620438
314 Ga0070671_100329415
315 Ga0070667_100190561
316 Ga0070710_10115373
317 Ga0070700_100723005
318 Ga0070663_100532541
319 Ga0070681_10130636
320 Ga0070681_10467715
321 Ga0070681_10511869
322 Ga0068867_100754999
323 Ga0070679_100060717
324 Ga0070679_100107155
325 Ga0070679_101036870
326 Ga0070684_100006137
327 Ga0070684_101174308
328 Ga0068853_100043235
329 Ga0068853_100486713
330 Ga0068853_100735317
331 Ga0070672_100882233
332 Ga0070665_100001530
333 Ga0070665_100034091
334 Ga0070665_100347634
335 Ga0070704_100947715
336 Ga0068855_100269570
337 Ga0068855_100526221
338 Ga0068855_100603445
339 Ga0068855_100622119
340 Ga0068857_100272574
341 Ga0068857_100729993
342 Ga0068856_100499415
343 Ga0068852_101150847
344 Ga0068859_100491680
345 Ga0068858_100026372
346 Ga0097621_100479691
347 Ga0097621_100539705
348 Ga0068871_100067148
349 Ga0068871_100099722
350 Ga0068871_100420445
351 Ga0068865_100023313
352 Ga0068865_100037192
353 Ga0068865_100877148
354 Ga0097620_100491659
355 Ga0105240_10121174
356 Ga0105240_10631113
357 Ga0105245_10003180
358 Ga0105243_10979821
359 Ga0105241_10360222
360 Ga0105241_11177953
361 Ga0105241_11377822
362 Ga0105242_10407187
363 Ga0105242_11103257
364 Ga0105248_10082463
365 Ga0105248_11484876
366 Ga0105248_11889934
367 Ga0105237_10039441
368 Ga0105237_10104536
369 Ga0105238_10135126
370 Ga0105238_10258778
371 Ga0105238_10316919
372 Ga0105238_10768306
373 Ga0105238_11012187
374 Ga0105238_11226509
375 Ga0105249_10143032
376 Ga0105147_108317
377 Ga0105239_10013335
378 Ga0105239_10732514
379 Ga0105239_10838018
380 Ga0105239_10917720
381 Ga0157370_10064535
382 Ga0157378_11859447
383 Ga0163162_10297554
384 Ga0163162_10349349
385 Ga0163162_10562024
386 Ga0163162_11125940
387 Ga0157372_10983310
388 Ga0157375_10762465
389 Ga0163163_10006118
390 Ga0157380_10843434
391 Ga0157379_10774070
392 Ga0157379_11621354
393 Ga0157376_10094019
394 Ga0157376_10099692
395 Ga0157376_10832020
396 Ga0157376_11012868
397 Ga0163161_10058675
398 Ga0213876_10023028
399 Ga0207427_111663
400 Ga0209233_1000045
401 Ga0209233_1023317
402 Ga0209758_1000008
403 Ga0207682_10091685
404 Ga0207645_10080540
405 Ga0207645_10104809
406 Ga0207705_10013994
407 Ga0207705_10039294
408 Ga0207705_10067451
409 Ga0207705_10484681
410 Ga0207654_10253965
411 Ga0207654_10421715
412 Ga0207707_10044894
413 Ga0207707_10078034
414 Ga0207695_10007642
415 Ga0207695_10032012
416 Ga0207695_10296100
417 Ga0207695_10354569
418 Ga0207671_10384687
419 Ga0207660_10088080
420 Ga0207660_10543009
421 Ga0207657_10006000
422 Ga0207657_10030468
423 Ga0207657_10051314
424 Ga0207657_10357466
425 Ga0207649_10465799
426 Ga0207652_10082985
427 Ga0207652_10294616
428 Ga0207694_10212173
429 Ga0207694_10381243
430 Ga0207694_10622810
431 Ga0207694_10798388
432 Ga0207650_10753468
433 Ga0207687_10009450
434 Ga0207687_10379017
435 Ga0207686_10017190
436 Ga0207704_10010527
437 Ga0207665_10098766
438 Ga0207691_10506085
439 Ga0207691_10582542
440 Ga0207691_10957443
441 Ga0207711_10586204
442 Ga0207689_10258415
443 Ga0207667_10015436
444 Ga0207667_10128134
445 Ga0207667_10543083
446 Ga0207677_10280861
447 Ga0207677_10727035
448 Ga0207677_11089707
449 Ga0207703_10007284
450 Ga0207703_10631709
451 Ga0207639_10491950
452 Ga0207639_10625467
453 Ga0207639_10697736
454 Ga0207639_10918368
455 Ga0207678_10589690
456 Ga0207702_10092173
457 Ga0207648_10010545
458 Ga0207674_10116133
459 Ga0207674_10191189
460 Ga0207674_10255404
461 Ga0207683_10006190
462 Ga0207683_10199484
463 Ga0207683_10514024
464 Ga0207698_10146143
465 Ga0207698_10254999
466 Ga0268266_10000357
467 Ga0268266_10020420
468 Ga0268266_10111910
469 Ga0268266_10280523
470 Ga0265337_1003137
471 Ga0265334_10001214
472 Ga0265334_10094823
473 Ga0265318_10003625
474 Ga0265338_10001374
475 Ga0265338_10032504
476 Ga0265332_10060025
477 Ga0265320_10460319
478 Ga0265325_10000967
479 Ga0265325_10060004
480 Ga0265339_10067771
481 Ga0265339_10131919
482 Ga0265331_10032871
483 Ga0265331_10062038
484 Ga0265331_10235070
485 Ga0265316_10301041
486 Ga0265316_10388423
487 Ga0265316_10628508
488 Ga0265313_10003138
489 Ga0265313_10007299
490 Ga0265313_10023463
491 Ga0265313_10033419
492 Ga0265313_10078887
493 Ga0265314_10012564
494 Ga0265314_10057847
495 Ga0265314_10269928
496 Ga0265342_10161518
497 Ga0265342_10178703
498 Ga0307516_10007154
499 Ga0307516_10053096
500 Ga0373941_0072986
501 Ga0373931_0007124
502 Ga0373937_0367958
503 Ga0373937_1263220
504 Ga0395899_0231411
505 Ga0395899_0301054
506 Ga0395900_0256650
507 Ga0395900_0606987
508 Ga0395898_0071001
509 Ga0395898_0192293
510 Ga0395898_0584166
511 Ga0395905_0809798
512 Ga0395901_0020328
513 Ga0395901_0037055
514 Ga0436365_0151405
515 Ga0436365_1464692
516 Ga0436360_0443588
517 Ga0436360_1376640
518 Ga0436362_0335004
519 Ga0466964_0353594
520 Ga0466957_0231206
521 Ga0466958_0592843
522 Ga0466967_0910547
523 Ga0495638_0196363
524 Ga0495650_0126086
525 Ga0495580_0470346
526 Ga0495628_0750718
527 Ga0495665_0019961
528 Ga0495587_0061942
529 Ga0495622_0002481
530 Ga0495669_0196098
531 Ga0496121_0000342
532 Ga0501033_0021557
533 Ga0501033_0021827
534 Ga0501033_0026413
535 Ga0501033_0314123
536 Ga0501033_0474281
537 Ga0501034_0456420
538 Ga0501034_0941557
539 Ga0501034_1255953
540 Ga0501036_0073577
541 Ga0501036_0285784
542 Ga0501036_1051086
543 Ga0501037_0037237
544 Ga0501037_0243600
545 Ga0501037_0385795
546 Ga0501037_0722952
547 Ga0501038_0268872
548 Ga0501039_1283829
549 Ga0501043_0437631
550 Ga0501043_0518244
551 Ga0501043_1111292
552 Ga0501046_0011955
553 Ga0501046_0012497
554 Ga0501047_0002340
555 Ga0501047_0010038
556 Ga0501047_0031123
557 Ga0501047_0045091
558 Ga0501047_0065482
559 Ga0501047_0158295
560 Ga0501047_0219213
561 Ga0501047_0222632
562 Ga0501047_0430387
563 Ga0501048_0118957
564 Ga0501048_0266110
565 Ga0501048_0311795
566 Ga0501068_0222821
567 Ga0501070_0353808
568 Ga0501073_0075416
569 Ga0501073_0365654
570 Ga0501074_0239097
571 Ga0501080_0062760
572 Ga0501080_0290764
573 Ga0501080_0761299
574 Ga0501083_0258939
575 Ga0501035_0012962
576 Ga0501035_0083978
577 Ga0501035_0101593
578 Ga0501035_0142726
579 Ga0501035_0613710
580 Ga0501035_0646202
581 Ga0501035_1177955
582 Ga0501044_0039450
583 Ga0501044_0067318
584 Ga0501044_0085404
585 Ga0501044_0202606
586 Ga0501044_0752778
587 Ga0501044_0802898
588 Ga0501044_0852018
589 Ga0500641_0040832
590 Ga0500595_002013
591 Ga0500595_041374
592 Ga0500595_157897
593 Ga0500559_0197201
594 Ga0466962_0433316

