F393686

General Info

Members Datasets Scaffolds Average Seq Length
297 188 594 141

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10343248|Ga0105242_103432481
Length 167
Sequence MITDPGLTRQAEPHLTHHGALQEEPSMTISAATASPAPQPIDVVDYRPGVCNIGPAEISRRRRAGHVGLIAAVXXXXILVAVGAPPIARLLLVIPVAISASGYLQAYLKFCAGFGSRGIYNFGDVGTTDKVADAAARALDKAKAMRISIASFAIGLGVALIAVLLPI

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
95 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
96 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
97 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
98 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
99 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
100 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
101 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
102 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
103 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
104 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
105 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
106 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
107 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
108 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
109 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
110 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
111 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
114 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
115 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
116 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
122 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
123 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
124 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
125 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
126 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
127 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
128 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
129 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
130 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
131 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
132 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
133 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
134 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
135 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
138 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
139 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
140 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
141 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
165 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
166 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
167 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
168 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
169 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
170 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
171 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
176 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
182 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
183 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
184 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
185 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
186 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
187 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
188 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.34
Nodule 0
Rhizoplane 13.8
Rhizosphere 85.19
Stem 0
Stem Tuber 0
Unclassified 17.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_10343248 3300009176 Bacteria 1377
2 Ga0070683_100425476 3300005329 Bacteria 1267
3 Ga0070690_100802821 3300005330 Bacteria 730
4 Ga0070690_101465679 3300005330 Bacteria 551
5 Ga0070670_100129609 3300005331 Bacteria 2177
6 Ga0068869_102054520 3300005334 Bacteria 513
7 Ga0070666_11342519 3300005335 Bacteria 534
8 Ga0070680_100073419 3300005336 Bacteria 2813
9 Ga0068868_100588952 3300005338 Bacteria 984
10 Ga0070687_100421744 3300005343 Bacteria 880
11 Ga0070668_100241569 3300005347 Bacteria 1496
12 Ga0070668_100347060 3300005347 Bacteria 1255
13 Ga0070669_100833840 3300005353 Bacteria 785
14 Ga0070669_101441698 3300005353 Archaea 598
15 Ga0070675_100447512 3300005354 Unclassified 1158
16 Ga0070675_100967840 3300005354 Bacteria 781
17 Ga0070667_100342098 3300005367 Bacteria 1353
18 Ga0070705_100105442 3300005440 Bacteria 1790
19 Ga0070705_100117308 3300005440 Bacteria 1712
20 Ga0070700_100050397 3300005441 Bacteria 2588
21 Ga0070694_101177327 3300005444 Bacteria 642
22 Ga0070678_100327855 3300005456 Unclassified 1309
23 Ga0070678_100369065 3300005456 Bacteria 1239
24 Ga0070678_100514565 3300005456 Bacteria 1058
25 Ga0070681_10137053 3300005458 Bacteria 2378
26 Ga0070681_10975307 3300005458 Bacteria 767
27 Ga0070685_10222244 3300005466 Bacteria 1238
28 Ga0070707_100049518 3300005468 Bacteria 4027
29 Ga0070699_100003016 3300005518 Bacteria 14946
30 Ga0070679_100125702 3300005530 Bacteria 2547
31 Ga0070684_100147804 3300005535 Bacteria 2128
32 Ga0070697_100258645 3300005536 Bacteria 1490
33 Ga0070686_100023736 3300005544 Bacteria 3669
34 Ga0070686_100051847 3300005544 Bacteria 2614
35 Ga0070695_100227953 3300005545 Bacteria 1345
36 Ga0070695_100975912 3300005545 Bacteria 688
37 Ga0070696_100054813 3300005546 Bacteria 2779
38 Ga0070693_100072168 3300005547 Bacteria 2036
39 Ga0070693_100885421 3300005547 Bacteria 668
40 Ga0070665_101041531 3300005548 Bacteria 830
41 Ga0070664_100059066 3300005564 Bacteria 3263
42 Ga0070664_100197768 3300005564 Bacteria 1793
43 Ga0068854_100740633 3300005578 Bacteria 852
44 Ga0068856_100233484 3300005614 Bacteria 1855
45 Ga0068856_100377815 3300005614 Bacteria 1436
46 Ga0070702_100031236 3300005615 Bacteria 2912
47 Ga0068859_101741768 3300005617 Unclassified 688
48 Ga0068864_100098407 3300005618 Bacteria 2591
49 Ga0068864_100250843 3300005618 Bacteria 1643
50 Ga0068870_10677138 3300005840 Unclassified 709
51 Ga0068863_100569434 3300005841 Bacteria 1119
52 Ga0068858_101281992 3300005842 Unclassified 721
53 Ga0068860_100351905 3300005843 Bacteria 1450
54 Ga0068862_101059131 3300005844 Bacteria 804
55 Ga0081455_10117259 3300005937 Bacteria 2104
56 Ga0070712_100224441 3300006175 Bacteria 1489
57 Ga0097621_100260236 3300006237 Bacteria 1522
58 Ga0068871_100186486 3300006358 Bacteria 1785
59 Ga0075433_10218370 3300006852 Bacteria 1694
60 Ga0075434_100258936 3300006871 Bacteria 1759
61 Ga0097620_101742631 3300006931 Unclassified 688
