F393539

General Info

Members Datasets Scaffolds Average Seq Length
297 155 594 301

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100291878|Ga0070683_1002918782
Length 310
Sequence VRAALLHAPGDLRIEEVPRPDXXXXDVLVQVELALTDGTDLKTYRRGHPLLLTESPARFGHEFCGLVDGRRVVAANSAPCGVCDGCTRGEQCRALVFLAGAYAEWLVVPERIVAVNLHDVPRGVVPEVAAMVEPLACCLRGVERAGIAAGDSVAILGAGPIGLMLAASVADAGGWPVIVGGRPERRALVEEFGAEVGDGRGADIVIEAAGTEQAWSDAVELVRPGGTVVMFGGLPRDARPPVDAYRVHYEELTIRGSFHHTPRTVRAALVFLASGAYPWERLVTHRVGLDALPELLASPPDDLLKAAVVF

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
18 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
19 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
20 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
21 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
24 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
30 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
31 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
32 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
51 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
52 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
53 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
54 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
55 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
56 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
57 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
58 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
59 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
60 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
61 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
62 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
63 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
64 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
65 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
66 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
67 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
68 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
69 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
70 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
71 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
72 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
73 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
74 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
75 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
76 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
77 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
79 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
80 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
83 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
84 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
85 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
86 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
87 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
88 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
89 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
90 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
91 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
92 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
93 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
94 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
95 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
96 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
97 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
98 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
99 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
100 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
101 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
102 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
103 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
104 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
