F393720

General Info

Members Datasets Scaffolds Average Seq Length
297 216 595 174

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10080847|Ga0213876_100808473
Length 192
Sequence VSPATRSHALPAGETNVIEIVLIAAVAENGVIGSGGTMPWRIKSDMAHFRALTIDKPVVMGRKTYLSTSIKPLPRRTNIVITRDKDYAAPGVAVARSLEAALQVARADALRRGTNAIMVIGGADVYAQAMRFADRLEITQIHARPAGDTRFPEINPAIWHEIARQAHPAGAGDDAAYDLVTYRRQTAERTPG

Samples

Sample ID Description Type Environment
1 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
67 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
104 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
105 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
106 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
107 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
108 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
109 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
110 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
111 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
112 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
113 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
114 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
115 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
116 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
117 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
118 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
119 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
120 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
121 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
122 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
123 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
124 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
125 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
126 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
127 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
129 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
133 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
136 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
137 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
140 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
141 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
142 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
143 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
144 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
145 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
146 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
147 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
148 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
149 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
150 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
151 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
152 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
153 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
154 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
155 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
156 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
157 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
160 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
161 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
162 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
163 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
164 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
165 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
166 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
167 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
168 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
169 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
170 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
171 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
172 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
173 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
174 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
175 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
176 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
177 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
178 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
179 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
187 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
188 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
194 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
195 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
196 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
203 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
206 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
207 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
208 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
209 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
212 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
213 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
214 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
215 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
216 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.33
Metatranscriptomes 0.67
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.38
Nodule 0
Rhizoplane 7.41
Rhizosphere 83.16
Stem 0
Stem Tuber 0
Unclassified 0.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213876_10080847 3300021384 Bacteria 1718
2 rootH1_10037357 3300003316 Bacteria 2175
3 rootH1_10037357 3300003323 Bacteria 1596
4 Ga0065715_10237342 3300005293 Bacteria 1185
5 Ga0065707_10223341 3300005295 Bacteria 1214
6 Ga0070683_100116818 3300005329 Bacteria 2519
7 Ga0070690_100098466 3300005330 Bacteria 1935
8 Ga0070690_100641881 3300005330 Bacteria 810
9 Ga0070670_101179154 3300005331 Bacteria 700
10 Ga0068869_100128268 3300005334 Bacteria 1947
11 Ga0070666_10164041 3300005335 Bacteria 1553
12 Ga0070682_100290071 3300005337 Bacteria 1196
13 Ga0070689_100082768 3300005340 Bacteria 2521
14 Ga0070687_100581266 3300005343 Bacteria 767
15 Ga0070661_100153771 3300005344 Bacteria 1740
16 Ga0070675_100476219 3300005354 Bacteria 1122
17 Ga0070671_100639061 3300005355 Bacteria 921
18 Ga0070674_100000199 3300005356 Bacteria 28875
19 Ga0070659_100932158 3300005366 Bacteria 760
20 Ga0070667_100205048 3300005367 Bacteria 1750
21 Ga0070709_10006702 3300005434 Bacteria 6287
22 Ga0070709_10056857 3300005434 Bacteria 2476
23 Ga0070709_10083056 3300005434 Bacteria 2094
24 Ga0070709_10309496 3300005434 Bacteria 1156
25 Ga0070714_100002396 3300005435 Bacteria 13798
26 Ga0070714_100008580 3300005435 Bacteria 7993
27 Ga0070714_100038279 3300005435 Bacteria 4032
28 Ga0070714_100910661 3300005435 Bacteria 854
29 Ga0070714_101046719 3300005435 Bacteria 795
30 Ga0070713_100000639 3300005436 Bacteria 22363
31 Ga0070713_100147689 3300005436 Bacteria 2088
32 Ga0070713_100693580 3300005436 Bacteria 972
33 Ga0070713_100871987 3300005436 Bacteria 865
34 Ga0070710_10000587 3300005437 Bacteria 17296