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

26

162

0.95

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

38

161

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fbu-assembly2.cif.gz_A the crystal structure of the acetyltransferase (gnat family) from bacillus anthracis 0.893 2 162
3fbu-assembly2.cif.gz_B-2 the crystal structure of the acetyltransferase (gnat family) from bacillus anthracis 0.8871 2 162
2zw7-assembly1.cif.gz_B crystal structure of bleomycin n-acetyltransferase complexed with bleomycin a2 and coenzyme a 0.8719 1 163
3fbu-assembly2.cif.gz_A the crystal structure of the acetyltransferase (gnat family) from bacillus anthracis 0.8626 2 162
3fbu-assembly2.cif.gz_B-2 the crystal structure of the acetyltransferase (gnat family) from bacillus anthracis 0.857 2 162
ID Description Score Start End Superfamily
af_Q54VL6_2_179_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9014 1 166 3.40.630.30
af_A0A0R0ECR9_59_131_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8941 95 165 3.40.630.30
af_Q54L65_11_183_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8932 3 161 3.40.630.30
af_Q3UG98_3_169_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8922 2 143 3.40.630.30
3fbuB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8871 2 162 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A147J5J3-F1-model_v4 N-acetyltransferase domain-containing protein 0.9748 1 162 GO:0016747
AF-A0A2C9DD94-F1-model_v4 Acetyltransferase (GNAT) family protein 0.9588 1 171 GO:0016747
AF-A0A1I7NRT2-F1-model_v4 [ribosomal protein uS5]-alanine N-acetyltransferase (EC 2.3.1.267) 0.9546 1 170 GO:0016747
AF-A0A371X2C6-F1-model_v4 N-acetyltransferase 0.9542 5 171 GO:0016747
AF-A0A7Y7DBN2-F1-model_v4 [ribosomal protein uS5]-alanine N-acetyltransferase (EC 2.3.1.267) 0.9505 2 172 GO:0016747

Map