105 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
106 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
107 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
108 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
109 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
110 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
111 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
112 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
113 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
114 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
115 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
116 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
117 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
118 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
119 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
120 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
121 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
122 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
123 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
124 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
125 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
126 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
127 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
128 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
129 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
130 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
131 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
135 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
136 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
137 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
140 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
141 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
144 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
145 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
146 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
147 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
148 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
149 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
150 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
151 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
152 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
153 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
154 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
155 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.98
Metatranscriptomes 2.02
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.72
Rhizosphere 93.94
Stem 0
Stem Tuber 0
Unclassified 8.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100291878 3300005329 Bacteria 1551
2 Ga0070658_10112732 3300005327 Bacteria 2254
3 Ga0070683_100008637 3300005329 Bacteria 8657
4 Ga0070683_100029532 3300005329 Bacteria 4964
5 Ga0070683_100082340 3300005329 Bacteria 3013
6 Ga0070683_100103162 3300005329 Unclassified 2687
7 Ga0070680_100039243 3300005336 Bacteria 3832
8 Ga0070680_100044236 3300005336 Bacteria 3618
9 Ga0070680_100045052 3300005336 Bacteria 3585
10 Ga0070660_100001080 3300005339 Bacteria 18313
11 Ga0070660_100027330 3300005339 Bacteria 4257
12 Ga0070661_100010800 3300005344 Bacteria 6355
13 Ga0070661_100019790 3300005344 Bacteria 4797
14 Ga0070661_100030273 3300005344 Bacteria 3910
15 Ga0070714_100107763 3300005435 Bacteria 2463
16 Ga0070711_100046162 3300005439 Bacteria 2967
17 Ga0070708_100002634 3300005445 Bacteria 13890
18 Ga0070681_10007094 3300005458 Bacteria 10909
19 Ga0070681_10018092 3300005458 Bacteria 7045
20 Ga0070681_10025776 3300005458 Bacteria 5912
21 Ga0070681_10251127 3300005458 Bacteria 1681
22 Ga0070681_10299019 3300005458 Bacteria 1519
23 Ga0070698_100275356 3300005471 Bacteria 1614
24 Ga0070679_100015659 3300005530 Bacteria 7289
25 Ga0070679_100036596 3300005530 Bacteria 4871