35 Ga0070710_10028612 3300005437 Bacteria 2982
36 Ga0070710_10083270 3300005437 Bacteria 1872
37 Ga0070711_100002894 3300005439 Bacteria 9893
38 Ga0070711_100078163 3300005439 Bacteria 2350
39 Ga0070711_100541065 3300005439 Bacteria 965
40 Ga0070678_100071292 3300005456 Bacteria 2601
41 Ga0070662_100132422 3300005457 Bacteria 1924
42 Ga0070662_101001782 3300005457 Unclassified 715
43 Ga0070681_10133699 3300005458 Bacteria 2411
44 Ga0070685_10245525 3300005466 Bacteria 1184
45 Ga0070706_100295436 3300005467 Bacteria 1512
46 Ga0070707_100277897 3300005468 Bacteria 1628
47 Ga0070698_100197852 3300005471 Bacteria 1946
48 Ga0070699_100319038 3300005518 Bacteria 1396
49 Ga0068853_100996283 3300005539 Bacteria 806
50 Ga0070672_100674374 3300005543 Bacteria 904
51 Ga0070693_100434002 3300005547 Bacteria 918
52 Ga0068855_100929942 3300005563 Bacteria 917
53 Ga0070664_100065185 3300005564 Bacteria 3108
54 Ga0070664_100614024 3300005564 Bacteria 1009
55 Ga0068857_100364694 3300005577 Bacteria 1339
56 Ga0068856_101233621 3300005614 Bacteria 764
57 Ga0068852_101756317 3300005616 Bacteria 643
58 Ga0068864_100593135 3300005618 Bacteria 1074
59 Ga0068866_10066059 3300005718 Bacteria 1894
60 Ga0068858_100847146 3300005842 Bacteria 893
61 Ga0070717_10014303 3300006028 Bacteria 6103
62 Ga0070717_10163585 3300006028 Bacteria 1932
63 Ga0070717_10364541 3300006028 Bacteria 1294
64 Ga0075365_10902964 3300006038 Bacteria 623
65 Ga0075364_10165271 3300006051 Bacteria 1495
66 Ga0070715_10000260 3300006163 Bacteria 12808
67 Ga0070715_10058758 3300006163 Bacteria 1680
68 Ga0070716_100000213 3300006173 Bacteria 23132
69 Ga0070712_100022001 3300006175 Bacteria 4194
70 Ga0070712_100082962 3300006175 Bacteria 2326
71 Ga0070712_101124192 3300006175 Bacteria 682
72 Ga0068871_100086373 3300006358 Bacteria 2606
73 Ga0075428_100220351 3300006844 Bacteria 2049
74 Ga0075431_100115812 3300006847 Bacteria 2767
75 Ga0075431_100126392 3300006847 Bacteria 2638
76 Ga0075431_100193043 3300006847 Bacteria 2086
77 Ga0105240_10232377 3300009093 Bacteria 2142
78 Ga0105245_10656186 3300009098 Bacteria 1080
79 Ga0114129_10107850 3300009147 Bacteria 3845
80 Ga0105243_10181912 3300009148 Bacteria 1829
81 Ga0105243_10274192 3300009148 Bacteria 1516
82 Ga0105248_10330558 3300009177 Bacteria 1717
83 Ga0105237_10935479 3300009545 Bacteria 874
84 Ga0105238_10011476 3300009551 Bacteria 8924
85 Ga0157373_10643953 3300013100 Bacteria 774
86 Ga0157372_11416002 3300013307 Bacteria 801
87 Ga0157375_10104866 3300013308 Bacteria 2916
88 Ga0163163_10093776 3300014325 Bacteria 3019
89 Ga0157380_10109521 3300014326 Bacteria 2318
90 Ga0209677_100874 3300025253 Bacteria 14845
91 Ga0209148_1009778 3300025254 Bacteria 1848
92 Ga0209233_1000766 3300025261 Bacteria 14467
93 Ga0209455_1011254 3300025272 Bacteria 2214
94 Ga0209130_1030243 3300025284 Bacteria 1121
95 Ga0209564_1000248 3300025295 Bacteria 116617
96 Ga0207682_10000171 3300025893 Bacteria 29817
97 Ga0207692_10000295 3300025898 Bacteria 17307
98 Ga0207692_10046248 3300025898 Bacteria 2181
99 Ga0207642_10534292 3300025899 Bacteria 722
100 Ga0207680_10055239 3300025903 Bacteria 2392
101 Ga0207685_10077989 3300025905 Bacteria 1363
102 Ga0207685_10126635 3300025905 Bacteria 1128
103 Ga0207699_10007555 3300025906 Bacteria 5320
104 Ga0207699_10020384 3300025906 Bacteria 3553
105 Ga0207699_10047019 3300025906 Bacteria 2528
106 Ga0207699_10754980 3300025906 Bacteria 714
107 Ga0207645_10009463 3300025907 Bacteria 6737
108 Ga0207643_10084637 3300025908 Bacteria 1841
