F393521

General Info

Members Datasets Scaffolds Average Seq Length
297 182 594 206

Family's Representative Sequence

Representative Sequence 3300003752|Ga0055539_1011580|Ga0055539_10115801
Length 206
Sequence MLQLNLGDLDQYSDVVHTRRGETVTLRFIMPDDAEALQAYVRRLSSRSRYNRFLGAMSELPKRVLEDFTHAGRDDRFSLMATMHDDAEAIVGEARYAFHPENDSVEFGLSVQDRWQGHGIGPALMQNLECRAAALGAVSMFGDTLRSNDVMITLAKKSGYLFRQHPDDWKLVRFEKPIAQAGAGIPCASLRLVATSRRADEAAAAN

Samples

Sample ID Description Type Environment
1 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
41 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
42 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
45 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
67 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
68 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
69 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
70 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
71 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
72 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
73 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
74 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
75 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
76 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
77 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
78 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
79 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
80 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
81 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
82 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
83 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
84 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
85 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
86 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
87 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
88 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
89 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
90 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
91 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
92 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
93 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
94 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
95 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
96 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
102 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
103 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
104 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
105 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
106 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
107 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
108 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
109 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
110 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
113 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
114 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
115 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
116 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
117 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
118 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
119 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
120 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
121 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
122 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
123 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
124 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
125 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
126 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
127 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
128 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
129 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
130 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
131 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
132 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
