F393654

General Info

Members Datasets Scaffolds Average Seq Length
297 181 594 389

Family's Representative Sequence

Representative Sequence 3300007076|Ga0075435_100149726|Ga0075435_1001497261
Length 445
Sequence MLPQNSPSHIQRRYPGSRGTVVPSGNVIASEGLQRTGGKARSLNPFPRRVTYNREPMKRSVDRILTTHTGSLIRPPRLLEFVKARQAGQPIDQSAYEAILKDSVRDVVARQIEAGIDIPNDGEFGKSTSWSLYVLKRLSGFEMREVKGANPFARGADRLRFADFYAELEGRGDGKDWSNVTRRDAVCVGPIKYNGLFELQRDIDNLKAAAKAAGVDEAFLPVAAPSSAIPDRKNEYYKTDEDLVVALAEALRTEYRSIVDAGFLLQVDDARAAVTYDRMVPPASFEDYYKWLERHVDVLNHALEGIPEDRIRYHVCWGSWPGPHTTDVPLRKIVDLILKVNAGAYLLEAANPRHEHEWKVWQEVKLPPGKILVPGVVSHGTNVVEHPELIAQRLTRFATYVGRENLIAGTDCGFAQEEINRRVHPSIMWAKLEAMAEGARIASRA

Samples

Sample ID Description Type Environment
1 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
71 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
106 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
107 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
108 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
109 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
110 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
111 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
112 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
113 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
119 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
120 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
121 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
122 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
123 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
124 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
125 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
126 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
127 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
128 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
129 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
130 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
131 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
132 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
133 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
134 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
135 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
136 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
137 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
140 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
141 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
142 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
155 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
156 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
157 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
158 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
159 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
160 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
161 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
162 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
163 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
164 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
167 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
168 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
169 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
170 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
171 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