109 Ga0207684_10197578 3300025910 Bacteria 1735
110 Ga0207654_10218909 3300025911 Bacteria 1262
111 Ga0207693_10000674 3300025915 Bacteria 30670
112 Ga0207693_10069351 3300025915 Bacteria 2759
113 Ga0207693_10071644 3300025915 Bacteria 2713
114 Ga0207663_10001588 3300025916 Bacteria 10673
115 Ga0207663_10109719 3300025916 Bacteria 1870
116 Ga0207663_10270327 3300025916 Bacteria 1259
117 Ga0207663_10305672 3300025916 Bacteria 1190
118 Ga0207650_10568820 3300025925 Bacteria 951
119 Ga0207700_10007259 3300025928 Bacteria 6760
120 Ga0207700_10054300 3300025928 Bacteria 3006
121 Ga0207664_10037043 3300025929 Bacteria 3772
122 Ga0207664_10392394 3300025929 Bacteria 1233
123 Ga0207664_10743985 3300025929 Bacteria 882
124 Ga0207644_10577252 3300025931 Bacteria 932
125 Ga0207690_11267074 3300025932 Bacteria 616
126 Ga0207706_10010398 3300025933 Bacteria 8501
127 Ga0207706_10559243 3300025933 Bacteria 984
128 Ga0207709_10308105 3300025935 Bacteria 1180
129 Ga0207670_10200290 3300025936 Bacteria 1516
130 Ga0207669_10029742 3300025937 Bacteria 3025
131 Ga0207665_10000214 3300025939 Bacteria 39213
132 Ga0207665_10510206 3300025939 Bacteria 930
133 Ga0207665_10565651 3300025939 Bacteria 885
134 Ga0207691_10004900 3300025940 Bacteria 12937
135 Ga0207689_10124185 3300025942 Bacteria 2124
136 Ga0207661_10038326 3300025944 Bacteria 3756
137 Ga0207712_10536663 3300025961 Bacteria 1004
138 Ga0207658_10200373 3300025986 Bacteria 1666
139 Ga0207703_10476069 3300026035 Bacteria 1170
140 Ga0207639_10561787 3300026041 Bacteria 1049
141 Ga0207641_10333943 3300026088 Bacteria 1441
142 Ga0207674_10129178 3300026116 Bacteria 2491
143 Ga0207683_10000902 3300026121 Bacteria 27333
144 Ga0265763_1000431 3300030763 Bacteria 2496
145 Ga0265332_10000849 3300031238 Bacteria 18521
146 Ga0265328_10148123 3300031239 Bacteria 882
147 Ga0265325_10084773 3300031241 Bacteria 1570
148 Ga0265340_10000517 3300031247 Bacteria 21236
149 Ga0265339_10006654 3300031249 Bacteria 7562
150 Ga0265331_10055762 3300031250 Bacteria 1878
151 Ga0307513_10232324 3300031456 Bacteria 1656
152 Ga0307508_10053920 3300031616 Bacteria 3566
153 Ga0265342_10000360 3300031712 Bacteria 50461
154 Ga0316576_10090364 3300031727 Bacteria 2281
155 Ga0373930_0022902 3300034816 Bacteria 1239
156 Ga0373926_0012416 3300035083 Bacteria 2879
157 Ga0373934_0048135 3300035086 Bacteria 1687
158 Ga0373944_0167258 3300035089 Bacteria 783
159 Ga0373936_0024413 3300035113 Bacteria 2360
160 Ga0373936_0087434 3300035113 Bacteria 1303
161 Ga0373936_0219148 3300035113 Bacteria 843
162 Ga0373945_0156686 3300035116 Bacteria 926
163 Ga0373953_0213685 3300035117 Bacteria 835
164 Ga0373954_0008905 3300035118 Bacteria 4416
165 Ga0373954_0126495 3300035118 Bacteria 1242
166 Ga0373957_0022163 3300035120 Bacteria 2261
167 Ga0373943_0006310 3300035170 Bacteria 5322
168 Ga0373946_0028575 3300035171 Bacteria 2213
169 Ga0373955_0110258 3300035172 Bacteria 1591
170 Ga0316574_0013196 3300035398 Bacteria 4745
171 Ga0373924_0004761 3300035410 Bacteria 4763
172 Ga0373935_0092933 3300035692 Bacteria 1978
173 Ga0373935_0933993 3300035692 Bacteria 643
174 Ga0373933_0000933 3300035724 Bacteria 17845
175 Ga0373933_0032897 3300035724 Bacteria 3014
176 Ga0373933_0210620 3300035724 Bacteria 1245
177 Ga0373947_0192145 3300035725 Bacteria 1332
178 Ga0373937_0024376 3300036401 Bacteria 5456
179 Ga0373937_0138753 3300036401 Bacteria 2274
180 Ga0373937_0287309 3300036401 Bacteria 1554
181 Ga0265778_028781 3300036457 Bacteria 712
182 Ga0316584_0035929 3300036712 Bacteria 3676