26 Ga0070679_100086209 3300005530 Bacteria 3127
27 Ga0070679_100305065 3300005530 Bacteria 1542
28 Ga0070679_100334337 3300005530 Unclassified 1463
29 Ga0070679_100471516 3300005530 Bacteria 1199
30 Ga0070679_100524277 3300005530 Unclassified 1129
31 Ga0070684_100028124 3300005535 Bacteria 4752
32 Ga0070684_100072115 3300005535 Bacteria 3040
33 Ga0070684_100093253 3300005535 Bacteria 2680
34 Ga0068853_100108445 3300005539 Bacteria 2463
35 Ga0070665_100112856 3300005548 Bacteria 2720
36 Ga0068855_100033644 3300005563 Bacteria 6115
37 Ga0068855_100107910 3300005563 Bacteria 3198
38 Ga0068855_100140784 3300005563 Bacteria 2750
39 Ga0068855_100221148 3300005563 Bacteria 2123
40 Ga0068855_100292373 3300005563 Unclassified 1806
41 Ga0068855_100412966 3300005563 Bacteria 1477
42 Ga0068857_100088310 3300005577 Bacteria 2773
43 Ga0070717_10216775 3300006028 Bacteria 1681
44 Ga0070712_100036112 3300006175 Bacteria 3359
45 Ga0075433_10363056 3300006852 Bacteria 1279
46 Ga0075434_100066781 3300006871 Bacteria 3583
47 Ga0075435_100000425 3300007076 Bacteria 25950
48 Ga0105240_10037470 3300009093 Bacteria 6232
49 Ga0105240_10273908 3300009093 Bacteria 1942
50 Ga0105240_10439977 3300009093 Bacteria 1461
51 Ga0105242_10111898 3300009176 Bacteria 2329
52 Ga0105237_10051946 3300009545 Bacteria 4117
53 Ga0105237_10080283 3300009545 Bacteria 3252
54 Ga0105238_10086731 3300009551 Bacteria 3118
55 Ga0157370_10042503 3300013104 Bacteria 4379
56 Ga0157370_10149385 3300013104 Bacteria 2175
57 Ga0157370_10448099 3300013104 Bacteria 1187
58 Ga0157369_10001951 3300013105 Bacteria 24849
59 Ga0157369_10010343 3300013105 Bacteria 10640
60 Ga0157369_10073334 3300013105 Bacteria 3673
61 Ga0157369_10094456 3300013105 Bacteria 3192
62 Ga0157372_10030103 3300013307 Bacteria 5935
63 Ga0157372_10355773 3300013307 Bacteria 1706
64 Ga0157372_10737558 3300013307 Bacteria 1145
65 Ga0157375_10040191 3300013308 Bacteria 4507
66 Ga0206356_11105396 3300020070 Bacteria 2341
67 Ga0206354_11169935 3300020081 Bacteria 1922
68 Ga0206353_10112018 3300020082 Unclassified 3304
69 Ga0206353_10565566 3300020082 Bacteria 3150
70 Ga0206353_10582217 3300020082 Bacteria 3632
71 Ga0206353_11000182 3300020082 Bacteria 4795
72 Ga0207705_10071877 3300025909 Bacteria 2508
73 Ga0207695_10506890 3300025913 Unclassified 1089
74 Ga0207693_10011150 3300025915 Bacteria 7280
75 Ga0207693_10282277 3300025915 Bacteria 1301
76 Ga0207693_10295456 3300025915 Bacteria 1269
77 Ga0207660_10048748 3300025917 Bacteria 2999
78 Ga0207660_10122956 3300025917 Unclassified 1968
79 Ga0207657_10002727 3300025919 Bacteria 19014
80 Ga0207657_10006259 3300025919 Bacteria 12372
81 Ga0207657_10032127 3300025919 Bacteria 4746
82 Ga0207657_10045412 3300025919 Bacteria 3856
83 Ga0207649_10018966 3300025920 Bacteria 3925
84 Ga0207649_10019016 3300025920 Bacteria 3921
85 Ga0207649_10110018 3300025920 Bacteria 1839
86 Ga0207649_10178049 3300025920 Bacteria 1486
87 Ga0207652_10004047 3300025921 Bacteria 11964
88 Ga0207652_10176247 3300025921 Bacteria 1920
89 Ga0207652_10189365 3300025921 Bacteria 1850
90 Ga0207652_10197306 3300025921 Bacteria 1811
91 Ga0207700_10323074 3300025928 Bacteria 1338
92 Ga0207664_10197740 3300025929 Bacteria 1734
93 Ga0207690_10062334 3300025932 Bacteria 2538
94 Ga0207686_10115386 3300025934 Bacteria 1819
95 Ga0207661_10027563 3300025944 Bacteria 4340
96 Ga0207667_10073811 3300025949 Bacteria 3544
97 Ga0207667_10159974 3300025949 Bacteria 2317
98 Ga0207667_10163272 3300025949 Bacteria 2290
99 Ga0207667_10221625 3300025949 Bacteria 1938
100 Ga0207678_10041846 3300026067 Bacteria 3971
101 Ga0207702_10478238 3300026078 Bacteria 1212
102 Ga0207674_10008299 3300026116 Bacteria 12023
103 Ga0207674_10193242 3300026116 Bacteria 1985
104 Ga0207675_100216054 3300026118 Bacteria 1846
105 Ga0265322_10004382 3300028654 Unclassified 4206
106 Ga0265338_10015461 3300028800 Bacteria 8379
107 Ga0265338_10018868 3300028800 Bacteria 7355
108 Ga0265338_10044861 3300028800 Bacteria 4073