62 Ga0075435_100417800 3300007076 Bacteria 1155
63 Ga0111539_11651234 3300009094 Unclassified 743
64 Ga0105245_10023803 3300009098 Bacteria 5377
65 Ga0105245_10097899 3300009098 Bacteria 2710
66 Ga0105245_10098996 3300009098 Bacteria 2695
67 Ga0105245_10118022 3300009098 Bacteria 2475
68 Ga0105245_12118574 3300009098 Bacteria 616
69 Ga0114129_10882878 3300009147 Bacteria 1134
70 Ga0114129_11786167 3300009147 Unclassified 748
71 Ga0105243_11724181 3300009148 Bacteria 656
72 Ga0105241_11227230 3300009174 Bacteria 711
73 Ga0105248_10076540 3300009177 Bacteria 3761
74 Ga0105248_10163922 3300009177 Bacteria 2506
75 Ga0105239_10444708 3300010375 Bacteria 1470
76 Ga0105239_10566197 3300010375 Bacteria 1295
77 Ga0105246_10240122 3300011119 Bacteria 1432
78 Ga0157374_10387861 3300013296 Bacteria 1392
79 Ga0157374_11387286 3300013296 Bacteria 725
80 Ga0157378_10604308 3300013297 Bacteria 1108
81 Ga0157378_11814471 3300013297 Bacteria 658
82 Ga0163162_11697991 3300013306 Bacteria 721
83 Ga0157375_10078553 3300013308 Bacteria 3333
84 Ga0157375_10926589 3300013308 Bacteria 1014
85 Ga0163163_10240616 3300014325 Bacteria 1859
86 Ga0163163_10777745 3300014325 Bacteria 1021
87 Ga0163163_12169969 3300014325 Bacteria 615
88 Ga0157379_10500734 3300014968 Unclassified 1126
89 Ga0157376_10444358 3300014969 Bacteria 1263
90 Ga0207688_10145505 3300025901 Bacteria 1397
91 Ga0207654_11233974 3300025911 Bacteria 545
92 Ga0207693_10212423 3300025915 Bacteria 1521
93 Ga0207662_10397318 3300025918 Bacteria 934
94 Ga0207649_10808934 3300025920 Bacteria 732
95 Ga0207649_11195528 3300025920 Unclassified 601
96 Ga0207646_10016710 3300025922 Bacteria 6884
97 Ga0207650_10186902 3300025925 Bacteria 1654
98 Ga0207659_10354731 3300025926 Unclassified 1218
99 Ga0207659_11736965 3300025926 Bacteria 531
100 Ga0207659_11790780 3300025926 Bacteria 522
101 Ga0207687_10050932 3300025927 Bacteria 2885
102 Ga0207644_10717934 3300025931 Bacteria 834
103 Ga0207706_10173389 3300025933 Bacteria 1895
104 Ga0207706_10468521 3300025933 Unclassified 1089
105 Ga0207686_10596257 3300025934 Bacteria 869
106 Ga0207711_10823794 3300025941 Bacteria 864
107 Ga0207689_10310770 3300025942 Bacteria 1307
108 Ga0207661_10717101 3300025944 Bacteria 920
109 Ga0207679_10076622 3300025945 Bacteria 2542
110 Ga0207679_10966065 3300025945 Bacteria 780
111 Ga0207651_10146160 3300025960 Bacteria 1834
112 Ga0207712_10162660 3300025961 Bacteria 1736
113 Ga0207668_10880274 3300025972 Bacteria 796
114 Ga0207658_10067013 3300025986 Bacteria 2703
115 Ga0207677_11267256 3300026023 Bacteria 676
116 Ga0207703_11472025 3300026035 Unclassified 655
117 Ga0207708_10260109 3300026075 Bacteria 1401
118 Ga0207708_10568096 3300026075 Bacteria 958
119 Ga0207702_10425322 3300026078 Bacteria 1285
120 Ga0207641_10181524 3300026088 Bacteria 1928
121 Ga0207641_10392700 3300026088 Bacteria 1331
122 Ga0207676_10271778 3300026095 Bacteria 1535
123 Ga0207676_10408515 3300026095 Bacteria 1271
124 Ga0207683_10025369 3300026121 Bacteria 5113
125 Ga0207698_11299749 3300026142 Bacteria 742
126 Ga0207428_10656052 3300027907 Bacteria 753
127 Ga0268264_10226901 3300028381 Bacteria 1722
128 Ga0265337_1046491 3300028556 Unclassified 1232
129 Ga0265326_10020017 3300028558 Bacteria 1919
130 Ga0265319_1005078 3300028563 Bacteria 6391
