F393621

General Info

Members Datasets Scaffolds Average Seq Length
297 202 594 114

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_100831329|Ga0068860_1008313292
Length 112
Sequence MRRGEIWWASTGHPSGSEPGYRRPAVIISANSFNATALKTIIVAFLTSATKRAGDPGNVRLPARSAGLPRDSILNVTQITSIDRRTLTEPAGRVPDDLMREVDAGLRLVLAL

Samples

Sample ID Description Type Environment
1 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
123 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
124 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
125 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
126 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
127 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
128 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
129 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
130 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
131 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
132 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
133 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
134 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
137 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
138 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
139 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
140 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
141 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
142 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
143 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
144 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
145 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
146 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
147 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
151 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
152 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
153 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
154 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
155 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
156 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
157 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
158 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
159 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
160 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
161 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
162 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
163 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
164 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
165 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
166 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
167 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
183 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
184 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
185 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
186 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
189 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
190 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
192 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
193 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
194 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
195 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
196 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
199 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
200 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
201 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
202 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.01
Nodule 0
Rhizoplane 2.69
Rhizosphere 95.62
Stem 0
Stem Tuber 0
Unclassified 37.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068860_100831329 3300005843 Bacteria 938
2 SwRhRL2b_contig_2468154 2162886007 Unclassified 992
3 rootH2_10136149 3300003320 Bacteria 6600
4 Ga0070676_10276059 3300005328 Bacteria 1130
5 Ga0070690_100136861 3300005330 Bacteria 1659
6 Ga0070677_10282873 3300005333 Unclassified 836
7 Ga0068869_100092622 3300005334 Unclassified 2275
8 Ga0068869_100391196 3300005334 Bacteria 1141
9 Ga0068869_100893578 3300005334 Unclassified 768
10 Ga0070666_10295755 3300005335 Bacteria 1152
11 Ga0070666_10311998 3300005335 Bacteria 1121
12 Ga0070682_101450694 3300005337 Unclassified 588
13 Ga0070689_100405954 3300005340 Bacteria 1152
14 Ga0070661_100326622 3300005344 Unclassified 1199
15 Ga0070668_101098649 3300005347 Unclassified 718
16 Ga0070675_100630580 3300005354 Unclassified 973
17 Ga0070674_100357806 3300005356 Bacteria 1181
18 Ga0070674_100498642 3300005356 Unclassified 1014
19 Ga0070673_100211712 3300005364 Bacteria 1674
20 Ga0070688_100821952 3300005365 Unclassified 728
21 Ga0070667_100075871 3300005367 Bacteria 2870
22 Ga0070709_10044728 3300005434 Bacteria 2743
23 Ga0070709_10106863 3300005434 Bacteria 1874
24 Ga0070714_100204571 3300005435 Bacteria 1807
25 Ga0070714_101372357 3300005435 Bacteria 690
26 Ga0070713_100068742 3300005436 Bacteria 2985
27 Ga0070701_10728921 3300005438 Unclassified 669
28 Ga0070705_100005921 3300005440 Bacteria 5979
29 Ga0070700_101131855 3300005441 Bacteria 650
30 Ga0070700_101374865 3300005441 Unclassified 596
31 Ga0070694_100003565 3300005444 Bacteria 9308
32 Ga0070694_100178506 3300005444 Bacteria 1569
33 Ga0070694_100249836 3300005444 Bacteria 1341
34 Ga0070708_100000888 3300005445 Bacteria 22619
35 Ga0070708_100033737 3300005445 Bacteria 4447
36 Ga0070663_100555852 3300005455 Bacteria 960
37 Ga0070678_100223884 3300005456 Bacteria 1565
38 Ga0068867_101437381 3300005459 Bacteria 640
39 Ga0070685_10011404 3300005466 Bacteria 4653
40 Ga0070685_10342664 3300005466 Bacteria 1019
41 Ga0070706_100331844 3300005467 Bacteria 1418
42 Ga0070706_100573445 3300005467 Unclassified 1049
43 Ga0070706_100917554 3300005467 Unclassified 809
44 Ga0070707_100237019 3300005468 Bacteria 1776
45 Ga0070707_100257269 3300005468 Unclassified 1699
46 Ga0070698_100008537 3300005471 Bacteria 11053
47 Ga0070698_101381637 3300005471 Unclassified 655
48 Ga0070699_100013285 3300005518 Bacteria 7101
49 Ga0070699_100527865 3300005518 Bacteria 1073
50 Ga0070699_101466241 3300005518 Unclassified 626
51 Ga0070684_101021709 3300005535 Bacteria 776
52 Ga0070697_101263756 3300005536 Bacteria 658
53 Ga0070672_100104418 3300005543 Bacteria 2302
54 Ga0070672_101806661 3300005543 Unclassified 550
55 Ga0070686_100063995 3300005544 Bacteria 2384
56 Ga0070695_100008632 3300005545 Bacteria 6053
57 Ga0070696_100146796 3300005546 Bacteria 1728
58 Ga0070696_100478377 3300005546 Unclassified 987
59 Ga0070665_100248152 3300005548 Bacteria 1780
60 Ga0070704_100013991 3300005549 Bacteria 4999
61 Ga0070704_100039981 3300005549 Bacteria 3224
62 Ga0070704_100861395 3300005549 Unclassified 813