183 Ga0373925_0008127 3300037068 Bacteria 7640
184 Ga0373925_0067648 3300037068 Bacteria 2695
185 Ga0395899_0014921 3300037312 Bacteria 5925
186 Ga0436364_0520870 3300037853 Bacteria 550
187 Ga0436365_0171038 3300039437 Bacteria 2705
188 Ga0436365_0207937 3300039437 Bacteria 18457
189 Ga0436365_1605869 3300039437 Bacteria 827
190 Ga0466969_0210099 3300044656 Bacteria 887
191 Ga0466963_0071267 3300044694 Bacteria 2339
192 Ga0466963_0200035 3300044694 Bacteria 1397
193 Ga0466968_0255016 3300044735 Bacteria 834
194 Ga0466970_0407073 3300044765 Bacteria 777
195 Ga0466967_0329016 3300045976 Bacteria 1475
196 Ga0466967_0338451 3300045976 Bacteria 1454
197 Ga0466967_0489226 3300045976 Bacteria 1206
198 Ga0466967_0646562 3300045976 Bacteria 1045
199 Ga0466967_1009101 3300045976 Bacteria 829
200 Ga0466967_1009551 3300045976 Bacteria 828
201 Ga0495592_0018709 3300046454 Bacteria 5273
202 Ga0495629_0177556 3300046459 Bacteria 1477
203 Ga0495629_0597470 3300046459 Bacteria 738
204 Ga0495638_0005101 3300046460 Bacteria 9838
205 Ga0495651_0203208 3300046462 Bacteria 1385
206 Ga0495580_0014157 3300046472 Bacteria 6060
207 Ga0495582_0010213 3300046473 Bacteria 5171
208 Ga0495639_0226333 3300046475 Bacteria 920
209 Ga0495662_0387691 3300046476 Bacteria 686
210 Ga0495664_0154314 3300046477 Bacteria 1393
211 Ga0495608_0114167 3300046511 Bacteria 1735
212 Ga0495618_0020165 3300046514 Bacteria 4104
213 Ga0495628_0027207 3300046516 Bacteria 4656
214 Ga0495630_0441390 3300046517 Bacteria 997
215 Ga0495630_0613932 3300046517 Bacteria 833
216 Ga0495643_0102538 3300046522 Bacteria 1465
217 Ga0495663_0059387 3300046525 Bacteria 1200
218 Ga0495666_0070281 3300046526 Bacteria 1665
219 Ga0495652_0203897 3300046529 Bacteria 1499
220 Ga0495665_0059118 3300046531 Bacteria 2023
221 Ga0495665_0105495 3300046531 Bacteria 1479
222 Ga0495640_0040208 3300046533 Bacteria 3275
223 Ga0495598_0001762 3300046537 Bacteria 4349
224 Ga0495621_0017339 3300046539 Bacteria 2326
225 Ga0495645_0059525 3300046543 Bacteria 2769
226 Ga0495645_0729849 3300046543 Bacteria 599
227 Ga0495634_0441696 3300046642 Bacteria 768
228 Ga0495635_0166189 3300046663 Bacteria 1501
229 Ga0495588_0045146 3300046674 Bacteria 2259
230 Ga0495657_0077523 3300046675 Bacteria 2156
231 Ga0495599_0306556 3300046678 Bacteria 958
232 Ga0495613_0353343 3300046689 Bacteria 1009
233 Ga0495624_0013481 3300046690 Bacteria 5572
234 Ga0495600_0805690 3300046809 Bacteria 559
235 Ga0495581_0022831 3300047315 Bacteria 3624
236 Ga0495604_0427627 3300047317 Bacteria 868
237 Ga0495674_0079882 3300047319 Bacteria 2807
238 Ga0495674_0123439 3300047319 Bacteria 2187
239 Ga0495674_0434280 3300047319 Bacteria 1056
240 Ga0495680_0041930 3300047322 Bacteria 3635
241 Ga0495684_0034978 3300047471 Bacteria 3854
242 Ga0495593_0073224 3300047673 Bacteria 1777
243 Ga0495602_0171926 3300048088 Bacteria 1681
244 Ga0495615_0064424 3300048090 Bacteria 974
245 Ga0496101_0035046 3300048904 Bacteria 3549
246 Ga0496104_0005875 3300048907 Bacteria 10748
247 Ga0496105_0138633 3300048908 Bacteria 2003
248 Ga0496106_0002438 3300048909 Bacteria 13856
249 Ga0496107_0004695 3300048910 Bacteria 9281
250 Ga0496107_0572128 3300048910 Bacteria 836
251 Ga0496108_0001846 3300048911 Bacteria 16935
252 Ga0496109_0001905 3300048912 Bacteria 17328
253 Ga0496110_0163974 3300048913 Bacteria 2015
254 Ga0496110_0175775 3300048913 Bacteria 1943
255 Ga0496111_0060507 3300048914 Bacteria 2745
256 Ga0496112_0002552 3300048915 Bacteria 14709
257 Ga0496112_0028407 3300048915 Bacteria 5399