172 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
173 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
174 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
177 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
178 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
179 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
180 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
181 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.02
Nodule 0
Rhizoplane 0.34
Rhizosphere 91.92
Stem 0
Stem Tuber 0
Unclassified 9.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075435_100149726 3300007076 Bacteria 1961
2 JGI25404J52841_10014701 3300003659 Bacteria 1699
3 Ga0065704_10000618 3300005289 Bacteria 15465
4 Ga0065707_10001292 3300005295 Bacteria 11952
5 Ga0070658_10068761 3300005327 Bacteria 2896
6 Ga0070677_10006760 3300005333 Bacteria 3816
7 Ga0070677_10055377 3300005333 Bacteria 1619
8 Ga0068869_100043770 3300005334 Bacteria 3217
9 Ga0070680_100209301 3300005336 Bacteria 1645
10 Ga0070689_100001996 3300005340 Bacteria 13222
11 Ga0070687_100006132 3300005343 Bacteria 4910
12 Ga0070692_10126088 3300005345 Bacteria 1434
13 Ga0070669_100002199 3300005353 Bacteria 14122
14 Ga0070669_100015391 3300005353 Bacteria 5451
15 Ga0070669_100228235 3300005353 Bacteria 1474
16 Ga0070675_100003022 3300005354 Bacteria 12697
17 Ga0070675_100080782 3300005354 Bacteria 2710
18 Ga0070671_100021510 3300005355 Bacteria 5268
19 Ga0070714_100050171 3300005435 Unclassified 3554
20 Ga0070713_100058444 3300005436 Unclassified 3216
21 Ga0070713_100105625 3300005436 Bacteria 2447
22 Ga0070710_10008991 3300005437 Bacteria 4880
23 Ga0070701_10001279 3300005438 Bacteria 9244
24 Ga0070701_10026874 3300005438 Bacteria 2812
25 Ga0070705_100000226 3300005440 Bacteria 33382
26 Ga0070700_100064983 3300005441 Bacteria 2312
27 Ga0070700_100185006 3300005441 Bacteria 1452
28 Ga0070694_100188410 3300005444 Bacteria 1530
29 Ga0070708_100237879 3300005445 Bacteria 1709
30 Ga0070678_100040068 3300005456 Bacteria 3312
31 Ga0070678_100089553 3300005456 Unclassified 2356
32 Ga0070678_100239794 3300005456 Bacteria 1516
33 Ga0068867_100004682 3300005459 Bacteria 9625
34 Ga0070707_100079163 3300005468 Bacteria 3172
35 Ga0070698_100006219 3300005471 Bacteria 12993
36 Ga0070699_100003870 3300005518 Bacteria 13236
37 Ga0070699_100022527 3300005518 Bacteria 5430
38 Ga0070697_100066558 3300005536 Bacteria 2946
39 Ga0070672_100007499 3300005543 Bacteria 7408
40 Ga0070695_100001530 3300005545 Bacteria 12874
41 Ga0070695_100121965 3300005545 Bacteria 1784
42 Ga0070696_100000106 3300005546 Bacteria 43183
43 Ga0070696_100022745 3300005546 Bacteria 4260
44 Ga0070665_100000229 3300005548 Bacteria 93160
45 Ga0070664_100007889 3300005564 Bacteria 8600
46 Ga0068859_100005105 3300005617 Bacteria 13335
47 Ga0068859_100009007 3300005617 Bacteria 10081
48 Ga0068859_100016471 3300005617 Bacteria 7424
49 Ga0068859_100080659 3300005617 Bacteria 3295
50 Ga0068864_100158105 3300005618 Bacteria 2059
51 Ga0068861_100006364 3300005719 Bacteria 8040
52 Ga0068861_100203619 3300005719 Bacteria 1663
53 Ga0068870_10000831 3300005840 Bacteria 12014
54 Ga0068870_10014039 3300005840 Bacteria 3775
55 Ga0068863_100030387 3300005841 Bacteria 5159
56 Ga0068863_100092174 3300005841 Unclassified 2874
57 Ga0068858_100001958 3300005842 Bacteria 21017
58 Ga0068858_100018075 3300005842 Bacteria 6602
59 Ga0068860_100002894 3300005843 Bacteria 17788