63 Ga0070704_101249584 3300005549 Unclassified 678
64 Ga0068855_100166968 3300005563 Bacteria 2494
65 Ga0070664_100003670 3300005564 Bacteria 12367
66 Ga0070664_101062398 3300005564 Unclassified 762
67 Ga0070664_101099602 3300005564 Bacteria 749
68 Ga0068857_100338252 3300005577 Bacteria 1392
69 Ga0068857_100955344 3300005577 Unclassified 823
70 Ga0068854_100976958 3300005578 Bacteria 748
71 Ga0068856_100663792 3300005614 Bacteria 1063
72 Ga0068859_100137460 3300005617 Bacteria 2517
73 Ga0068859_100274383 3300005617 Unclassified 1779
74 Ga0068859_101164434 3300005617 Bacteria 849
75 Ga0068859_101379688 3300005617 Unclassified 777
76 Ga0068870_10539724 3300005840 Unclassified 783
77 Ga0068858_100291355 3300005842 Bacteria 1556
78 Ga0068858_101144829 3300005842 Unclassified 764
79 Ga0068860_100527693 3300005843 Unclassified 1181
80 Ga0068860_100714245 3300005843 Bacteria 1012
81 Ga0068860_102254091 3300005843 Unclassified 565
82 Ga0068862_100073152 3300005844 Bacteria 2962
83 Ga0068862_100264900 3300005844 Bacteria 1570
84 Ga0068862_100432582 3300005844 Unclassified 1237
85 Ga0068862_100455844 3300005844 Unclassified 1206
86 Ga0070717_10089485 3300006028 Bacteria 2596
87 Ga0075365_10022764 3300006038 Bacteria 3930
88 Ga0070716_100076939 3300006173 Bacteria 1979
89 Ga0070712_100011107 3300006175 Bacteria 5701
90 Ga0097621_100720927 3300006237 Unclassified 919
91 Ga0097621_101216367 3300006237 Unclassified 710
92 Ga0075428_100290360 3300006844 Bacteria 1759
93 Ga0075431_100237517 3300006847 Unclassified 1855
94 Ga0075433_11177876 3300006852 Unclassified 665
95 Ga0075429_100260897 3300006880 Bacteria 1517
96 Ga0075429_101632979 3300006880 Unclassified 560
97 Ga0068865_100518459 3300006881 Unclassified 996
98 Ga0097620_100137456 3300006931 Bacteria 2517
99 Ga0097620_100274359 3300006931 Unclassified 1779
100 Ga0097620_101164204 3300006931 Bacteria 849
101 Ga0097620_101379745 3300006931 Unclassified 777
102 Ga0075435_100588040 3300007076 Bacteria 965
103 Ga0105240_10286996 3300009093 Unclassified 1888
104 Ga0111539_10008832 3300009094 Bacteria 12768
105 Ga0111539_11701068 3300009094 Unclassified 732
106 Ga0111539_12217246 3300009094 Unclassified 637
107 Ga0105245_10944217 3300009098 Unclassified 905
108 Ga0105245_12097857 3300009098 Unclassified 619
109 Ga0114129_10065667 3300009147 Bacteria 5064
110 Ga0114129_10082254 3300009147 Bacteria 4475
111 Ga0114129_10233732 3300009147 Bacteria 2475
112 Ga0114129_10302347 3300009147 Bacteria 2132
113 Ga0114129_11328476 3300009147 Bacteria 890
114 Ga0114129_12571615 3300009147 Unclassified 608
115 Ga0105243_11097824 3300009148 Archaea 804
116 Ga0105243_11422788 3300009148 Unclassified 715
117 Ga0105242_10217928 3300009176 Bacteria 1704
118 Ga0105248_10765460 3300009177 Bacteria 1090
119 Ga0105248_10830952 3300009177 Unclassified 1043
120 Ga0105238_10045558 3300009551 Bacteria 4431
121 Ga0105249_10011754 3300009553 Bacteria 7696
122 Ga0105249_10299156 3300009553 Bacteria 1613
123 Ga0105249_10363398 3300009553 Unclassified 1469
124 Ga0105239_10248091 3300010375 Bacteria 1999
125 Ga0105239_10679994 3300010375 Unclassified 1176
126 Ga0105239_10989192 3300010375 Unclassified 967
127 Ga0105246_10906698 3300011119 Unclassified 791
128 Ga0157370_10309992 3300013104 Unclassified 1456
129 Ga0157369_11470108 3300013105 Unclassified 693
130 Ga0157374_11354600 3300013296 Unclassified 734