258 Ga0496112_1077317 3300048915 Bacteria 722
259 Ga0496113_0143745 3300048916 Bacteria 1878
260 Ga0496113_0882466 3300048916 Bacteria 708
261 Ga0496114_0093300 3300048917 Bacteria 2559
262 Ga0496114_0567922 3300048917 Bacteria 1001
263 Ga0496115_0017578 3300048918 Bacteria 5472
264 Ga0496115_0078997 3300048918 Bacteria 2678
265 Ga0496115_0129585 3300048918 Bacteria 2079
266 Ga0496115_0303617 3300048918 Bacteria 1308
267 Ga0496118_0012813 3300048921 Bacteria 8004
268 Ga0496121_0023950 3300048924 Bacteria 5854
269 Ga0496121_0025176 3300048924 Bacteria 5659
270 Ga0496121_0062422 3300048924 Bacteria 3052
271 Ga0496124_0454095 3300048927 Bacteria 873
272 Ga0496126_0007204 3300048929 Bacteria 12234
273 Ga0496126_0271705 3300048929 Bacteria 1407
274 Ga0501034_0184795 3300049571 Bacteria 2048
275 Ga0501034_0645342 3300049571 Bacteria 961
276 Ga0501036_0076509 3300049572 Bacteria 2831
277 Ga0501038_0008323 3300049574 Bacteria 9544
278 Ga0501038_0356434 3300049574 Bacteria 1138
279 Ga0501039_0421758 3300049575 Bacteria 1048
280 Ga0501047_0033033 3300049581 Bacteria 4996
281 Ga0501072_0551070 3300049588 Bacteria 911
282 Ga0501076_0583486 3300049592 Bacteria 922
283 Ga0501080_0023236 3300049742 Bacteria 5749
284 Ga0501044_0079397 3300049823 Bacteria 3325
285 nmdc:mga00v17_139030_c1 3300050491 Bacteria 1556
286 nmdc:mga00v17_46919_c1 3300050491 Bacteria 2615
287 nmdc:mga0yw44_511202_c1 3300050492 Bacteria 815
288 nmdc:mga0qj67_12665_c1 3300050509 Bacteria 6358
289 nmdc:mga0qj67_241272_c1 3300050509 Bacteria 1466
290 nmdc:mga06r32_109763_c1 3300050510 Bacteria 2713
291 nmdc:mga06r32_16557_c1 3300050510 Bacteria 6720
292 nmdc:mga0n895_326752_c1 3300050512 Bacteria 1554
293 nmdc:mga0a205_701649_c1 3300050515 Bacteria 862
294 Ga0495595_0219862 3300053084 Bacteria 948
295 Ga0495619_0976569 3300053085 Bacteria 567
296 Ga0500566_0413916 3300053094 Bacteria 600
297 Ga0500627_0144993 3300053158 Bacteria 1073
298 Ga0466962_0120829 3300061719 Bacteria 1264
299 Ga0213876_10080847
300 rootH1_10037357
301 Ga0065715_10237342
302 Ga0065707_10223341
303 Ga0070683_100116818
304 Ga0070690_100098466
305 Ga0070690_100641881
306 Ga0070670_101179154
307 Ga0068869_100128268
308 Ga0070666_10164041
309 Ga0070682_100290071
310 Ga0070689_100082768
311 Ga0070687_100581266
312 Ga0070661_100153771
313 Ga0070675_100476219
314 Ga0070671_100639061
315 Ga0070674_100000199
316 Ga0070659_100932158
317 Ga0070667_100205048
318 Ga0070709_10006702
319 Ga0070709_10056857
320 Ga0070709_10083056
321 Ga0070709_10309496
322 Ga0070714_100002396
323 Ga0070714_100008580
324 Ga0070714_100038279
325 Ga0070714_100910661
326 Ga0070714_101046719
327 Ga0070713_100000639
328 Ga0070713_100147689
329 Ga0070713_100693580
330 Ga0070713_100871987
331 Ga0070710_10000587
332 Ga0070710_10028612
333 Ga0070710_10083270
334 Ga0070711_100002894
335 Ga0070711_100078163
336 Ga0070711_100541065
337 Ga0070678_100071292
338 Ga0070662_100132422
339 Ga0070662_101001782
340 Ga0070681_10133699
341 Ga0070685_10245525
342 Ga0070706_100295436
343 Ga0070707_100277897
344 Ga0070698_100197852
345 Ga0070699_100319038
346 Ga0068853_100996283
347 Ga0070672_100674374
348 Ga0070693_100434002
349 Ga0068855_100929942
350 Ga0070664_100065185
351 Ga0070664_100614024
352 Ga0068857_100364694
353 Ga0068856_101233621
354 Ga0068852_101756317
355 Ga0068864_100593135
356 Ga0068866_10066059
357 Ga0068858_100847146
358 Ga0070717_10014303
359 Ga0070717_10163585
360 Ga0070717_10364541
361 Ga0075365_10902964
362 Ga0075364_10165271
363 Ga0070715_10000260
364 Ga0070715_10058758
365 Ga0070716_100000213