60 Ga0068862_100012814 3300005844 Bacteria 6936
61 Ga0081455_10025377 3300005937 Bacteria 5472
62 Ga0081455_10090334 3300005937 Bacteria 2484
63 Ga0081539_10014446 3300005985 Bacteria 5840
64 Ga0081539_10026782 3300005985 Bacteria 3666
65 Ga0070717_10008185 3300006028 Bacteria 7806
66 Ga0070717_10025479 3300006028 Unclassified 4704
67 Ga0070717_10042357 3300006028 Unclassified 3713
68 Ga0070712_100023751 3300006175 Bacteria 4054
69 Ga0075362_10034544 3300006177 Bacteria 2205
70 Ga0075366_10010260 3300006195 Bacteria 5254
71 Ga0097621_100058526 3300006237 Bacteria 3152
72 Ga0068871_100053714 3300006358 Bacteria 3266
73 Ga0075428_100008222 3300006844 Bacteria 11574
74 Ga0075428_100013990 3300006844 Bacteria 8932
75 Ga0075428_100050672 3300006844 Bacteria 4553
76 Ga0075428_100075962 3300006844 Unclassified 3668
77 Ga0075428_100380175 3300006844 Unclassified 1514
78 Ga0075430_100001677 3300006846 Bacteria 18099
79 Ga0075431_100002100 3300006847 Bacteria 19045
80 Ga0075433_10013118 3300006852 Bacteria 6724
81 Ga0075433_10081968 3300006852 Bacteria 2845
82 Ga0075433_10314616 3300006852 Bacteria 1385
83 Ga0075434_100056682 3300006871 Bacteria 3894
84 Ga0075434_100080681 3300006871 Unclassified 3251
85 Ga0075434_100099029 3300006871 Bacteria 2920
86 Ga0075434_100104712 3300006871 Bacteria 2839
87 Ga0075434_100129872 3300006871 Bacteria 2538
88 Ga0075434_100278401 3300006871 Bacteria 1692
89 Ga0075429_100031786 3300006880 Bacteria 4588
90 Ga0075429_100034901 3300006880 Bacteria 4371
91 Ga0097620_100005105 3300006931 Bacteria 13335
92 Ga0097620_100009006 3300006931 Bacteria 10081
93 Ga0097620_100016471 3300006931 Bacteria 7424
94 Ga0097620_100080661 3300006931 Bacteria 3295
95 Ga0075435_100035628 3300007076 Bacteria 3950
96 Ga0075435_100050049 3300007076 Bacteria 3361
97 Ga0075435_100177527 3300007076 Bacteria 1799
98 Ga0111539_10048463 3300009094 Bacteria 5072
99 Ga0111539_10077477 3300009094 Bacteria 3913
100 Ga0111539_10099282 3300009094 Bacteria 3419
101 Ga0111539_10115824 3300009094 Bacteria 3142
102 Ga0111539_10265710 3300009094 Bacteria 1997
103 Ga0105245_10017840 3300009098 Bacteria 6197
104 Ga0114129_10005989 3300009147 Bacteria 17227
105 Ga0114129_10009102 3300009147 Bacteria 14153
106 Ga0114129_10106513 3300009147 Bacteria 3873
107 Ga0114129_10151424 3300009147 Bacteria 3174
108 Ga0114129_10227195 3300009147 Bacteria 2515
109 Ga0114129_10238032 3300009147 Bacteria 2448
110 Ga0105243_10094398 3300009148 Bacteria 2470
111 Ga0105248_10028885 3300009177 Bacteria 6182
112 Ga0105249_10003968 3300009553 Bacteria 12769
113 Ga0163162_10011761 3300013306 Bacteria 8537
114 Ga0157372_10404298 3300013307 Bacteria 1591
115 Ga0157375_10004391 3300013308 Bacteria 12242
116 Ga0157375_10027990 3300013308 Bacteria 5275
117 Ga0157375_10055621 3300013308 Bacteria 3902
118 Ga0163163_10225405 3300014325 Bacteria 1923
119 Ga0163163_10265553 3300014325 Unclassified 1767
120 Ga0157380_10118771 3300014326 Bacteria 2236
121 Ga0163161_10021925 3300017792 Bacteria 4491
122 Ga0213876_10007902 3300021384 Bacteria 5769
123 Ga0213876_10013966 3300021384 Bacteria 4256
124 Ga0213875_10000790 3300021388 Bacteria 23663
125 Ga0213875_10011029 3300021388 Bacteria 4513
126 Ga0213875_10022622 3300021388 Bacteria 3006
127 Ga0207682_10005247 3300025893 Bacteria 5299
128 Ga0207692_10008302 3300025898 Bacteria 4296
129 Ga0207688_10012341 3300025901 Bacteria 4650
130 Ga0207645_10008106 3300025907 Bacteria 7363