131 Ga0163162_10026280 3300013306 Bacteria 5754
132 Ga0157372_10312475 3300013307 Bacteria 1829
133 Ga0157375_10260155 3300013308 Unclassified 1897
134 Ga0157375_10612670 3300013308 Bacteria 1247
135 Ga0157375_10846278 3300013308 Bacteria 1061
136 Ga0157375_13161383 3300013308 Unclassified 549
137 Ga0157375_13793506 3300013308 Unclassified 502
138 Ga0157380_10638805 3300014326 Bacteria 1060
139 Ga0157380_12600069 3300014326 Unclassified 572
140 Ga0182008_10127317 3300014497 Unclassified 1269
141 Ga0157377_10007538 3300014745 Bacteria 5261
142 Ga0157377_10334185 3300014745 Unclassified 1011
143 Ga0157379_10248121 3300014968 Unclassified 1616
144 Ga0157379_10673429 3300014968 Archaea 970
145 Ga0157376_10355300 3300014969 Bacteria 1404
146 Ga0207697_10124578 3300025315 Bacteria 1111
147 Ga0207682_10516975 3300025893 Unclassified 565
148 Ga0207692_10417154 3300025898 Bacteria 840
149 Ga0207680_10646709 3300025903 Unclassified 757
150 Ga0207645_10266474 3300025907 Bacteria 1135
151 Ga0207643_10489312 3300025908 Unclassified 786
152 Ga0207705_10871508 3300025909 Unclassified 698
153 Ga0207695_10228753 3300025913 Unclassified 1765
154 Ga0207693_10033373 3300025915 Bacteria 4062
155 Ga0207646_10009943 3300025922 Bacteria 9352
156 Ga0207646_10061187 3300025922 Bacteria 3361
157 Ga0207646_10097700 3300025922 Bacteria 2631
158 Ga0207681_10203601 3300025923 Bacteria 1521
159 Ga0207700_10007401 3300025928 Bacteria 6705
160 Ga0207700_10335048 3300025928 Bacteria 1314
161 Ga0207664_10264730 3300025929 Bacteria 1504
162 Ga0207664_10645840 3300025929 Bacteria 951
163 Ga0207644_10273689 3300025931 Unclassified 1354
164 Ga0207686_10578186 3300025934 Unclassified 881
165 Ga0207709_11574324 3300025935 Archaea 546
166 Ga0207670_10101035 3300025936 Bacteria 2060
167 Ga0207669_10422199 3300025937 Bacteria 1050
168 Ga0207704_10893670 3300025938 Bacteria 747
169 Ga0207704_11480575 3300025938 Unclassified 582
170 Ga0207665_10172547 3300025939 Bacteria 1562
171 Ga0207665_10422403 3300025939 Bacteria 1019
172 Ga0207691_10419567 3300025940 Bacteria 1140
173 Ga0207689_10091287 3300025942 Unclassified 2502
174 Ga0207689_10409315 3300025942 Bacteria 1131
175 Ga0207661_10108248 3300025944 Bacteria 2346
176 Ga0207661_10769243 3300025944 Unclassified 886
177 Ga0207679_10036244 3300025945 Bacteria 3496
178 Ga0207712_10061527 3300025961 Bacteria 2665
179 Ga0207658_10062985 3300025986 Bacteria 2778
180 Ga0207658_10320058 3300025986 Unclassified 1342
181 Ga0207703_11661804 3300026035 Unclassified 614
182 Ga0207678_10421761 3300026067 Unclassified 1157
183 Ga0207708_10317393 3300026075 Bacteria 1271
184 Ga0207708_11028574 3300026075 Bacteria 716
185 Ga0207702_10997215 3300026078 Bacteria 831
186 Ga0207676_11297045 3300026095 Bacteria 723
187 Ga0207674_10056903 3300026116 Bacteria 3967
188 Ga0207674_10331657 3300026116 Unclassified 1471
189 Ga0207675_100484352 3300026118 Unclassified 1230
190 Ga0207675_101073029 3300026118 Bacteria 825
191 Ga0207683_10266244 3300026121 Bacteria 1565
192 Ga0209974_10117466 3300027876 Bacteria 940
193 Ga0268266_10093537 3300028379 Bacteria 2638
194 Ga0268265_11084225 3300028380 Unclassified 794
195 Ga0265319_1149792 3300028563 Bacteria 722
196 Ga0265334_10138556 3300028573 Bacteria 863
197 Ga0265338_10323182 3300028800 Bacteria 1116
198 Ga0265324_10033782 3300029957 Unclassified 1783