131 Ga0265319_1188246 3300028563 Bacteria 635
132 Ga0265334_10001943 3300028573 Bacteria 9805
133 Ga0265334_10079565 3300028573 Bacteria 1209
134 Ga0265334_10167235 3300028573 Unclassified 771
135 Ga0265318_10005605 3300028577 Bacteria 5882
136 Ga0265323_10051952 3300028653 Bacteria 1452
137 Ga0265323_10116270 3300028653 Bacteria 874
138 Ga0265322_10002627 3300028654 Bacteria 5513
139 Ga0265322_10014419 3300028654 Bacteria 2284
140 Ga0265336_10013700 3300028666 Unclassified 2699
141 Ga0265338_10012867 3300028800 Bacteria 9507
142 Ga0265324_10128362 3300029957 Unclassified 861
143 Ga0265330_10009061 3300031235 Bacteria 4744
144 Ga0265328_10164700 3300031239 Unclassified 837
145 Ga0265320_10001498 3300031240 Bacteria 17012
146 Ga0265325_10015704 3300031241 Bacteria 4251
147 Ga0265325_10018059 3300031241 Bacteria 3913
148 Ga0265325_10049289 3300031241 Bacteria 2174
149 Ga0265329_10016377 3300031242 Unclassified 2569
150 Ga0265340_10001877 3300031247 Bacteria 11969
151 Ga0265339_10100244 3300031249 Unclassified 1508
152 Ga0265331_10163805 3300031250 Unclassified 1007
153 Ga0265316_10002038 3300031344 Bacteria 21269
154 Ga0265316_10210453 3300031344 Bacteria 1438
155 Ga0265316_10449258 3300031344 Unclassified 924
156 Ga0265313_10091049 3300031595 Unclassified 1369
157 Ga0265314_10001127 3300031711 Bacteria 30914
158 Ga0265314_10083348 3300031711 Bacteria 2102
159 Ga0265342_10008375 3300031712 Bacteria 7420
160 Ga0265342_10066110 3300031712 Unclassified 2118
161 Ga0307413_10783419 3300031824 Bacteria 800
162 Ga0307410_10845700 3300031852 Bacteria 781
163 Ga0316583_10108342 3300032133 Unclassified 968
164 Ga0373937_0178444 3300036401 Unclassified 1994
165 Ga0395901_1145961 3300038443 Bacteria 746
166 Ga0451853_0901848 3300041512 Unclassified 940
167 Ga0451853_3700228 3300041512 Bacteria 901
168 Ga0495592_0079097 3300046454 Unclassified 2380
169 Ga0495641_0064268 3300046461 Bacteria 1653
170 Ga0495662_0302419 3300046476 Bacteria 787
171 Ga0495608_0530701 3300046511 Unclassified 711
172 Ga0495618_0248144 3300046514 Unclassified 1117
173 Ga0495628_0034548 3300046516 Bacteria 4066
174 Ga0495628_0475302 3300046516 Bacteria 905
175 Ga0495630_0235901 3300046517 Bacteria 1398
176 Ga0495640_0808704 3300046533 Unclassified 558
177 Ga0495587_0117693 3300046536 Unclassified 1523
178 Ga0495634_0092402 3300046642 Unclassified 1963
179 Ga0495635_0853062 3300046663 Bacteria 585
180 Ga0495599_0506133 3300046678 Unclassified 710
181 Ga0495658_0203917 3300046683 Bacteria 1234
182 Ga0495670_0136486 3300046691 Bacteria 1281
183 Ga0495674_0075054 3300047319 Bacteria 2910
184 Ga0495674_0262488 3300047319 Unclassified 1419
185 Ga0495680_0290666 3300047322 Bacteria 1150
186 Ga0495675_0158486 3300047444 Unclassified 1395
187 Ga0495684_0225755 3300047471 Unclassified 1371
188 Ga0495602_0339865 3300048088 Bacteria 1086
189 Ga0496100_0508641 3300048903 Bacteria 929
190 Ga0496100_0812374 3300048903 Bacteria 733
191 Ga0496102_0097937 3300048905 Bacteria 2721
192 Ga0496102_0725808 3300048905 Bacteria 916
193 Ga0496102_1216541 3300048905 Bacteria 673
194 Ga0496104_0024870 3300048907 Bacteria 5514
195 Ga0496104_0130307 3300048907 Bacteria 2416
196 Ga0496104_0181759 3300048907 Bacteria 2013
197 Ga0496104_0876130 3300048907 Bacteria 803
198 Ga0496105_0002094 3300048908 Bacteria 14434