131 Ga0207693_10040513 3300025915 Unclassified 3669
132 Ga0207662_10002973 3300025918 Bacteria 8631
133 Ga0207662_10011372 3300025918 Bacteria 4933
134 Ga0207649_10079020 3300025920 Bacteria 2124
135 Ga0207646_10039688 3300025922 Bacteria 4236
136 Ga0207659_10000310 3300025926 Bacteria 29559
137 Ga0207700_10063333 3300025928 Unclassified 2812
138 Ga0207664_10060349 3300025929 Unclassified 3022
139 Ga0207690_10257836 3300025932 Bacteria 1350
140 Ga0207706_10006664 3300025933 Bacteria 10678
141 Ga0207706_10007893 3300025933 Bacteria 9822
142 Ga0207686_10031034 3300025934 Bacteria 3169
143 Ga0207709_10059093 3300025935 Bacteria 2385
144 Ga0207670_10001948 3300025936 Bacteria 10818
145 Ga0207670_10009343 3300025936 Bacteria 5593
146 Ga0207669_10035778 3300025937 Bacteria 2830
147 Ga0207691_10006608 3300025940 Bacteria 11194
148 Ga0207691_10022860 3300025940 Bacteria 5893
149 Ga0207679_10007993 3300025945 Bacteria 6726
150 Ga0207651_10241120 3300025960 Unclassified 1473
151 Ga0207658_10010634 3300025986 Bacteria 6255
152 Ga0207703_10004903 3300026035 Bacteria 10878
153 Ga0207708_10025427 3300026075 Bacteria 4478
154 Ga0207708_10027575 3300026075 Bacteria 4301
155 Ga0207708_10050437 3300026075 Bacteria 3168
156 Ga0207641_10055750 3300026088 Unclassified 3356
157 Ga0207648_10000246 3300026089 Bacteria 58501
158 Ga0207676_10142705 3300026095 Bacteria 2052
159 Ga0207675_100001075 3300026118 Bacteria 27143
160 Ga0207675_100055880 3300026118 Bacteria 3683
161 Ga0207683_10029547 3300026121 Unclassified 4746
162 Ga0207683_10063537 3300026121 Bacteria 3252
163 Ga0207683_10137605 3300026121 Bacteria 2199
164 Ga0209971_1001627 3300027682 Bacteria 5554
165 Ga0207428_10023662 3300027907 Bacteria 5162
166 Ga0268266_10085400 3300028379 Bacteria 2757
167 Ga0268265_10001488 3300028380 Bacteria 19626
168 Ga0268265_10013079 3300028380 Bacteria 5635
169 Ga0268265_10136721 3300028380 Bacteria 2046
170 Ga0268264_10002712 3300028381 Bacteria 15454
171 Ga0265770_1013899 3300030878 Bacteria 1209
172 Ga0307509_10000370 3300031507 Bacteria 75863
173 Ga0373928_0015188 3300035084 Bacteria 1565
174 Ga0373941_0060185 3300035115 Bacteria 1234
175 Ga0373953_0068860 3300035117 Bacteria 1457
176 Ga0373943_0002256 3300035170 Bacteria 8760
177 Ga0373955_0069054 3300035172 Bacteria 1971
178 Ga0373961_0041329 3300035241 Bacteria 1332
179 Ga0373935_0028757 3300035692 Bacteria 3436
180 Ga0373935_0047634 3300035692 Bacteria 2711
181 Ga0373927_0068939 3300035695 Bacteria 2289
182 Ga0373937_0058759 3300036401 Bacteria 3533
183 Ga0373925_0012514 3300037068 Bacteria 6146
184 Ga0373925_0033914 3300037068 Bacteria 3761
185 Ga0373925_0160069 3300037068 Unclassified 1773
186 Ga0436364_0010755 3300037853 Bacteria 4256
187 Ga0436364_0036732 3300037853 Bacteria 6740
188 Ga0436364_0323687 3300037853 Bacteria 10086
189 Ga0436364_0673917 3300037853 Bacteria 36750
190 Ga0436364_1173377 3300037853 Unclassified 1948
191 Ga0436364_1232819 3300037853 Bacteria 22129
192 Ga0436365_0362738 3300039437 Bacteria 6336
193 Ga0436365_0760060 3300039437 Bacteria 44267
194 Ga0436363_0543238 3300039450 Bacteria 10741
195 Ga0466969_0004913 3300044656 Bacteria 7122
196 Ga0466966_0002138 3300044684 Bacteria 12813
197 Ga0466964_0001430 3300044706 Bacteria 8148
198 Ga0466970_0007805 3300044765 Bacteria 5370
199 Ga0451576_0051548 3300045051 Bacteria 4314
200 Ga0451576_0073314 3300045051 Bacteria 3562
201 Ga0451576_0133958 3300045051 Bacteria 2583