133 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
134 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
135 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
136 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
137 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
138 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
139 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
140 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
141 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
142 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
143 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
144 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
145 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
146 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
147 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
148 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
149 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
150 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
151 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
162 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
163 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
164 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
165 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
166 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
169 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
170 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
171 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
172 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
173 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
174 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
175 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
176 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
177 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
178 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
179 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
180 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
181 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
182 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0
Isolates 0.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.69
Nodule 0
Rhizoplane 5.05
Rhizosphere 83.84
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055539_1011580 3300003752 Bacteria 1086
2 rootL2_10109589 3300003322 Bacteria 1854
3 Ga0055539_1010463 3300003752 Bacteria 1149
4 Ga0070683_100013800 3300005329 Bacteria 7053
5 Ga0070683_100352107 3300005329 Bacteria 1402
6 Ga0070690_100501132 3300005330 Bacteria 908
7 Ga0070680_100114303 3300005336 Bacteria 2249
8 Ga0070680_100190537 3300005336 Bacteria 1728
9 Ga0070682_100031810 3300005337 Bacteria 3194
10 Ga0070661_100317216 3300005344 Bacteria 1217
11 Ga0070709_10006849 3300005434 Bacteria 6225
12 Ga0070709_10087142 3300005434 Bacteria 2051
13 Ga0070714_100242221 3300005435 Bacteria 1665
14 Ga0070713_100038767 3300005436 Bacteria 3863
15 Ga0070713_100045873 3300005436 Bacteria 3584
16 Ga0070713_100215821 3300005436 Bacteria 1739
17 Ga0070710_10001636 3300005437 Bacteria 10592
18 Ga0070711_100009849 3300005439 Bacteria 5895
19 Ga0070711_100503123 3300005439 Bacteria 999
20 Ga0070663_100081941 3300005455 Bacteria 2373
21 Ga0070681_10008570 3300005458 Bacteria 10018
22 Ga0070681_10042018 3300005458 Bacteria 4583
23 Ga0070681_10462101 3300005458 Bacteria 1182
24 Ga0070681_10582957 3300005458 Bacteria 1032
25 Ga0070681_10632981 3300005458 Bacteria 984
26 Ga0070679_100009080 3300005530 Bacteria 9380
27 Ga0070679_100121787 3300005530 Bacteria 2593
28 Ga0070679_100270731 3300005530 Bacteria 1652
29 Ga0070684_100018082 3300005535 Bacteria 5797
30 Ga0070684_100093185 3300005535 Bacteria 2681
31 Ga0070684_100546620 3300005535 Bacteria 1075
32 Ga0070696_100495522 3300005546 Bacteria 971
33 Ga0070693_100139353 3300005547 Bacteria 1525
34 Ga0068855_100087579 3300005563 Bacteria 3598
35 Ga0068855_100105229 3300005563 Bacteria 3244
36 Ga0068855_100410317 3300005563 Bacteria 1483
37 Ga0068855_100461005 3300005563 Bacteria 1386