199 Ga0496105_0292219 3300048908 Bacteria 1312
200 Ga0496106_0130688 3300048909 Bacteria 1969
201 Ga0496106_0661513 3300048909 Bacteria 834
202 Ga0496107_0093258 3300048910 Bacteria 2202
203 Ga0496108_0011448 3300048911 Bacteria 7210
204 Ga0496108_0066406 3300048911 Bacteria 3041
205 Ga0496108_0070944 3300048911 Bacteria 2940
206 Ga0496108_0071735 3300048911 Bacteria 2923
207 Ga0496109_0022028 3300048912 Bacteria 5641
208 Ga0496109_0025689 3300048912 Bacteria 5249
209 Ga0496109_0072936 3300048912 Bacteria 3154
210 Ga0496109_0214477 3300048912 Bacteria 1810
211 Ga0496109_1519667 3300048912 Unclassified 604
212 Ga0496110_0139508 3300048913 Bacteria 2191
213 Ga0496110_0250222 3300048913 Bacteria 1613
214 Ga0496110_1447485 3300048913 Bacteria 597
215 Ga0496111_0000682 3300048914 Bacteria 17861
216 Ga0496111_0175629 3300048914 Bacteria 1592
217 Ga0496112_0012824 3300048915 Bacteria 7714
218 Ga0496112_0030286 3300048915 Bacteria 5235
219 Ga0496112_0280061 3300048915 Bacteria 1615
220 Ga0496112_0971527 3300048915 Bacteria 770
221 Ga0496113_0002601 3300048916 Bacteria 10550
222 Ga0496113_0027041 3300048916 Bacteria 4108
223 Ga0496113_0108699 3300048916 Bacteria 2156
224 Ga0496113_0207147 3300048916 Bacteria 1560
225 Ga0496113_0405691 3300048916 Unclassified 1094
226 Ga0496113_0639198 3300048916 Bacteria 851
227 Ga0496114_0892545 3300048917 Unclassified 770
228 Ga0496114_1024785 3300048917 Bacteria 709
229 Ga0496114_1504254 3300048917 Bacteria 561
230 Ga0501031_0135484 3300049568 Bacteria 1609
231 Ga0501031_0239383 3300049568 Bacteria 1180
232 Ga0501032_0508167 3300049569 Unclassified 770
233 Ga0501032_0991945 3300049569 Unclassified 528
234 Ga0501036_0130159 3300049572 Bacteria 2125
235 Ga0501036_0229989 3300049572 Bacteria 1556
236 Ga0501036_0262480 3300049572 Bacteria 1447
237 Ga0501038_0134297 3300049574 Bacteria 2029
238 Ga0501039_0046946 3300049575 Bacteria 3337
239 Ga0501039_0159993 3300049575 Bacteria 1770
240 Ga0501039_0282942 3300049575 Unclassified 1304
241 Ga0501039_0378371 3300049575 Bacteria 1112
242 Ga0501040_0197208 3300049576 Bacteria 1429
243 Ga0501040_0558389 3300049576 Bacteria 826
244 Ga0501041_0056015 3300049577 Bacteria 2408
245 Ga0501041_0195826 3300049577 Bacteria 1266
246 Ga0501042_0557895 3300049578 Bacteria 832
247 Ga0501043_0331298 3300049579 Bacteria 1159
248 Ga0501043_0377313 3300049579 Bacteria 1074
249 Ga0501046_0261992 3300049580 Bacteria 1270
250 Ga0501046_0558486 3300049580 Bacteria 815
251 Ga0501046_0608073 3300049580 Unclassified 775
252 Ga0501069_0403542 3300049585 Bacteria 809
253 Ga0501071_0035834 3300049587 Bacteria 3536
254 Ga0501071_0094816 3300049587 Bacteria 2196
255 Ga0501071_0397032 3300049587 Bacteria 1053
256 Ga0501072_0048254 3300049588 Bacteria 3353
257 Ga0501072_0113121 3300049588 Bacteria 2161
258 Ga0501072_0225684 3300049588 Bacteria 1492
259 Ga0501072_0459439 3300049588 Unclassified 1008
260 Ga0501074_0300912 3300049590 Unclassified 1139
261 Ga0501075_0007823 3300049591 Bacteria 7423
262 Ga0501075_0087683 3300049591 Bacteria 2359
263 Ga0501075_0108256 3300049591 Bacteria 2113
264 Ga0501075_0373904 3300049591 Bacteria 1086
265 Ga0501076_0150293 3300049592 Bacteria 1895
266 Ga0501077_0027311 3300049593 Bacteria 3625
267 Ga0501077_0351907 3300049593 Bacteria 940