202 Ga0451576_0144593 3300045051 Bacteria 2479
203 Ga0466958_0167972 3300045836 Bacteria 1389
204 Ga0495580_0014674 3300046472 Bacteria 5938
205 Ga0495582_0082601 3300046473 Bacteria 1785
206 Ga0495583_0001022 3300046506 Bacteria 31806
207 Ga0495606_0001373 3300046507 Bacteria 32920
208 Ga0495628_0076544 3300046516 Bacteria 2604
209 Ga0495645_0119074 3300046543 Bacteria 1861
210 Ga0495633_0109006 3300046558 Bacteria 1284
211 Ga0495656_0026152 3300046615 Bacteria 2321
212 Ga0495661_0028639 3300046665 Bacteria 3563
213 Ga0495658_0062831 3300046683 Bacteria 2135
214 Ga0495674_0053361 3300047319 Bacteria 3554
215 Ga0495673_0004906 3300047469 Bacteria 8238
216 Ga0495686_0000063 3300047472 Bacteria 228575
217 Ga0496106_0127867 3300048909 Bacteria 1991
218 Ga0496117_0019601 3300048920 Bacteria 5548
219 Ga0496123_0040597 3300048926 Bacteria 3238
220 Ga0495682_0005382 3300049460 Bacteria 5329
221 Ga0501031_0118446 3300049568 Bacteria 1730
222 Ga0501034_0095041 3300049571 Bacteria 2977
223 Ga0501036_0118177 3300049572 Bacteria 2239
224 Ga0501037_0038600 3300049573 Bacteria 3518
225 Ga0501038_0012084 3300049574 Bacteria 7884
226 Ga0501039_0025275 3300049575 Bacteria 4562
227 Ga0501040_0001806 3300049576 Bacteria 13742
228 Ga0501040_0130532 3300049576 Bacteria 1766
229 Ga0501040_0181981 3300049576 Unclassified 1490
230 Ga0501041_0004575 3300049577 Bacteria 8023
231 Ga0501042_0001828 3300049578 Bacteria 12775
232 Ga0501043_0022523 3300049579 Bacteria 4939
233 Ga0501043_0025343 3300049579 Bacteria 4653
234 Ga0501046_0011226 3300049580 Bacteria 7671
235 Ga0501046_0220629 3300049580 Bacteria 1403
236 Ga0501048_0016723 3300049582 Bacteria 5407
237 Ga0501068_0014478 3300049584 Bacteria 4509
238 Ga0501070_0036622 3300049586 Bacteria 4097
239 Ga0501070_0043647 3300049586 Bacteria 3731
240 Ga0501071_0004972 3300049587 Bacteria 8490
241 Ga0501071_0072330 3300049587 Unclassified 2515
242 Ga0501072_0008243 3300049588 Bacteria 7915
243 Ga0501073_0034365 3300049589 Bacteria 3608
244 Ga0501074_0019180 3300049590 Bacteria 4965
245 Ga0501075_0002746 3300049591 Bacteria 11790
246 Ga0501076_0082565 3300049592 Bacteria 2579
247 Ga0501079_0008071 3300049741 Bacteria 7975
248 Ga0501080_0038109 3300049742 Bacteria 4489
249 Ga0501080_0045555 3300049742 Bacteria 4083
250 Ga0501080_0144051 3300049742 Bacteria 2202
251 Ga0501081_0005706 3300049743 Bacteria 8052
252 Ga0501035_0019828 3300049822 Bacteria 6178
253 Ga0501035_0028402 3300049822 Bacteria 5106
254 Ga0501035_0047921 3300049822 Bacteria 3833
255 Ga0501045_0006671 3300049824 Bacteria 7999
256 nmdc:mga0k408_82420_c1 3300050493 Bacteria 1885
257 nmdc:mga05p37_107566_c1 3300050507 Bacteria 3431
258 nmdc:mga05p37_11119_c1 3300050507 Bacteria 10697
259 nmdc:mga05p37_116626_c1 3300050507 Unclassified 3282
260 nmdc:mga05p37_128668_c1 3300050507 Bacteria 3108
261 nmdc:mga05p37_153477_c1 3300050507 Bacteria 2815
262 nmdc:mga05p37_30950_c1 3300050507 Bacteria 6534
263 nmdc:mga05p37_316509_c1 3300050507 Bacteria 1848
264 nmdc:mga05p37_5163_c1 3300050507 Bacteria 15305
265 nmdc:mga09592_148418_c1 3300050508 Bacteria 2022
266 nmdc:mga09592_28343_c1 3300050508 Bacteria 4652
267 nmdc:mga09592_44834_c1 3300050508 Bacteria 3724
268 nmdc:mga09592_9238_c1 3300050508 Bacteria 8019
269 nmdc:mga09592_94291_c1 3300050508 Bacteria 2560
270 nmdc:mga0qj67_283265_c1 3300050509 Unclassified 1343
271 nmdc:mga06r32_381195_c1 3300050510 Bacteria 1393
272 nmdc:mga06r32_55489_c1 3300050510 Bacteria 3800