38 Ga0070664_100421686 3300005564 Bacteria 1222
39 Ga0068857_100607725 3300005577 Bacteria 1034
40 Ga0068857_101065386 3300005577 Bacteria 780
41 Ga0068854_100045344 3300005578 Bacteria 3126
42 Ga0068856_100462756 3300005614 Bacteria 1289
43 Ga0068856_100621647 3300005614 Bacteria 1101
44 Ga0068856_100897594 3300005614 Bacteria 905
45 Ga0068852_100152150 3300005616 Bacteria 2152
46 Ga0068852_100542226 3300005616 Bacteria 1163
47 Ga0068859_100422632 3300005617 Bacteria 1429
48 Ga0068858_100616454 3300005842 Bacteria 1053
49 Ga0070717_10000445 3300006028 Bacteria 26264
50 Ga0070716_100049503 3300006173 Bacteria 2381
51 Ga0070716_100082888 3300006173 Bacteria 1919
52 Ga0070712_100145963 3300006175 Bacteria 1811
53 Ga0097620_100422659 3300006931 Bacteria 1429
54 Ga0105240_10142537 3300009093 Bacteria 2864
55 Ga0105240_10256599 3300009093 Bacteria 2019
56 Ga0105240_10434709 3300009093 Bacteria 1472
57 Ga0105247_10320284 3300009101 Bacteria 1081
58 Ga0105237_10658755 3300009545 Bacteria 1054
59 Ga0105237_10922053 3300009545 Bacteria 880
60 Ga0105238_10051770 3300009551 Bacteria 4129
61 Ga0105238_10057860 3300009551 Bacteria 3886
62 Ga0105238_10065950 3300009551 Bacteria 3621
63 Ga0105238_10534577 3300009551 Bacteria 1176
64 Ga0105239_10126367 3300010375 Bacteria 2842
65 Ga0105239_10990135 3300010375 Bacteria 966
66 Ga0157369_10209646 3300013105 Bacteria 2043
67 Ga0157369_10240071 3300013105 Bacteria 1893
68 Ga0157369_10762539 3300013105 Bacteria 995
69 Ga0157369_10883625 3300013105 Bacteria 917
70 Ga0157374_10322022 3300013296 Bacteria 1532
71 Ga0157372_10145006 3300013307 Bacteria 2738
72 Ga0157372_10669961 3300013307 Bacteria 1208
73 Ga0163163_10161794 3300014325 Bacteria 2284
74 Ga0157379_10069691 3300014968 Bacteria 3145
75 Ga0213876_10152855 3300021384 Bacteria 1227
76 Ga0213876_10257995 3300021384 Bacteria 926
77 Ga0209677_102544 3300025253 Bacteria 6739
78 Ga0209148_1008525 3300025254 Bacteria 2054
79 Ga0209233_1014728 3300025261 Bacteria 2195
80 Ga0209455_1004130 3300025272 Bacteria 4869
81 Ga0207692_10034140 3300025898 Bacteria 2461
82 Ga0207699_10023700 3300025906 Bacteria 3343
83 Ga0207699_10055007 3300025906 Bacteria 2366
84 Ga0207707_10000143 3300025912 Bacteria 74226
85 Ga0207707_10058755 3300025912 Bacteria 3346
86 Ga0207707_10110079 3300025912 Bacteria 2407
87 Ga0207695_10101197 3300025913 Bacteria 2876
88 Ga0207695_10297216 3300025913 Bacteria 1506
89 Ga0207695_10430710 3300025913 Bacteria 1203
90 Ga0207671_10611664 3300025914 Bacteria 868
91 Ga0207693_10021338 3300025915 Bacteria 5148
92 Ga0207663_10011205 3300025916 Bacteria 4806
93 Ga0207663_10256250 3300025916 Bacteria 1290
94 Ga0207660_10053522 3300025917 Bacteria 2877
95 Ga0207652_10008815 3300025921 Bacteria 8122
96 Ga0207652_10077431 3300025921 Bacteria 2902
97 Ga0207694_10149259 3300025924 Bacteria 1883
98 Ga0207694_10154768 3300025924 Bacteria 1848
99 Ga0207687_10561826 3300025927 Bacteria 958
100 Ga0207700_10165544 3300025928 Bacteria 1840
101 Ga0207700_10295518 3300025928 Bacteria 1397
102 Ga0207665_10062389 3300025939 Bacteria 2529
103 Ga0207661_10005550 3300025944 Bacteria 8897
104 Ga0207661_10050977 3300025944 Bacteria 3300
105 Ga0207679_10935800 3300025945 Bacteria 793
106 Ga0207667_10145688 3300025949 Bacteria 2438
107 Ga0207667_10360217 3300025949 Bacteria 1483
108 Ga0207667_10376161 3300025949 Bacteria 1447
109 Ga0207703_10238638 3300026035 Bacteria 1633
110 Ga0207678_10435724 3300026067 Bacteria 1138
111 Ga0207702_10452682 3300026078 Bacteria 1246
112 Ga0207674_10099170 3300026116 Bacteria 2896
113 Ga0207674_10406872 3300026116 Bacteria 1315
114 Ga0265326_10008158 3300028558 Bacteria 3170
115 Ga0265319_1004675 3300028563 Bacteria 6715
116 Ga0265334_10004652 3300028573 Bacteria 6058
117 Ga0265318_10127372 3300028577 Bacteria 936
118 Ga0265323_10023330 3300028653 Bacteria 2359
119 Ga0265336_10005667 3300028666 Bacteria 4581
120 Ga0265338_10001172 3300028800 Bacteria 43270
121 Ga0265324_10011263 3300029957 Bacteria 3414
122 Ga0265330_10010663 3300031235 Bacteria 4325
123 Ga0265330_10041225 3300031235 Bacteria 2048
124 Ga0265330_10050469 3300031235 Bacteria 1825