199 Ga0265332_10131835 3300031238 Unclassified 1048
200 Ga0265320_10004308 3300031240 Bacteria 9353
201 Ga0265329_10205857 3300031242 Bacteria 648
202 Ga0265340_10005212 3300031247 Bacteria 7220
203 Ga0265331_10015029 3300031250 Bacteria 4101
204 Ga0316579_10236581 3300031691 Bacteria 883
205 Ga0265314_10376981 3300031711 Bacteria 773
206 Ga0265342_10003363 3300031712 Bacteria 13211
207 Ga0316577_10000667 3300031733 Bacteria 14363
208 Ga0316577_10090639 3300031733 Bacteria 1711
209 Ga0307416_102205752 3300032002 Bacteria 652
210 Ga0373934_0020167 3300035086 Bacteria 2562
211 Ga0373954_0194147 3300035118 Unclassified 997
212 Ga0373955_0802771 3300035172 Unclassified 578
213 Ga0316574_0061203 3300035398 Unclassified 2364
214 Ga0316574_1011699 3300035398 Unclassified 500
215 Ga0373933_0049273 3300035724 Bacteria 2511
216 Ga0316582_0261827 3300036647 Bacteria 1186
217 Ga0316582_0948826 3300036647 Unclassified 588
218 Ga0316584_0283416 3300036712 Bacteria 1203
219 Ga0316584_0571520 3300036712 Unclassified 787
220 Ga0436363_0638462 3300039450 Unclassified 2121
221 Ga0451798_0248216 3300041458 Bacteria 942
222 Ga0451807_1877493 3300041486 Unclassified 610
223 Ga0450907_093522 3300042146 Unclassified 523
224 Ga0453683_0271282 3300044673 Bacteria 1083
225 Ga0453684_0092725 3300044712 Bacteria 3722
226 Ga0453684_0096298 3300044712 Bacteria 3636
227 Ga0453684_0928765 3300044712 Bacteria 930
228 Ga0451576_0272787 3300045051 Bacteria 1768
229 Ga0495653_0065170 3300046463 Unclassified 2743
230 Ga0495580_0163912 3300046472 Unclassified 1538
231 Ga0495580_0267679 3300046472 Bacteria 1168
232 Ga0495594_0025764 3300046499 Unclassified 3161
233 Ga0495628_0027152 3300046516 Bacteria 4661
234 Ga0495652_0082322 3300046529 Bacteria 2653
235 Ga0495587_0015792 3300046536 Bacteria 4707
236 Ga0495598_0152913 3300046537 Bacteria 807
237 Ga0495621_0010992 3300046539 Archaea 2786
238 Ga0495645_0003370 3300046543 Bacteria 10828
239 Ga0495622_0409923 3300046557 Unclassified 583
240 Ga0495667_0035021 3300046559 Bacteria 3357
241 Ga0495657_0320773 3300046675 Unclassified 921
242 Ga0495599_0012290 3300046678 Bacteria 5274
243 Ga0495623_0007012 3300046679 Bacteria 7325
244 Ga0495600_0127732 3300046809 Bacteria 1653
245 Ga0495600_0135199 3300046809 Bacteria 1602
246 Ga0495672_0003461 3300047320 Bacteria 13501
247 Ga0495675_0017779 3300047444 Bacteria 4508
248 Ga0495684_0383531 3300047471 Unclassified 991
249 Ga0496104_0053903 3300048907 Bacteria 3801
250 Ga0496106_0287864 3300048909 Bacteria 1317
251 Ga0496108_0362161 3300048911 Bacteria 1266
252 Ga0496108_1761296 3300048911 Unclassified 508
253 Ga0496109_0046363 3300048912 Bacteria 3948
254 Ga0496110_0862001 3300048913 Unclassified 811
255 Ga0501036_0727436 3300049572 Bacteria 819
256 Ga0501038_0296589 3300049574 Bacteria 1269
257 Ga0501039_0493731 3300049575 Bacteria 961
258 Ga0501040_0090318 3300049576 Bacteria 2129
259 Ga0501040_0235209 3300049576 Bacteria 1305
260 Ga0501041_0036156 3300049577 Bacteria 2993
261 Ga0501042_0029784 3300049578 Bacteria 3850
262 Ga0501042_1353932 3300049578 Unclassified 519
263 Ga0501047_0519410 3300049581 Bacteria 1017
264 Ga0501071_0152284 3300049587 Bacteria 1726
265 Ga0501072_0067220 3300049588 Bacteria 2828
266 Ga0501073_0388422 3300049589 Bacteria 964
267 Ga0501075_0015151 3300049591 Bacteria 5529
268 Ga0501076_0137425 3300049592 Unclassified 1984
269 Ga0501076_0653303 3300049592 Bacteria 868