273 nmdc:mga06r32_65270_c1 3300050510 Unclassified 3511
274 nmdc:mga08y16_1121_c1 3300050511 Bacteria 26404
275 nmdc:mga08y16_130091_c1 3300050511 Unclassified 2618
276 nmdc:mga08y16_458150_c1 3300050511 Bacteria 1300
277 nmdc:mga08y16_89303_c1 3300050511 Bacteria 3212
278 nmdc:mga0n895_10982_c1 3300050512 Bacteria 8047
279 nmdc:mga0n895_218257_c1 3300050512 Bacteria 1936
280 nmdc:mga0n895_394631_c1 3300050512 Bacteria 1400
281 nmdc:mga0n895_67152_c1 3300050512 Bacteria 3551
282 nmdc:mga0n895_7523_c1 3300050512 Bacteria 9355
283 nmdc:mga0n895_85486_c1 3300050512 Plasmid 3149
284 nmdc:mga0rr50_128716_c1 3300050513 Unclassified 2024
285 nmdc:mga0rr50_299934_c1 3300050513 Unclassified 1344
286 nmdc:mga0a205_110483_c1 3300050515 Bacteria 2648
287 nmdc:mga0a205_1274_c1 3300050515 Bacteria 21205
288 nmdc:mga0a205_134504_c1 3300050515 Unclassified 2373
289 nmdc:mga0a205_60488_c1 3300050515 Bacteria 3658
290 Ga0500555_001547 3300053103 Bacteria 6961
291 Ga0500604_0000090 3300053151 Bacteria 29328
292 Ga0500616_0014994 3300053153 Bacteria 4440
293 Ga0501084_0000459 3300054114 Bacteria 31419
294 Ga0501084_0010886 3300054114 Bacteria 7533
295 Ga0466962_0002148 3300061719 Bacteria 9314
296 Ga0530510_0006689 3300061734 Bacteria 8038
297 Ga0530510_0024116 3300061734 Bacteria 4339
298 Ga0075435_100149726
299 JGI25404J52841_10014701
300 Ga0065704_10000618
301 Ga0065707_10001292
302 Ga0070658_10068761
303 Ga0070677_10006760
304 Ga0070677_10055377
305 Ga0068869_100043770
306 Ga0070680_100209301
307 Ga0070689_100001996
308 Ga0070687_100006132
309 Ga0070692_10126088
310 Ga0070669_100002199
311 Ga0070669_100015391
312 Ga0070669_100228235
313 Ga0070675_100003022
314 Ga0070675_100080782
315 Ga0070671_100021510
316 Ga0070714_100050171
317 Ga0070713_100058444
318 Ga0070713_100105625
319 Ga0070710_10008991
320 Ga0070701_10001279
321 Ga0070701_10026874
322 Ga0070705_100000226
323 Ga0070700_100064983
324 Ga0070700_100185006
325 Ga0070694_100188410
326 Ga0070708_100237879
327 Ga0070678_100040068
328 Ga0070678_100089553
329 Ga0070678_100239794
330 Ga0068867_100004682
331 Ga0070707_100079163
332 Ga0070698_100006219
333 Ga0070699_100003870
334 Ga0070699_100022527
335 Ga0070697_100066558
336 Ga0070672_100007499
337 Ga0070695_100001530
338 Ga0070695_100121965
339 Ga0070696_100000106
340 Ga0070696_100022745
341 Ga0070665_100000229
342 Ga0070664_100007889
343 Ga0068859_100005105
344 Ga0068859_100009007
345 Ga0068859_100016471
346 Ga0068859_100080659
347 Ga0068864_100158105
348 Ga0068861_100006364
349 Ga0068861_100203619
350 Ga0068870_10000831
351 Ga0068870_10014039
352 Ga0068863_100030387
353 Ga0068863_100092174
354 Ga0068858_100001958
355 Ga0068858_100018075
356 Ga0068860_100002894
357 Ga0068862_100012814
358 Ga0081455_10025377
359 Ga0081455_10090334
360 Ga0081539_10014446
361 Ga0081539_10026782
362 Ga0070717_10008185
363 Ga0070717_10025479
364 Ga0070717_10042357
365 Ga0070712_100023751
366 Ga0075362_10034544
367 Ga0075366_10010260
368 Ga0097621_100058526
369 Ga0068871_100053714
370 Ga0075428_100008222
371 Ga0075428_100013990
372 Ga0075428_100050672
373 Ga0075428_100075962
374 Ga0075428_100380175
375 Ga0075430_100001677
376 Ga0075431_100002100
377 Ga0075433_10013118
378 Ga0075433_10081968
379 Ga0075433_10314616
380 Ga0075434_100056682
381 Ga0075434_100080681
382 Ga0075434_100099029
383 Ga0075434_100104712
384 Ga0075434_100129872
385 Ga0075434_100278401
386 Ga0075429_100031786
387 Ga0075429_100034901
388 Ga0097620_100005105