268 Ga0501079_0053809 3300049741 Bacteria 3105
269 Ga0501079_0087631 3300049741 Bacteria 2410
270 Ga0501079_0239225 3300049741 Bacteria 1418
271 Ga0501080_0124208 3300049742 Bacteria 2391
272 Ga0501081_0139466 3300049743 Bacteria 1737
273 Ga0501081_1205746 3300049743 Bacteria 573
274 Ga0501044_0517811 3300049823 Bacteria 1093
275 Ga0501045_0161817 3300049824 Bacteria 1666
276 Ga0501045_0530722 3300049824 Bacteria 873
277 nmdc:mga0yw44_674647_c1 3300050492 Unclassified 702
278 nmdc:mga05p37_1665283_c1 3300050507 Bacteria 624
279 nmdc:mga05p37_511506_c1 3300050507 Bacteria 1375
280 nmdc:mga08y16_1930977_c1 3300050511 Bacteria 541
281 nmdc:mga08y16_31257_c1 3300050511 Bacteria 5601
282 nmdc:mga0n895_98793_c1 3300050512 Bacteria 2926
283 nmdc:mga0rr50_411308_c1 3300050513 Bacteria 1144
284 nmdc:mga0a205_210764_c1 3300050515 Bacteria 1831
285 Ga0495601_0131430 3300053077 Unclassified 1630
286 Ga0495612_0000297 3300053078 Bacteria 20179
287 Ga0495595_0002888 3300053084 Bacteria 6773
288 Ga0495595_0445623 3300053084 Bacteria 658
289 Ga0495619_0011895 3300053085 Bacteria 5480
290 Ga0501084_0021562 3300054114 Bacteria 5371
291 Ga0501084_0452406 3300054114 Unclassified 1085
292 Ga0501082_0165905 3300060353 Bacteria 1919
293 Ga0501082_1259943 3300060353 Unclassified 646
294 Ga0530510_0005476 3300061734 Bacteria 8790
295 Ga0530510_0061181 3300061734 Bacteria 2726
296 Ga0530510_0114254 3300061734 Unclassified 1979
297 Ga0530510_0525588 3300061734 Bacteria 898
298 Ga0105242_10343248
299 Ga0070683_100425476
300 Ga0070690_100802821
301 Ga0070690_101465679
302 Ga0070670_100129609
303 Ga0068869_102054520
304 Ga0070666_11342519
305 Ga0070680_100073419
306 Ga0068868_100588952
307 Ga0070687_100421744
308 Ga0070668_100241569
309 Ga0070668_100347060
310 Ga0070669_100833840
311 Ga0070669_101441698
312 Ga0070675_100447512
313 Ga0070675_100967840
314 Ga0070667_100342098
315 Ga0070705_100105442
316 Ga0070705_100117308
317 Ga0070700_100050397
318 Ga0070694_101177327
319 Ga0070678_100327855
320 Ga0070678_100369065
321 Ga0070678_100514565
322 Ga0070681_10137053
323 Ga0070681_10975307
324 Ga0070685_10222244
325 Ga0070707_100049518
326 Ga0070699_100003016
327 Ga0070679_100125702
328 Ga0070684_100147804
329 Ga0070697_100258645
330 Ga0070686_100023736
331 Ga0070686_100051847
332 Ga0070695_100227953
333 Ga0070695_100975912
334 Ga0070696_100054813
335 Ga0070693_100072168
336 Ga0070693_100885421
337 Ga0070665_101041531
338 Ga0070664_100059066
339 Ga0070664_100197768
340 Ga0068854_100740633
341 Ga0068856_100233484
342 Ga0068856_100377815
343 Ga0070702_100031236
344 Ga0068859_101741768
345 Ga0068864_100098407
346 Ga0068864_100250843
347 Ga0068870_10677138
348 Ga0068863_100569434
349 Ga0068858_101281992
350 Ga0068860_100351905
351 Ga0068862_101059131
352 Ga0081455_10117259
353 Ga0070712_100224441
354 Ga0097621_100260236
355 Ga0068871_100186486
356 Ga0075433_10218370
357 Ga0075434_100258936
358 Ga0097620_101742631
359 Ga0075435_100417800
360 Ga0111539_11651234
361 Ga0105245_10023803
362 Ga0105245_10097899
363 Ga0105245_10098996
364 Ga0105245_10118022
365 Ga0105245_12118574
366 Ga0114129_10882878
367 Ga0114129_11786167
368 Ga0105243_11724181
369 Ga0105241_11227230
370 Ga0105248_10076540
371 Ga0105248_10163922
372 Ga0105239_10444708