366 Ga0070712_100022001
367 Ga0070712_100082962
368 Ga0070712_101124192
369 Ga0068871_100086373
370 Ga0075428_100220351
371 Ga0075431_100115812
372 Ga0075431_100126392
373 Ga0075431_100193043
374 Ga0105240_10232377
375 Ga0105245_10656186
376 Ga0114129_10107850
377 Ga0105243_10181912
378 Ga0105243_10274192
379 Ga0105248_10330558
380 Ga0105237_10935479
381 Ga0105238_10011476
382 Ga0157373_10643953
383 Ga0157372_11416002
384 Ga0157375_10104866
385 Ga0163163_10093776
386 Ga0157380_10109521
387 Ga0209677_100874
388 Ga0209148_1009778
389 Ga0209233_1000766
390 Ga0209455_1011254
391 Ga0209130_1030243
392 Ga0209564_1000248
393 Ga0207682_10000171
394 Ga0207692_10000295
395 Ga0207692_10046248
396 Ga0207642_10534292
397 Ga0207680_10055239
398 Ga0207685_10077989
399 Ga0207685_10126635
400 Ga0207699_10007555
401 Ga0207699_10020384
402 Ga0207699_10047019
403 Ga0207699_10754980
404 Ga0207645_10009463
405 Ga0207643_10084637
406 Ga0207684_10197578
407 Ga0207654_10218909
408 Ga0207693_10000674
409 Ga0207693_10069351
410 Ga0207693_10071644
411 Ga0207663_10001588
412 Ga0207663_10109719
413 Ga0207663_10270327
414 Ga0207663_10305672
415 Ga0207650_10568820
416 Ga0207700_10007259
417 Ga0207700_10054300
418 Ga0207664_10037043
419 Ga0207664_10392394
420 Ga0207664_10743985
421 Ga0207644_10577252
422 Ga0207690_11267074
423 Ga0207706_10010398
424 Ga0207706_10559243
425 Ga0207709_10308105
426 Ga0207670_10200290
427 Ga0207669_10029742
428 Ga0207665_10000214
429 Ga0207665_10510206
430 Ga0207665_10565651
431 Ga0207691_10004900
432 Ga0207689_10124185
433 Ga0207661_10038326
434 Ga0207712_10536663
435 Ga0207658_10200373
436 Ga0207703_10476069
437 Ga0207639_10561787
438 Ga0207641_10333943
439 Ga0207674_10129178
440 Ga0207683_10000902
441 Ga0265763_1000431
442 Ga0265332_10000849
443 Ga0265328_10148123
444 Ga0265325_10084773
445 Ga0265340_10000517
446 Ga0265339_10006654
447 Ga0265331_10055762
448 Ga0307513_10232324
449 Ga0307508_10053920
450 Ga0265342_10000360
451 Ga0316576_10090364
452 Ga0373930_0022902
453 Ga0373926_0012416
454 Ga0373934_0048135
455 Ga0373944_0167258
456 Ga0373936_0024413
457 Ga0373936_0087434
458 Ga0373936_0219148
459 Ga0373945_0156686
460 Ga0373953_0213685
461 Ga0373954_0008905
462 Ga0373954_0126495
463 Ga0373957_0022163
464 Ga0373943_0006310
465 Ga0373946_0028575
466 Ga0373955_0110258
467 Ga0316574_0013196
468 Ga0373924_0004761
469 Ga0373935_0092933
470 Ga0373935_0933993
471 Ga0373933_0000933
472 Ga0373933_0032897
473 Ga0373933_0210620
474 Ga0373947_0192145
475 Ga0373937_0024376
476 Ga0373937_0138753
477 Ga0373937_0287309
478 Ga0265778_028781
479 Ga0316584_0035929
480 Ga0373925_0008127
481 Ga0373925_0067648
482 Ga0395899_0014921
483 Ga0436364_0520870
484 Ga0436365_0171038
485 Ga0436365_0207937
486 Ga0436365_1605869
487 Ga0466969_0210099
488 Ga0466963_0071267
489 Ga0466963_0200035
490 Ga0466968_0255016
491 Ga0466970_0407073
492 Ga0466967_0329016
493 Ga0466967_0338451
494 Ga0466967_0489226
495 Ga0466967_0646562
496 Ga0466967_1009101
497 Ga0466967_1009551
498 Ga0495592_0018709
499 Ga0495629_0177556
500 Ga0495629_0597470
501 Ga0495638_0005101
502 Ga0495651_0203208
503 Ga0495580_0014157
504 Ga0495582_0010213
505 Ga0495639_0226333
506 Ga0495662_0387691
507 Ga0495664_0154314
508 Ga0495608_0114167
509 Ga0495618_0020165
510 Ga0495628_0027207
511 Ga0495630_0441390
512 Ga0495630_0613932
513 Ga0495643_0102538
514 Ga0495663_0059387
515 Ga0495666_0070281
516 Ga0495652_0203897
517 Ga0495665_0059118
518 Ga0495665_0105495
519 Ga0495640_0040208
520 Ga0495598_0001762
521 Ga0495621_0017339