389 Ga0097620_100009006
390 Ga0097620_100016471
391 Ga0097620_100080661
392 Ga0075435_100035628
393 Ga0075435_100050049
394 Ga0075435_100177527
395 Ga0111539_10048463
396 Ga0111539_10077477
397 Ga0111539_10099282
398 Ga0111539_10115824
399 Ga0111539_10265710
400 Ga0105245_10017840
401 Ga0114129_10005989
402 Ga0114129_10009102
403 Ga0114129_10106513
404 Ga0114129_10151424
405 Ga0114129_10227195
406 Ga0114129_10238032
407 Ga0105243_10094398
408 Ga0105248_10028885
409 Ga0105249_10003968
410 Ga0163162_10011761
411 Ga0157372_10404298
412 Ga0157375_10004391
413 Ga0157375_10027990
414 Ga0157375_10055621
415 Ga0163163_10225405
416 Ga0163163_10265553
417 Ga0157380_10118771
418 Ga0163161_10021925
419 Ga0213876_10007902
420 Ga0213876_10013966
421 Ga0213875_10000790
422 Ga0213875_10011029
423 Ga0213875_10022622
424 Ga0207682_10005247
425 Ga0207692_10008302
426 Ga0207688_10012341
427 Ga0207645_10008106
428 Ga0207693_10040513
429 Ga0207662_10002973
430 Ga0207662_10011372
431 Ga0207649_10079020
432 Ga0207646_10039688
433 Ga0207659_10000310
434 Ga0207700_10063333
435 Ga0207664_10060349
436 Ga0207690_10257836
437 Ga0207706_10006664
438 Ga0207706_10007893
439 Ga0207686_10031034
440 Ga0207709_10059093
441 Ga0207670_10001948
442 Ga0207670_10009343
443 Ga0207669_10035778
444 Ga0207691_10006608
445 Ga0207691_10022860
446 Ga0207679_10007993
447 Ga0207651_10241120
448 Ga0207658_10010634
449 Ga0207703_10004903
450 Ga0207708_10025427
451 Ga0207708_10027575
452 Ga0207708_10050437
453 Ga0207641_10055750
454 Ga0207648_10000246
455 Ga0207676_10142705
456 Ga0207675_100001075
457 Ga0207675_100055880
458 Ga0207683_10029547
459 Ga0207683_10063537
460 Ga0207683_10137605
461 Ga0209971_1001627
462 Ga0207428_10023662
463 Ga0268266_10085400
464 Ga0268265_10001488
465 Ga0268265_10013079
466 Ga0268265_10136721
467 Ga0268264_10002712
468 Ga0265770_1013899
469 Ga0307509_10000370
470 Ga0373928_0015188
471 Ga0373941_0060185
472 Ga0373953_0068860
473 Ga0373943_0002256
474 Ga0373955_0069054
475 Ga0373961_0041329
476 Ga0373935_0028757
477 Ga0373935_0047634
478 Ga0373927_0068939
479 Ga0373937_0058759
480 Ga0373925_0012514
481 Ga0373925_0033914
482 Ga0373925_0160069
483 Ga0436364_0010755
484 Ga0436364_0036732
485 Ga0436364_0323687
486 Ga0436364_0673917
487 Ga0436364_1173377
488 Ga0436364_1232819
489 Ga0436365_0362738
490 Ga0436365_0760060
491 Ga0436363_0543238
492 Ga0466969_0004913
493 Ga0466966_0002138
494 Ga0466964_0001430
495 Ga0466970_0007805
496 Ga0451576_0051548
497 Ga0451576_0073314
498 Ga0451576_0133958
499 Ga0451576_0144593
500 Ga0466958_0167972
501 Ga0495580_0014674
502 Ga0495582_0082601
503 Ga0495583_0001022
504 Ga0495606_0001373
505 Ga0495628_0076544
506 Ga0495645_0119074
507 Ga0495633_0109006
508 Ga0495656_0026152
509 Ga0495661_0028639
510 Ga0495658_0062831
511 Ga0495674_0053361
512 Ga0495673_0004906
513 Ga0495686_0000063
514 Ga0496106_0127867
515 Ga0496117_0019601
516 Ga0496123_0040597
517 Ga0495682_0005382
518 Ga0501031_0118446
519 Ga0501034_0095041
520 Ga0501036_0118177
521 Ga0501037_0038600
522 Ga0501038_0012084
523 Ga0501039_0025275
524 Ga0501040_0001806
525 Ga0501040_0130532
526 Ga0501040_0181981
527 Ga0501041_0004575
528 Ga0501042_0001828
529 Ga0501043_0022523
530 Ga0501043_0025343
531 Ga0501046_0011226
532 Ga0501046_0220629
533 Ga0501048_0016723
534 Ga0501068_0014478
535 Ga0501070_0036622
536 Ga0501070_0043647
537 Ga0501071_0004972
538 Ga0501071_0072330
539 Ga0501072_0008243
540 Ga0501073_0034365