373 Ga0105239_10566197
374 Ga0105246_10240122
375 Ga0157374_10387861
376 Ga0157374_11387286
377 Ga0157378_10604308
378 Ga0157378_11814471
379 Ga0163162_11697991
380 Ga0157375_10078553
381 Ga0157375_10926589
382 Ga0163163_10240616
383 Ga0163163_10777745
384 Ga0163163_12169969
385 Ga0157379_10500734
386 Ga0157376_10444358
387 Ga0207688_10145505
388 Ga0207654_11233974
389 Ga0207693_10212423
390 Ga0207662_10397318
391 Ga0207649_10808934
392 Ga0207649_11195528
393 Ga0207646_10016710
394 Ga0207650_10186902
395 Ga0207659_10354731
396 Ga0207659_11736965
397 Ga0207659_11790780
398 Ga0207687_10050932
399 Ga0207644_10717934
400 Ga0207706_10173389
401 Ga0207706_10468521
402 Ga0207686_10596257
403 Ga0207711_10823794
404 Ga0207689_10310770
405 Ga0207661_10717101
406 Ga0207679_10076622
407 Ga0207679_10966065
408 Ga0207651_10146160
409 Ga0207712_10162660
410 Ga0207668_10880274
411 Ga0207658_10067013
412 Ga0207677_11267256
413 Ga0207703_11472025
414 Ga0207708_10260109
415 Ga0207708_10568096
416 Ga0207702_10425322
417 Ga0207641_10181524
418 Ga0207641_10392700
419 Ga0207676_10271778
420 Ga0207676_10408515
421 Ga0207683_10025369
422 Ga0207698_11299749
423 Ga0207428_10656052
424 Ga0268264_10226901
425 Ga0265337_1046491
426 Ga0265326_10020017
427 Ga0265319_1005078
428 Ga0265319_1188246
429 Ga0265334_10001943
430 Ga0265334_10079565
431 Ga0265334_10167235
432 Ga0265318_10005605
433 Ga0265323_10051952
434 Ga0265323_10116270
435 Ga0265322_10002627
436 Ga0265322_10014419
437 Ga0265336_10013700
438 Ga0265338_10012867
439 Ga0265324_10128362
440 Ga0265330_10009061
441 Ga0265328_10164700
442 Ga0265320_10001498
443 Ga0265325_10015704
444 Ga0265325_10018059
445 Ga0265325_10049289
446 Ga0265329_10016377
447 Ga0265340_10001877
448 Ga0265339_10100244
449 Ga0265331_10163805
450 Ga0265316_10002038
451 Ga0265316_10210453
452 Ga0265316_10449258
453 Ga0265313_10091049
454 Ga0265314_10001127
455 Ga0265314_10083348
456 Ga0265342_10008375
457 Ga0265342_10066110
458 Ga0307413_10783419
459 Ga0307410_10845700
460 Ga0316583_10108342
461 Ga0373937_0178444
462 Ga0395901_1145961
463 Ga0451853_0901848
464 Ga0451853_3700228
465 Ga0495592_0079097
466 Ga0495641_0064268
467 Ga0495662_0302419
468 Ga0495608_0530701
469 Ga0495618_0248144
470 Ga0495628_0034548
471 Ga0495628_0475302
472 Ga0495630_0235901
473 Ga0495640_0808704
474 Ga0495587_0117693
475 Ga0495634_0092402
476 Ga0495635_0853062
477 Ga0495599_0506133
478 Ga0495658_0203917
479 Ga0495670_0136486
480 Ga0495674_0075054
481 Ga0495674_0262488
482 Ga0495680_0290666
483 Ga0495675_0158486
484 Ga0495684_0225755
485 Ga0495602_0339865
486 Ga0496100_0508641
487 Ga0496100_0812374
488 Ga0496102_0097937
489 Ga0496102_0725808
490 Ga0496102_1216541
491 Ga0496104_0024870
492 Ga0496104_0130307
493 Ga0496104_0181759
494 Ga0496104_0876130
495 Ga0496105_0002094
496 Ga0496105_0292219
497 Ga0496106_0130688
498 Ga0496106_0661513
499 Ga0496107_0093258
500 Ga0496108_0011448
501 Ga0496108_0066406
502 Ga0496108_0070944
503 Ga0496108_0071735
504 Ga0496109_0022028
505 Ga0496109_0025689
506 Ga0496109_0072936
507 Ga0496109_0214477
508 Ga0496109_1519667
509 Ga0496110_0139508
510 Ga0496110_0250222
511 Ga0496110_1447485
512 Ga0496111_0000682
513 Ga0496111_0175629
514 Ga0496112_0012824
515 Ga0496112_0030286
516 Ga0496112_0280061
517 Ga0496112_0971527