270 Ga0501077_0560705 3300049593 Unclassified 733
271 Ga0501079_0101739 3300049741 Unclassified 2228
272 Ga0501079_0245969 3300049741 Unclassified 1398
273 Ga0501080_0316611 3300049742 Bacteria 1413
274 Ga0501081_0004019 3300049743 Bacteria 9434
275 Ga0501081_0477159 3300049743 Unclassified 928
276 Ga0501081_0928807 3300049743 Bacteria 656
277 Ga0501083_0485016 3300049744 Bacteria 804
278 Ga0501035_0156760 3300049822 Bacteria 1973
279 Ga0501045_0053687 3300049824 Bacteria 2945
280 nmdc:mga0yw44_356906_c1 3300050492 Bacteria 985
281 nmdc:mga05p37_1833427_c1 3300050507 Unclassified 583
282 nmdc:mga05p37_19883_c1 3300050507 Bacteria 8122
283 nmdc:mga05p37_241223_c1 3300050507 Unclassified 2173
284 nmdc:mga05p37_78398_c1 3300050507 Bacteria 4068
285 nmdc:mga09592_341275_c1 3300050508 Bacteria 1297
286 nmdc:mga0rr50_39416_c1 3300050513 Bacteria 3427
287 nmdc:mga0rr50_726033_c1 3300050513 Unclassified 848
288 nmdc:mga0rr50_996910_c1 3300050513 Unclassified 714
289 nmdc:mga08x19_1049812_c1 3300050514 Unclassified 578
290 nmdc:mga0a205_234030_c1 3300050515 Bacteria 1720
291 nmdc:mga0a205_328715_c1 3300050515 Bacteria 1399
292 Ga0495612_0492412 3300053078 Unclassified 562
293 Ga0500628_023918 3300053129 Bacteria 1264
294 Ga0501084_0496399 3300054114 Bacteria 1031
295 Ga0501082_0113098 3300060353 Unclassified 2350
296 Ga0501082_0280127 3300060353 Bacteria 1451
297 Ga0530510_0104894 3300061734 Unclassified 2068
298 Ga0068860_100831329
299 SwRhRL2b_contig_2468154
300 rootH2_10136149
301 Ga0070676_10276059
302 Ga0070690_100136861
303 Ga0070677_10282873
304 Ga0068869_100092622
305 Ga0068869_100391196
306 Ga0068869_100893578
307 Ga0070666_10295755
308 Ga0070666_10311998
309 Ga0070682_101450694
310 Ga0070689_100405954
311 Ga0070661_100326622
312 Ga0070668_101098649
313 Ga0070675_100630580
314 Ga0070674_100357806
315 Ga0070674_100498642
316 Ga0070673_100211712
317 Ga0070688_100821952
318 Ga0070667_100075871
319 Ga0070709_10044728
320 Ga0070709_10106863
321 Ga0070714_100204571
322 Ga0070714_101372357
323 Ga0070713_100068742
324 Ga0070701_10728921
325 Ga0070705_100005921
326 Ga0070700_101131855
327 Ga0070700_101374865
328 Ga0070694_100003565
329 Ga0070694_100178506
330 Ga0070694_100249836
331 Ga0070708_100000888
332 Ga0070708_100033737
333 Ga0070663_100555852
334 Ga0070678_100223884
335 Ga0068867_101437381
336 Ga0070685_10011404
337 Ga0070685_10342664
338 Ga0070706_100331844
339 Ga0070706_100573445
340 Ga0070706_100917554
341 Ga0070707_100237019
342 Ga0070707_100257269
343 Ga0070698_100008537
344 Ga0070698_101381637
345 Ga0070699_100013285
346 Ga0070699_100527865
347 Ga0070699_101466241
348 Ga0070684_101021709
349 Ga0070697_101263756
350 Ga0070672_100104418
351 Ga0070672_101806661
352 Ga0070686_100063995
353 Ga0070695_100008632
354 Ga0070696_100146796
355 Ga0070696_100478377
356 Ga0070665_100248152
357 Ga0070704_100013991
358 Ga0070704_100039981
359 Ga0070704_100861395
360 Ga0070704_101249584
361 Ga0068855_100166968
362 Ga0070664_100003670
363 Ga0070664_101062398
364 Ga0070664_101099602
365 Ga0068857_100338252
366 Ga0068857_100955344
367 Ga0068854_100976958
368 Ga0068856_100663792
369 Ga0068859_100137460
370 Ga0068859_100274383
371 Ga0068859_101164434
372 Ga0068859_101379688
373 Ga0068870_10539724
374 Ga0068858_100291355
375 Ga0068858_101144829
376 Ga0068860_100527693
377 Ga0068860_100714245
378 Ga0068860_102254091