109 Ga0265330_10059156 3300031235 Unclassified 1669
110 Ga0265332_10037037 3300031238 Bacteria 2117
111 Ga0265328_10029150 3300031239 Bacteria 2063
112 Ga0265325_10016211 3300031241 Bacteria 4168
113 Ga0265329_10009636 3300031242 Unclassified 3589
114 Ga0265339_10004242 3300031249 Bacteria 9819
115 Ga0265331_10062171 3300031250 Unclassified 1762
116 Ga0265327_10028257 3300031251 Bacteria 3212
117 Ga0265316_10012066 3300031344 Bacteria 7764
118 Ga0265316_10075457 3300031344 Bacteria 2592
119 Ga0307408_100242809 3300031548 Unclassified 1481
120 Ga0307408_100441160 3300031548 Bacteria 1127
121 Ga0265313_10052749 3300031595 Bacteria 1939
122 Ga0265314_10013167 3300031711 Bacteria 6699
123 Ga0265314_10020249 3300031711 Bacteria 5137
124 Ga0265314_10088648 3300031711 Bacteria 2020
125 Ga0307405_10039588 3300031731 Bacteria 2850
126 Ga0307410_10010777 3300031852 Bacteria 5199
127 Ga0307406_10120936 3300031901 Bacteria 1820
128 Ga0307406_10315749 3300031901 Bacteria 1207
129 Ga0307409_100024091 3300031995 Bacteria 4236
130 Ga0373944_0063699 3300035089 Unclassified 1187
131 Ga0373936_0025669 3300035113 Bacteria 2305
132 Ga0373943_0013786 3300035170 Bacteria 3654
133 Ga0373943_0132219 3300035170 Bacteria 1336
134 Ga0373946_0000906 3300035171 Bacteria 10185
135 Ga0373955_0025605 3300035172 Bacteria 3032
136 Ga0373927_0025370 3300035695 Bacteria 3875
137 Ga0373933_0017788 3300035724 Bacteria 3989
138 Ga0373947_0000222 3300035725 Bacteria 31904
139 Ga0373937_0066755 3300036401 Bacteria 3313
140 Ga0373937_0166386 3300036401 Bacteria 2068
141 Ga0373925_0008681 3300037068 Bacteria 7402
142 Ga0395900_0054137 3300037418 Bacteria 4131
143 Ga0395900_0101022 3300037418 Bacteria 2962
144 Ga0395900_0250889 3300037418 Bacteria 1771
145 Ga0395900_0546817 3300037418 Unclassified 1103
146 Ga0395898_0008439 3300037466 Bacteria 10889
147 Ga0395898_0056223 3300037466 Bacteria 3836
148 Ga0395898_0131525 3300037466 Bacteria 2397
149 Ga0395898_0144880 3300037466 Bacteria 2274
150 Ga0395905_0082475 3300037471 Unclassified 3013
151 Ga0395905_0162525 3300037471 Bacteria 2098
152 Ga0395905_0453082 3300037471 Bacteria 1181
153 Ga0395901_0002091 3300038443 Bacteria 20489
154 Ga0395901_0003265 3300038443 Bacteria 16325
155 Ga0395901_0030730 3300038443 Bacteria 5534
156 Ga0395901_0059746 3300038443 Bacteria 3966
157 Ga0395901_0070641 3300038443 Bacteria 3638
158 Ga0436363_1299046 3300039450 Bacteria 1327
159 Ga0439439_0008870 3300041406 Bacteria 2380
160 Ga0439446_0000344 3300042156 Bacteria 8921
161 Ga0439446_0000667 3300042156 Bacteria 7132
162 Ga0466966_0093867 3300044684 Bacteria 1860
163 Ga0466961_0062295 3300044693 Bacteria 2370
164 Ga0466963_0003776 3300044694 Bacteria 8726
165 Ga0466963_0003969 3300044694 Bacteria 8558
166 Ga0466963_0011306 3300044694 Bacteria 5431
167 Ga0466963_0060170 3300044694 Bacteria 2536
168 Ga0466963_0101141 3300044694 Bacteria 1973
169 Ga0466963_0173629 3300044694 Bacteria 1503
170 Ga0466971_0014092 3300044719 Bacteria 3514
171 Ga0466971_0027018 3300044719 Bacteria 2569
172 Ga0466968_0003877 3300044735 Bacteria 5553
173 Ga0466957_0045692 3300044842 Bacteria 2656
174 Ga0466957_0108227 3300044842 Unclassified 1760
175 Ga0466957_0113425 3300044842 Bacteria 1721
176 Ga0466957_0287599 3300044842 Bacteria 1102
177 Ga0466959_0031824 3300045049 Bacteria 3904
178 Ga0466959_0050014 3300045049 Bacteria 3070
179 Ga0466958_0002224 3300045836 Bacteria 9665
180 Ga0466958_0016171 3300045836 Bacteria 4292
181 Ga0466967_0000359 3300045976 Bacteria 21145
182 Ga0466967_0004655 3300045976 Bacteria 9309
183 Ga0466967_0008214 3300045976 Bacteria 7624
184 Ga0466967_0031940 3300045976 Bacteria 4440
185 Ga0466967_0035917 3300045976 Bacteria 4224
186 Ga0466967_0085188 3300045976 Bacteria 2861
187 Ga0466967_0114885 3300045976 Bacteria 2478
188 Ga0466967_0163871 3300045976 Bacteria 2088
189 Ga0466967_0251748 3300045976 Bacteria 1687
190 Ga0466967_0257668 3300045976 Bacteria 1668