518 Ga0496113_0002601
519 Ga0496113_0027041
520 Ga0496113_0108699
521 Ga0496113_0207147
522 Ga0496113_0405691
523 Ga0496113_0639198
524 Ga0496114_0892545
525 Ga0496114_1024785
526 Ga0496114_1504254
527 Ga0501031_0135484
528 Ga0501031_0239383
529 Ga0501032_0508167
530 Ga0501032_0991945
531 Ga0501036_0130159
532 Ga0501036_0229989
533 Ga0501036_0262480
534 Ga0501038_0134297
535 Ga0501039_0046946
536 Ga0501039_0159993
537 Ga0501039_0282942
538 Ga0501039_0378371
539 Ga0501040_0197208
540 Ga0501040_0558389
541 Ga0501041_0056015
542 Ga0501041_0195826
543 Ga0501042_0557895
544 Ga0501043_0331298
545 Ga0501043_0377313
546 Ga0501046_0261992
547 Ga0501046_0558486
548 Ga0501046_0608073
549 Ga0501069_0403542
550 Ga0501071_0035834
551 Ga0501071_0094816
552 Ga0501071_0397032
553 Ga0501072_0048254
554 Ga0501072_0113121
555 Ga0501072_0225684
556 Ga0501072_0459439
557 Ga0501074_0300912
558 Ga0501075_0007823
559 Ga0501075_0087683
560 Ga0501075_0108256
561 Ga0501075_0373904
562 Ga0501076_0150293
563 Ga0501077_0027311
564 Ga0501077_0351907
565 Ga0501079_0053809
566 Ga0501079_0087631
567 Ga0501079_0239225
568 Ga0501080_0124208
569 Ga0501081_0139466
570 Ga0501081_1205746
571 Ga0501044_0517811
572 Ga0501045_0161817
573 Ga0501045_0530722
574 nmdc:mga0yw44_674647_c1
575 nmdc:mga05p37_1665283_c1
576 nmdc:mga05p37_511506_c1
577 nmdc:mga08y16_1930977_c1
578 nmdc:mga08y16_31257_c1
579 nmdc:mga0n895_98793_c1
580 nmdc:mga0rr50_411308_c1
581 nmdc:mga0a205_210764_c1
582 Ga0495601_0131430
583 Ga0495612_0000297
584 Ga0495595_0002888
585 Ga0495595_0445623
586 Ga0495619_0011895
587 Ga0501084_0021562
588 Ga0501084_0452406
589 Ga0501082_0165905
590 Ga0501082_1259943
591 Ga0530510_0005476
592 Ga0530510_0061181
593 Ga0530510_0114254
594 Ga0530510_0525588

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2azj-assembly1.cif.gz_B crystal structure for the mutant d81c of sulfolobus solfataricus hexaprenyl pyrophosphate synthase 0.3883 30 130
3t6g-assembly2.cif.gz_D structure of the complex between nsp3 (shep1) and p130cas 0.3748 31 131
7jz2-assembly1.cif.gz_D succinate: quinone oxidoreductase sqr from e.coli k12 0.3718 32 130
7jz2-assembly1.cif.gz_D succinate: quinone oxidoreductase sqr from e.coli k12 0.3386 32 130
5w93-assembly3.cif.gz_C p130cas complex with paxillin ld1 0.3312 31 131
ID Description Score Start End Superfamily
af_O76666_7_159_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5597 31 132 1.20.1070.10
af_D3ZA84_664_788_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.5138 32 130 1.20.120.230
af_P26039_661_785_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.5041 32 130 1.20.120.230
af_A0A0R4IDZ8_661_785_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.5029 32 130 1.20.120.230
af_Q54K81_850_982_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.4786 31 130 1.20.120.230
ID Description Score Start End GO Terms
AF-A0A2G9NVB6-F1-model_v4 DUF4395 domain-containing protein 0.9916 20 129 GO:0016020
AF-A0A6J6JP96-F1-model_v4 Unannotated protein 0.9883 19 132 GO:0016020
AF-A0A1J4U938-F1-model_v4 DUF4395 domain-containing protein 0.987 20 131 GO:0016020
AF-A0A6L5F5V9-F1-model_v4 DUF2892 domain-containing protein 0.9834 19 131 GO:0016020
AF-A0A0R2QKY2-F1-model_v4 DUF2892 domain-containing protein 0.9792 20 117 GO:0016020

Map