522 Ga0495645_0059525
523 Ga0495645_0729849
524 Ga0495634_0441696
525 Ga0495635_0166189
526 Ga0495588_0045146
527 Ga0495657_0077523
528 Ga0495599_0306556
529 Ga0495613_0353343
530 Ga0495624_0013481
531 Ga0495600_0805690
532 Ga0495581_0022831
533 Ga0495604_0427627
534 Ga0495674_0079882
535 Ga0495674_0123439
536 Ga0495674_0434280
537 Ga0495680_0041930
538 Ga0495684_0034978
539 Ga0495593_0073224
540 Ga0495602_0171926
541 Ga0495615_0064424
542 Ga0496101_0035046
543 Ga0496104_0005875
544 Ga0496105_0138633
545 Ga0496106_0002438
546 Ga0496107_0004695
547 Ga0496107_0572128
548 Ga0496108_0001846
549 Ga0496109_0001905
550 Ga0496110_0163974
551 Ga0496110_0175775
552 Ga0496111_0060507
553 Ga0496112_0002552
554 Ga0496112_0028407
555 Ga0496112_1077317
556 Ga0496113_0143745
557 Ga0496113_0882466
558 Ga0496114_0093300
559 Ga0496114_0567922
560 Ga0496115_0017578
561 Ga0496115_0078997
562 Ga0496115_0129585
563 Ga0496115_0303617
564 Ga0496118_0012813
565 Ga0496121_0023950
566 Ga0496121_0025176
567 Ga0496121_0062422
568 Ga0496124_0454095
569 Ga0496126_0007204
570 Ga0496126_0271705
571 Ga0501034_0184795
572 Ga0501034_0645342
573 Ga0501036_0076509
574 Ga0501038_0008323
575 Ga0501038_0356434
576 Ga0501039_0421758
577 Ga0501047_0033033
578 Ga0501072_0551070
579 Ga0501076_0583486
580 Ga0501080_0023236
581 Ga0501044_0079397
582 nmdc:mga00v17_139030_c1
583 nmdc:mga00v17_46919_c1
584 nmdc:mga0yw44_511202_c1
585 nmdc:mga0qj67_12665_c1
586 nmdc:mga0qj67_241272_c1
587 nmdc:mga06r32_109763_c1
588 nmdc:mga06r32_16557_c1
589 nmdc:mga0n895_326752_c1
590 nmdc:mga0a205_701649_c1
591 Ga0495595_0219862
592 Ga0495619_0976569
593 Ga0500566_0413916
594 Ga0500627_0144993
595 Ga0466962_0120829

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00186

DHFR_1

Dihydrofolate reductase

19

184

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5w3q-assembly1.cif.gz_A l28f e.coli dhfr in complex with nadph 0.951 4 168
4p68-assembly1.cif.gz_A electrostatics of active site microenvironments for e. coli dhfr 0.9506 4 168
4p66-assembly1.cif.gz_A electrostatics of active site microenvironments of e. coli dhfr 0.9496 4 168
4qi9-assembly3.cif.gz_C crystal structure of dihydrofolate reductase from yersinia pestis complexed with methotrexate 0.9455 2 171
7tj3-assembly1.cif.gz_A crystal structure of a dihydrofolate reductase fola from stenotrophomonas maltophilia bound to nadp and p218 0.9451 1 168
ID Description Score Start End Superfamily
4or7A00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9407 4 171 3.40.430.10
3tqaA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9376 2 167 3.40.430.10
3tqaA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9319 2 167 3.40.430.10
4or7A00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9135 4 171 3.40.430.10
5ecxB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9013 2 168 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A508TPI1-F1-model_v4 Dihydrofolate reductase (EC 1.5.1.3) 0.99 2 167 GO:0004146
GO:0005829
GO:0006730
GO:0046452
GO:0046654
GO:0046655
GO:0050661
AF-A0A7Y4LX80-F1-model_v4 Dihydrofolate reductase (EC 1.5.1.3) 0.9898 2 168 GO:0004146
GO:0005829
GO:0006730
GO:0046452
GO:0046654
GO:0046655
GO:0050661
AF-A0A354VME0-F1-model_v4 deleted 0.9877 2 134
AF-A0A4Q5PWH0-F1-model_v4 dihydrofolate reductase (EC 1.5.1.3) 0.9872 2 171 GO:0004146
GO:0005829
GO:0046452
GO:0046654
GO:0046655
GO:0050661
AF-A0A1M5A2B9-F1-model_v4 dihydrofolate reductase (EC 1.5.1.3) 0.9865 2 168 GO:0004146
GO:0005829
GO:0046452
GO:0046654
GO:0046655
GO:0050661

Map