191 Ga0495629_0000214 3300046459 Bacteria 52123
192 Ga0495629_0079051 3300046459 Bacteria 2296
193 Ga0495641_0000795 3300046461 Bacteria 26778
194 Ga0495651_0053547 3300046462 Bacteria 3106
195 Ga0495651_0066951 3300046462 Bacteria 2740
196 Ga0495653_0032443 3300046463 Bacteria 4146
197 Ga0495653_0050725 3300046463 Bacteria 3190
198 Ga0495582_0000389 3300046473 Bacteria 23879
199 Ga0495639_0001167 3300046475 Bacteria 11875
200 Ga0495662_0002550 3300046476 Bacteria 9194
201 Ga0495594_0060998 3300046499 Bacteria 2087
202 Ga0495618_0027598 3300046514 Bacteria 3534
203 Ga0495618_0083297 3300046514 Unclassified 2043
204 Ga0495628_0050538 3300046516 Bacteria 3288
205 Ga0495628_0166321 3300046516 Bacteria 1674
206 Ga0495628_0175698 3300046516 Bacteria 1622
207 Ga0495630_0008684 3300046517 Bacteria 7294
208 Ga0495630_0115902 3300046517 Bacteria 2030
209 Ga0495630_0266828 3300046517 Bacteria 1308
210 Ga0495652_0013287 3300046529 Bacteria 7409
211 Ga0495652_0057176 3300046529 Bacteria 3309
212 Ga0495652_0115201 3300046529 Bacteria 2154
213 Ga0495652_0125981 3300046529 Bacteria 2035
214 Ga0495652_0288004 3300046529 Bacteria 1200
215 Ga0495665_0019629 3300046531 Bacteria 3635
216 Ga0495640_0003268 3300046533 Bacteria 13036
217 Ga0495640_0018047 3300046533 Bacteria 5245
218 Ga0495640_0021739 3300046533 Bacteria 4701
219 Ga0495586_0163717 3300046535 Bacteria 1255
220 Ga0495587_0009850 3300046536 Bacteria 6103
221 Ga0495587_0070220 3300046536 Bacteria 2039
222 Ga0495645_0157476 3300046543 Bacteria 1573
223 Ga0495667_0006421 3300046559 Bacteria 7977
224 Ga0495667_0010738 3300046559 Bacteria 6193
225 Ga0495667_0016259 3300046559 Bacteria 5025
226 Ga0495667_0024713 3300046559 Bacteria 4046
227 Ga0495634_0005573 3300046642 Bacteria 9657
228 Ga0495634_0025186 3300046642 Bacteria 4169
229 Ga0495634_0084423 3300046642 Bacteria 2070
230 Ga0495635_0038419 3300046663 Bacteria 3315
231 Ga0495635_0045779 3300046663 Bacteria 3018
232 Ga0495657_0084771 3300046675 Bacteria 2043
233 Ga0495657_0094021 3300046675 Bacteria 1918
234 Ga0495646_0057895 3300046680 Bacteria 2318
235 Ga0495646_0110058 3300046680 Bacteria 1569
236 Ga0495646_0119699 3300046680 Unclassified 1491
237 Ga0495647_0028496 3300046681 Bacteria 2059
238 Ga0495658_0161650 3300046683 Bacteria 1381
239 Ga0495613_0007232 3300046689 Bacteria 8265
240 Ga0495600_0045369 3300046809 Bacteria 2867
241 Ga0495581_0000807 3300047315 Bacteria 16642
242 Ga0495604_0162931 3300047317 Bacteria 1574
243 Ga0495674_0045700 3300047319 Bacteria 3888
244 Ga0495674_0303620 3300047319 Bacteria 1303
245 Ga0495676_0018417 3300047321 Bacteria 6155
246 Ga0495680_0000502 3300047322 Bacteria 44236
247 Ga0495680_0000519 3300047322 Bacteria 43595
248 Ga0495680_0016103 3300047322 Bacteria 6428
249 Ga0495680_0314812 3300047322 Bacteria 1096
250 Ga0495675_0019077 3300047444 Bacteria 4356
251 Ga0495684_0013493 3300047471 Bacteria 6286
252 Ga0495684_0020487 3300047471 Bacteria 5097
253 Ga0495684_0049722 3300047471 Bacteria 3203
254 Ga0495684_0049948 3300047471 Bacteria 3195
255 Ga0495684_0402881 3300047471 Bacteria 960
256 Ga0495593_0004403 3300047673 Bacteria 8371
257 Ga0495602_0186560 3300048088 Bacteria 1594
258 Ga0495614_0006119 3300048089 Bacteria 5411
259 Ga0496100_0103944 3300048903 Bacteria 1962
260 Ga0496101_0017717 3300048904 Bacteria 4831
261 Ga0496101_0034262 3300048904 Unclassified 3585
262 Ga0496102_0086679 3300048905 Bacteria 2892
263 Ga0496102_0294742 3300048905 Bacteria 1529
264 Ga0496104_0092287 3300048907 Bacteria 2895
265 Ga0496105_0129580 3300048908 Bacteria 2080
266 Ga0496106_0092014 3300048909 Unclassified 2342
267 Ga0496108_0290874 3300048911 Unclassified 1422
268 Ga0496110_0164622 3300048913 Bacteria 2011
269 Ga0496112_0002538 3300048915 Bacteria 14735
270 Ga0496112_0018429 3300048915 Bacteria 6573
271 Ga0496112_0039750 3300048915 Bacteria 4598
272 Ga0496114_0029056 3300048917 Bacteria 4541
273 Ga0496114_0052066 3300048917 Bacteria 3410