379 Ga0068862_100073152
380 Ga0068862_100264900
381 Ga0068862_100432582
382 Ga0068862_100455844
383 Ga0070717_10089485
384 Ga0075365_10022764
385 Ga0070716_100076939
386 Ga0070712_100011107
387 Ga0097621_100720927
388 Ga0097621_101216367
389 Ga0075428_100290360
390 Ga0075431_100237517
391 Ga0075433_11177876
392 Ga0075429_100260897
393 Ga0075429_101632979
394 Ga0068865_100518459
395 Ga0097620_100137456
396 Ga0097620_100274359
397 Ga0097620_101164204
398 Ga0097620_101379745
399 Ga0075435_100588040
400 Ga0105240_10286996
401 Ga0111539_10008832
402 Ga0111539_11701068
403 Ga0111539_12217246
404 Ga0105245_10944217
405 Ga0105245_12097857
406 Ga0114129_10065667
407 Ga0114129_10082254
408 Ga0114129_10233732
409 Ga0114129_10302347
410 Ga0114129_11328476
411 Ga0114129_12571615
412 Ga0105243_11097824
413 Ga0105243_11422788
414 Ga0105242_10217928
415 Ga0105248_10765460
416 Ga0105248_10830952
417 Ga0105238_10045558
418 Ga0105249_10011754
419 Ga0105249_10299156
420 Ga0105249_10363398
421 Ga0105239_10248091
422 Ga0105239_10679994
423 Ga0105239_10989192
424 Ga0105246_10906698
425 Ga0157370_10309992
426 Ga0157369_11470108
427 Ga0157374_11354600
428 Ga0163162_10026280
429 Ga0157372_10312475
430 Ga0157375_10260155
431 Ga0157375_10612670
432 Ga0157375_10846278
433 Ga0157375_13161383
434 Ga0157375_13793506
435 Ga0157380_10638805
436 Ga0157380_12600069
437 Ga0182008_10127317
438 Ga0157377_10007538
439 Ga0157377_10334185
440 Ga0157379_10248121
441 Ga0157379_10673429
442 Ga0157376_10355300
443 Ga0207697_10124578
444 Ga0207682_10516975
445 Ga0207692_10417154
446 Ga0207680_10646709
447 Ga0207645_10266474
448 Ga0207643_10489312
449 Ga0207705_10871508
450 Ga0207695_10228753
451 Ga0207693_10033373
452 Ga0207646_10009943
453 Ga0207646_10061187
454 Ga0207646_10097700
455 Ga0207681_10203601
456 Ga0207700_10007401
457 Ga0207700_10335048
458 Ga0207664_10264730
459 Ga0207664_10645840
460 Ga0207644_10273689
461 Ga0207686_10578186
462 Ga0207709_11574324
463 Ga0207670_10101035
464 Ga0207669_10422199
465 Ga0207704_10893670
466 Ga0207704_11480575
467 Ga0207665_10172547
468 Ga0207665_10422403
469 Ga0207691_10419567
470 Ga0207689_10091287
471 Ga0207689_10409315
472 Ga0207661_10108248
473 Ga0207661_10769243
474 Ga0207679_10036244
475 Ga0207712_10061527
476 Ga0207658_10062985
477 Ga0207658_10320058
478 Ga0207703_11661804
479 Ga0207678_10421761
480 Ga0207708_10317393
481 Ga0207708_11028574
482 Ga0207702_10997215
483 Ga0207676_11297045
484 Ga0207674_10056903
485 Ga0207674_10331657
486 Ga0207675_100484352
487 Ga0207675_101073029
488 Ga0207683_10266244
489 Ga0209974_10117466
490 Ga0268266_10093537
491 Ga0268265_11084225
492 Ga0265319_1149792
493 Ga0265334_10138556
494 Ga0265338_10323182
495 Ga0265324_10033782
496 Ga0265332_10131835
497 Ga0265320_10004308
498 Ga0265329_10205857
499 Ga0265340_10005212
500 Ga0265331_10015029
501 Ga0316579_10236581
502 Ga0265314_10376981
503 Ga0265342_10003363
504 Ga0316577_10000667
505 Ga0316577_10090639
506 Ga0307416_102205752
507 Ga0373934_0020167
508 Ga0373954_0194147
509 Ga0373955_0802771
510 Ga0316574_0061203
511 Ga0316574_1011699
512 Ga0373933_0049273
513 Ga0316582_0261827
514 Ga0316582_0948826
515 Ga0316584_0283416
516 Ga0316584_0571520
517 Ga0436363_0638462
518 Ga0451798_0248216
519 Ga0451807_1877493
520 Ga0450907_093522
521 Ga0453683_0271282
522 Ga0453684_0092725
523 Ga0453684_0096298
524 Ga0453684_0928765