541 Ga0501074_0019180
542 Ga0501075_0002746
543 Ga0501076_0082565
544 Ga0501079_0008071
545 Ga0501080_0038109
546 Ga0501080_0045555
547 Ga0501080_0144051
548 Ga0501081_0005706
549 Ga0501035_0019828
550 Ga0501035_0028402
551 Ga0501035_0047921
552 Ga0501045_0006671
553 nmdc:mga0k408_82420_c1
554 nmdc:mga05p37_107566_c1
555 nmdc:mga05p37_11119_c1
556 nmdc:mga05p37_116626_c1
557 nmdc:mga05p37_128668_c1
558 nmdc:mga05p37_153477_c1
559 nmdc:mga05p37_30950_c1
560 nmdc:mga05p37_316509_c1
561 nmdc:mga05p37_5163_c1
562 nmdc:mga09592_148418_c1
563 nmdc:mga09592_28343_c1
564 nmdc:mga09592_44834_c1
565 nmdc:mga09592_9238_c1
566 nmdc:mga09592_94291_c1
567 nmdc:mga0qj67_283265_c1
568 nmdc:mga06r32_381195_c1
569 nmdc:mga06r32_55489_c1
570 nmdc:mga06r32_65270_c1
571 nmdc:mga08y16_1121_c1
572 nmdc:mga08y16_130091_c1
573 nmdc:mga08y16_458150_c1
574 nmdc:mga08y16_89303_c1
575 nmdc:mga0n895_10982_c1
576 nmdc:mga0n895_218257_c1
577 nmdc:mga0n895_394631_c1
578 nmdc:mga0n895_67152_c1
579 nmdc:mga0n895_7523_c1
580 nmdc:mga0n895_85486_c1
581 nmdc:mga0rr50_128716_c1
582 nmdc:mga0rr50_299934_c1
583 nmdc:mga0a205_110483_c1
584 nmdc:mga0a205_1274_c1
585 nmdc:mga0a205_134504_c1
586 nmdc:mga0a205_60488_c1
587 Ga0500555_001547
588 Ga0500604_0000090
589 Ga0500616_0014994
590 Ga0501084_0000459
591 Ga0501084_0010886
592 Ga0466962_0002148
593 Ga0530510_0006689
594 Ga0530510_0024116

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01717

Meth_synt_2

Cobalamin-independent synthase, Catalytic domain

201

439

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bq6-assembly2.cif.gz_B crystal structure of t. maritima cobalamin-independent methionine synthase complexed with zn2+ (monoclinic) 0.8655 1 376
1xpg-assembly1.cif.gz_A crystal structure of t. maritima cobalamin-independent methionine synthase complexed with zn2+ and methyltetrahydrofolate 0.8638 1 380
1t7l-assembly2.cif.gz_B crystal structure of cobalamin-independent methionine synthase from t. maritima 0.854 1 376
1xr2-assembly2.cif.gz_B crystal structure of oxidized t. maritima cobalamin-independent methionine synthase complexed with methyltetrahydrofolate 0.8525 1 376
1t7l-assembly1.cif.gz_A crystal structure of cobalamin-independent methionine synthase from t. maritima 0.8518 1 380
ID Description Score Start End Superfamily
2nq5A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8375 1 376 3.20.20.210
af_Q54X49_428_818_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8263 3 376 3.20.20.210
1xdjA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8158 1 380 3.20.20.210
af_K7MME4_84_171_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8155 292 379 3.20.20.210
1ypxA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.7898 2 374 3.20.20.210
ID Description Score Start End GO Terms
AF-A0A537BYS7-F1-model_v4 Epoxyalkane--coenzyme M transferase 0.989 279 380 GO:0016740
AF-A0A2V8GRJ4-F1-model_v4 Cobalamin-independent methionine synthase MetE C-terminal/archaeal domain-containing protein 0.9833 179 382 GO:0003871
GO:0008270
GO:0009086
AF-A0A537D100-F1-model_v4 Cobalamin-independent methionine synthase MetE C-terminal/archaeal domain-containing protein 0.9765 155 380 GO:0003871
GO:0008270
GO:0009086
AF-A0A2W4PMZ6-F1-model_v4 Cobalamin-independent methionine synthase MetE C-terminal/archaeal domain-containing protein 0.9757 268 380
AF-A0A1I4VIK2-F1-model_v4 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 0.974 265 380 GO:0008168
GO:0032259

Map