274 Ga0496114_0092448 3300048917 Bacteria 2570
275 Ga0496115_0135431 3300048918 Bacteria 2031
276 Ga0501041_0117009 3300049577 Bacteria 1656
277 Ga0501047_0170730 3300049581 Bacteria 2044
278 Ga0501067_0000359 3300049583 Bacteria 24901
279 Ga0501068_0085771 3300049584 Unclassified 1938
280 Ga0501069_0003905 3300049585 Bacteria 7687
281 Ga0501069_0053858 3300049585 Bacteria 2241
282 Ga0501070_0001015 3300049586 Bacteria 25203
283 Ga0501070_0086260 3300049586 Bacteria 2599
284 Ga0501076_0396490 3300049592 Bacteria 1135
285 Ga0501080_0189194 3300049742 Bacteria 1892
286 Ga0501044_0252763 3300049823 Bacteria 1703
287 nmdc:mga0n895_82560_c1 3300050512 Bacteria 3204
288 nmdc:mga0rr50_32449_c1 3300050513 Bacteria 3721
289 Ga0495601_0010209 3300053077 Bacteria 5583
290 Ga0495601_0213520 3300053077 Bacteria 1260
291 Ga0495601_0278540 3300053077 Unclassified 1091
292 Ga0495595_0003825 3300053084 Bacteria 5994
293 Ga0495619_0002099 3300053085 Bacteria 13226
294 Ga0495619_0007271 3300053085 Bacteria 7012
295 Ga0495619_0033259 3300053085 Bacteria 3349
296 Ga0466962_0000486 3300061719 Bacteria 17214
297 Ga0466962_0193714 3300061719 Unclassified 992
298 Ga0070683_100291878
299 Ga0070658_10112732
300 Ga0070683_100008637
301 Ga0070683_100029532
302 Ga0070683_100082340
303 Ga0070683_100103162
304 Ga0070680_100039243
305 Ga0070680_100044236
306 Ga0070680_100045052
307 Ga0070660_100001080
308 Ga0070660_100027330
309 Ga0070661_100010800
310 Ga0070661_100019790
311 Ga0070661_100030273
312 Ga0070714_100107763
313 Ga0070711_100046162
314 Ga0070708_100002634
315 Ga0070681_10007094
316 Ga0070681_10018092
317 Ga0070681_10025776
318 Ga0070681_10251127
319 Ga0070681_10299019
320 Ga0070698_100275356
321 Ga0070679_100015659
322 Ga0070679_100036596
323 Ga0070679_100086209
324 Ga0070679_100305065
325 Ga0070679_100334337
326 Ga0070679_100471516
327 Ga0070679_100524277
328 Ga0070684_100028124
329 Ga0070684_100072115
330 Ga0070684_100093253
331 Ga0068853_100108445
332 Ga0070665_100112856
333 Ga0068855_100033644
334 Ga0068855_100107910
335 Ga0068855_100140784
336 Ga0068855_100221148
337 Ga0068855_100292373
338 Ga0068855_100412966
339 Ga0068857_100088310
340 Ga0070717_10216775
341 Ga0070712_100036112
342 Ga0075433_10363056
343 Ga0075434_100066781
344 Ga0075435_100000425
345 Ga0105240_10037470
346 Ga0105240_10273908
347 Ga0105240_10439977
348 Ga0105242_10111898
349 Ga0105237_10051946
350 Ga0105237_10080283
351 Ga0105238_10086731
352 Ga0157370_10042503
353 Ga0157370_10149385
354 Ga0157370_10448099
355 Ga0157369_10001951
356 Ga0157369_10010343
357 Ga0157369_10073334
358 Ga0157369_10094456
359 Ga0157372_10030103
360 Ga0157372_10355773
361 Ga0157372_10737558
362 Ga0157375_10040191
363 Ga0206356_11105396
364 Ga0206354_11169935
365 Ga0206353_10112018
366 Ga0206353_10565566
367 Ga0206353_10582217
368 Ga0206353_11000182
369 Ga0207705_10071877
370 Ga0207695_10506890
371 Ga0207693_10011150
372 Ga0207693_10282277
373 Ga0207693_10295456
374 Ga0207660_10048748
375 Ga0207660_10122956
376 Ga0207657_10002727
377 Ga0207657_10006259
378 Ga0207657_10032127
379 Ga0207657_10045412
380 Ga0207649_10018966
381 Ga0207649_10019016
382 Ga0207649_10110018
383 Ga0207649_10178049
384 Ga0207652_10004047
385 Ga0207652_10176247
386 Ga0207652_10189365
387 Ga0207652_10197306
388 Ga0207700_10323074
389 Ga0207664_10197740
390 Ga0207690_10062334
391 Ga0207686_10115386
392 Ga0207661_10027563
393 Ga0207667_10073811
394 Ga0207667_10159974
395 Ga0207667_10163272
396 Ga0207667_10221625
397 Ga0207678_10041846
398 Ga0207702_10478238
399 Ga0207674_10008299
400 Ga0207674_10193242
401 Ga0207675_100216054
402 Ga0265322_10004382
403 Ga0265338_10015461
404 Ga0265338_10018868
405 Ga0265338_10044861
406 Ga0265330_10059156
407 Ga0265332_10037037
408 Ga0265328_10029150
409 Ga0265325_10016211
410 Ga0265329_10009636
411 Ga0265339_10004242
412 Ga0265331_10062171
413 Ga0265327_10028257
414 Ga0265316_10012066
415 Ga0265316_10075457
416 Ga0307408_100242809