525 Ga0451576_0272787
526 Ga0495653_0065170
527 Ga0495580_0163912
528 Ga0495580_0267679
529 Ga0495594_0025764
530 Ga0495628_0027152
531 Ga0495652_0082322
532 Ga0495587_0015792
533 Ga0495598_0152913
534 Ga0495621_0010992
535 Ga0495645_0003370
536 Ga0495622_0409923
537 Ga0495667_0035021
538 Ga0495657_0320773
539 Ga0495599_0012290
540 Ga0495623_0007012
541 Ga0495600_0127732
542 Ga0495600_0135199
543 Ga0495672_0003461
544 Ga0495675_0017779
545 Ga0495684_0383531
546 Ga0496104_0053903
547 Ga0496106_0287864
548 Ga0496108_0362161
549 Ga0496108_1761296
550 Ga0496109_0046363
551 Ga0496110_0862001
552 Ga0501036_0727436
553 Ga0501038_0296589
554 Ga0501039_0493731
555 Ga0501040_0090318
556 Ga0501040_0235209
557 Ga0501041_0036156
558 Ga0501042_0029784
559 Ga0501042_1353932
560 Ga0501047_0519410
561 Ga0501071_0152284
562 Ga0501072_0067220
563 Ga0501073_0388422
564 Ga0501075_0015151
565 Ga0501076_0137425
566 Ga0501076_0653303
567 Ga0501077_0560705
568 Ga0501079_0101739
569 Ga0501079_0245969
570 Ga0501080_0316611
571 Ga0501081_0004019
572 Ga0501081_0477159
573 Ga0501081_0928807
574 Ga0501083_0485016
575 Ga0501035_0156760
576 Ga0501045_0053687
577 nmdc:mga0yw44_356906_c1
578 nmdc:mga05p37_1833427_c1
579 nmdc:mga05p37_19883_c1
580 nmdc:mga05p37_241223_c1
581 nmdc:mga05p37_78398_c1
582 nmdc:mga09592_341275_c1
583 nmdc:mga0rr50_39416_c1
584 nmdc:mga0rr50_726033_c1
585 nmdc:mga0rr50_996910_c1
586 nmdc:mga08x19_1049812_c1
587 nmdc:mga0a205_234030_c1
588 nmdc:mga0a205_328715_c1
589 Ga0495612_0492412
590 Ga0500628_023918
591 Ga0501084_0496399
592 Ga0501082_0113098
593 Ga0501082_0280127
594 Ga0530510_0104894

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02452

PemK_toxin

PemK-like, MazF-like toxin of type II toxin-antitoxin system

2

110

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hk3-assembly1.cif.gz_B crystal structure of m. tuberculosis mazf-mt3 t52d-f62d mutant in complex with dna 0.977 2 114
5hk0-assembly1.cif.gz_B crystal structure of m. tuberculosis mazf-mt3 (rv1991c) in complex with rna 0.9719 1 114
5hk3-assembly1.cif.gz_B crystal structure of m. tuberculosis mazf-mt3 t52d-f62d mutant in complex with dna 0.9677 2 114
5hk0-assembly2.cif.gz_D crystal structure of m. tuberculosis mazf-mt3 (rv1991c) in complex with rna 0.9673 5 114
5hk0-assembly1.cif.gz_B crystal structure of m. tuberculosis mazf-mt3 (rv1991c) in complex with rna 0.9631 1 114
ID Description Score Start End Superfamily
5hk0C00 Mainly Beta;Roll;SH3 type barrels.; 0.9539 2 114 2.30.30.110
af_P95272_7_108_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.9483 5 113 2.30.30.110
5hk0C00 Mainly Beta;Roll;SH3 type barrels.; 0.9453 2 114 2.30.30.110
4hkeA00 Mainly Beta;Roll;SH3 type barrels.; 0.9421 1 114 2.30.30.110
af_P71650_1_116_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.9374 3 114 2.30.30.110
ID Description Score Start End GO Terms
AF-A0A5Q4DDE4-F1-model_v4 Type II toxin-antitoxin system PemK/MazF family toxin 0.9952 26 114 GO:0003677
GO:0004521
GO:0006402
GO:0016075
AF-A0A8B5WTZ6-F1-model_v4 Type II toxin-antitoxin system PemK/MazF family toxin 0.9938 23 84 GO:0003677
AF-A0A7R8B7M8-F1-model_v4 deleted 0.9926 3 114
AF-A0A849ULZ0-F1-model_v4 mRNA interferase (EC 3.1.-.-) 0.9905 3 114 GO:0003677
GO:0004521
GO:0006402
GO:0016075
AF-A0A7R7AJ13-F1-model_v4 mRNA interferase (EC 3.1.-.-) 0.9891 3 114 GO:0003677
GO:0004521
GO:0006402
GO:0016075

Map