417 Ga0307408_100441160
418 Ga0265313_10052749
419 Ga0265314_10013167
420 Ga0265314_10020249
421 Ga0265314_10088648
422 Ga0307405_10039588
423 Ga0307410_10010777
424 Ga0307406_10120936
425 Ga0307406_10315749
426 Ga0307409_100024091
427 Ga0373944_0063699
428 Ga0373936_0025669
429 Ga0373943_0013786
430 Ga0373943_0132219
431 Ga0373946_0000906
432 Ga0373955_0025605
433 Ga0373927_0025370
434 Ga0373933_0017788
435 Ga0373947_0000222
436 Ga0373937_0066755
437 Ga0373937_0166386
438 Ga0373925_0008681
439 Ga0395900_0054137
440 Ga0395900_0101022
441 Ga0395900_0250889
442 Ga0395900_0546817
443 Ga0395898_0008439
444 Ga0395898_0056223
445 Ga0395898_0131525
446 Ga0395898_0144880
447 Ga0395905_0082475
448 Ga0395905_0162525
449 Ga0395905_0453082
450 Ga0395901_0002091
451 Ga0395901_0003265
452 Ga0395901_0030730
453 Ga0395901_0059746
454 Ga0395901_0070641
455 Ga0436363_1299046
456 Ga0439439_0008870
457 Ga0439446_0000344
458 Ga0439446_0000667
459 Ga0466966_0093867
460 Ga0466961_0062295
461 Ga0466963_0003776
462 Ga0466963_0003969
463 Ga0466963_0011306
464 Ga0466963_0060170
465 Ga0466963_0101141
466 Ga0466963_0173629
467 Ga0466971_0014092
468 Ga0466971_0027018
469 Ga0466968_0003877
470 Ga0466957_0045692
471 Ga0466957_0108227
472 Ga0466957_0113425
473 Ga0466957_0287599
474 Ga0466959_0031824
475 Ga0466959_0050014
476 Ga0466958_0002224
477 Ga0466958_0016171
478 Ga0466967_0000359
479 Ga0466967_0004655
480 Ga0466967_0008214
481 Ga0466967_0031940
482 Ga0466967_0035917
483 Ga0466967_0085188
484 Ga0466967_0114885
485 Ga0466967_0163871
486 Ga0466967_0251748
487 Ga0466967_0257668
488 Ga0495629_0000214
489 Ga0495629_0079051
490 Ga0495641_0000795
491 Ga0495651_0053547
492 Ga0495651_0066951
493 Ga0495653_0032443
494 Ga0495653_0050725
495 Ga0495582_0000389
496 Ga0495639_0001167
497 Ga0495662_0002550
498 Ga0495594_0060998
499 Ga0495618_0027598
500 Ga0495618_0083297
501 Ga0495628_0050538
502 Ga0495628_0166321
503 Ga0495628_0175698
504 Ga0495630_0008684
505 Ga0495630_0115902
506 Ga0495630_0266828
507 Ga0495652_0013287
508 Ga0495652_0057176
509 Ga0495652_0115201
510 Ga0495652_0125981
511 Ga0495652_0288004
512 Ga0495665_0019629
513 Ga0495640_0003268
514 Ga0495640_0018047
515 Ga0495640_0021739
516 Ga0495586_0163717
517 Ga0495587_0009850
518 Ga0495587_0070220
519 Ga0495645_0157476
520 Ga0495667_0006421
521 Ga0495667_0010738
522 Ga0495667_0016259
523 Ga0495667_0024713
524 Ga0495634_0005573
525 Ga0495634_0025186
526 Ga0495634_0084423
527 Ga0495635_0038419
528 Ga0495635_0045779
529 Ga0495657_0084771
530 Ga0495657_0094021
531 Ga0495646_0057895
532 Ga0495646_0110058
533 Ga0495646_0119699
534 Ga0495647_0028496
535 Ga0495658_0161650
536 Ga0495613_0007232
537 Ga0495600_0045369
538 Ga0495581_0000807
539 Ga0495604_0162931
540 Ga0495674_0045700
541 Ga0495674_0303620
542 Ga0495676_0018417
543 Ga0495680_0000502
544 Ga0495680_0000519
545 Ga0495680_0016103
546 Ga0495680_0314812
547 Ga0495675_0019077
548 Ga0495684_0013493
549 Ga0495684_0020487
550 Ga0495684_0049722
551 Ga0495684_0049948
552 Ga0495684_0402881
553 Ga0495593_0004403
554 Ga0495602_0186560
555 Ga0495614_0006119
556 Ga0496100_0103944
557 Ga0496101_0017717
558 Ga0496101_0034262
559 Ga0496102_0086679
560 Ga0496102_0294742
561 Ga0496104_0092287
562 Ga0496105_0129580
563 Ga0496106_0092014
564 Ga0496108_0290874
565 Ga0496110_0164622
566 Ga0496112_0002538
567 Ga0496112_0018429
568 Ga0496112_0039750
569 Ga0496114_0029056
570 Ga0496114_0052066
571 Ga0496114_0092448
572 Ga0496115_0135431
573 Ga0501041_0117009
574 Ga0501047_0170730
575 Ga0501067_0000359
576 Ga0501068_0085771
577 Ga0501069_0003905
578 Ga0501069_0053858
579 Ga0501070_0001015
580 Ga0501070_0086260
581 Ga0501076_0396490
582 Ga0501080_0189194
583 Ga0501044_0252763
584 nmdc:mga0n895_82560_c1
585 nmdc:mga0rr50_32449_c1
586 Ga0495601_0010209
587 Ga0495601_0213520
588 Ga0495601_0278540
589 Ga0495595_0003825
590 Ga0495619_0002099
591 Ga0495619_0007271
592 Ga0495619_0033259
593 Ga0466962_0000486
594 Ga0466962_0193714

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

195

274

0.91

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

23

121

0.84

PF16912

Glu_dehyd_C

Glucose dehydrogenase C-terminus

126

310

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ejm-assembly1.cif.gz_A crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021 bound to nadp 0.8498 2 296
3fpc-assembly1.cif.gz_C chimera of alcohol dehydrogenase by exchange of the cofactor binding domain res 153-294 of t. brockii adh by e. histolytica adh 0.8479 1 295
4ejm-assembly1.cif.gz_A crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021 bound to nadp 0.8445 2 296
6sch-assembly1.cif.gz_D nadh-dependent variant of cbadh 0.8443 1 295
3fpc-assembly1.cif.gz_C chimera of alcohol dehydrogenase by exchange of the cofactor binding domain res 153-294 of t. brockii adh by e. histolytica adh 0.8427 1 295
ID Description Score Start End Superfamily
af_Q2FVP8_1_145_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9296 137 165 3.50.50.60
4ejmA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9281 124 243 3.40.50.720
af_B4G1G0_229_356_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.914 131 239 3.40.50.720
1lluA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8917 120 243 3.40.50.720
af_Q54JZ8_16_204_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8896 137 165 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A7W0S687-F1-model_v4 Zinc-binding dehydrogenase 0.9606 42 296 GO:0016491
AF-A0A7W0S687-F1-model_v4 Zinc-binding dehydrogenase 0.939 42 296 GO:0016491
AF-A0A538JGS2-F1-model_v4 Zinc-binding dehydrogenase 0.9373 1 296 GO:0016491
AF-A0A497K1F4-F1-model_v4 Threonine dehydrogenase 0.9353 107 296 GO:0016491
AF-A0A538JGS2-F1-model_v4 Zinc-binding dehydrogenase 0.9342 1 296 GO:0016491

Map