125 Ga0265332_10120970 3300031238 Bacteria 1099
126 Ga0265328_10137477 3300031239 Bacteria 916
127 Ga0265325_10031143 3300031241 Bacteria 2857
128 Ga0265340_10021829 3300031247 Bacteria 3278
129 Ga0265340_10252587 3300031247 Bacteria 786
130 Ga0265339_10006769 3300031249 Bacteria 7478
131 Ga0265339_10126842 3300031249 Bacteria 1308
132 Ga0265316_10257257 3300031344 Bacteria 1281
133 Ga0307508_10002880 3300031616 Bacteria 17788
134 Ga0265314_10124612 3300031711 Bacteria 1616
135 Ga0373934_0023318 3300035086 Bacteria 2391
136 Ga0373934_0041961 3300035086 Bacteria 1807
137 Ga0373934_0064956 3300035086 Bacteria 1457
138 Ga0373923_0002139 3300035111 Bacteria 5985
139 Ga0373953_0006329 3300035117 Bacteria 3896
140 Ga0373953_0033657 3300035117 Bacteria 2005
141 Ga0373954_0002404 3300035118 Bacteria 7843
142 Ga0373954_0012051 3300035118 Bacteria 3841
143 Ga0373956_0137173 3300035119 Bacteria 1147
144 Ga0373946_0008031 3300035171 Bacteria 3875
145 Ga0373955_0001440 3300035172 Bacteria 10116
146 Ga0373955_0004176 3300035172 Bacteria 6374
147 Ga0373955_0014696 3300035172 Bacteria 3815
148 Ga0373924_0001113 3300035410 Bacteria 8610
149 Ga0373924_0004613 3300035410 Bacteria 4826
150 Ga0373924_0087888 3300035410 Bacteria 1327
151 Ga0373931_0068818 3300035691 Bacteria 1928
152 Ga0373935_0083009 3300035692 Bacteria 2085
153 Ga0373935_0403286 3300035692 Bacteria 982
154 Ga0373927_0008562 3300035695 Bacteria 6875
155 Ga0373933_0000158 3300035724 Bacteria 44104
156 Ga0373933_0004414 3300035724 Bacteria 7727
157 Ga0373933_0028622 3300035724 Bacteria 3216
158 Ga0373933_0054021 3300035724 Bacteria 2406
159 Ga0373933_0077657 3300035724 Bacteria 2030
160 Ga0373947_0005836 3300035725 Bacteria 7175
161 Ga0373937_0296068 3300036401 Bacteria 1529
162 Ga0373937_0385895 3300036401 Bacteria 1328
163 Ga0373925_0186368 3300037068 Bacteria 1645
164 Ga0395900_0327204 3300037418 Bacteria 1511
165 Ga0395898_0003446 3300037466 Bacteria 17687
166 Ga0395901_0263664 3300038443 Bacteria 1793
167 Ga0436365_0079568 3300039437 Bacteria 1689
168 Ga0436365_0498686 3300039437 Bacteria 17846
169 Ga0436365_0853689 3300039437 Bacteria 1182
170 Ga0436365_1187744 3300039437 Bacteria 1129
171 Ga0436365_1273535 3300039437 Bacteria 1811
172 Ga0436365_1432525 3300039437 Bacteria 2029
173 Ga0436360_0221672 3300039438 Bacteria 1743
174 Ga0436360_0658785 3300039438 Bacteria 1608
175 Ga0436363_0593094 3300039450 Bacteria 1415
176 Ga0436363_0910317 3300039450 Bacteria 1718
177 Ga0451853_0091520 3300041512 Bacteria 876
178 Ga0466966_0086739 3300044684 Bacteria 1946
179 Ga0466963_0032461 3300044694 Bacteria 3381
180 Ga0466964_0396649 3300044706 Bacteria 720
181 Ga0466971_0095930 3300044719 Bacteria 1360
182 Ga0466957_0026302 3300044842 Bacteria 3452
183 Ga0466957_0164208 3300044842 Bacteria 1444
184 Ga0466959_0081242 3300045049 Bacteria 2336
185 Ga0466967_0034016 3300045976 Bacteria 4321
186 Ga0466967_0143068 3300045976 Bacteria 2229
187 Ga0466967_0170215 3300045976 Bacteria 2049
188 Ga0495592_0000496 3300046454 Bacteria 28707
189 Ga0495592_0038849 3300046454 Bacteria 3578
190 Ga0495629_0000419 3300046459 Bacteria 35618
191 Ga0495629_0053197 3300046459 Bacteria 2833
192 Ga0495641_0050103 3300046461 Bacteria 1910
193 Ga0495651_0123116 3300046462 Bacteria 1902
194 Ga0495653_0025307 3300046463 Bacteria 4772
195 Ga0495580_0349045 3300046472 Bacteria 1002
196 Ga0495582_0153368 3300046473 Bacteria 1308
197 Ga0495639_0141907 3300046475 Bacteria 1155
198 Ga0495662_0147169 3300046476 Bacteria 1160
199 Ga0495664_0014777 3300046477 Bacteria 4431
200 Ga0495664_0080311 3300046477 Bacteria 1954
201 Ga0495608_0048681 3300046511 Bacteria 2815
202 Ga0495618_0011307 3300046514 Bacteria 5409
203 Ga0495618_0024435 3300046514 Bacteria 3742
204 Ga0495628_0015191 3300046516 Bacteria 6432
205 Ga0495628_0062092 3300046516 Bacteria 2929
206 Ga0495630_0202362 3300046517 Bacteria 1515
207 Ga0495630_0323282 3300046517 Bacteria 1179
208 Ga0495652_0001897 3300046529 Bacteria 22213
209 Ga0495652_0120242 3300046529 Bacteria 2096
210 Ga0495652_0253140 3300046529 Bacteria 1304
211 Ga0495640_0003269 3300046533 Bacteria 13036
212 Ga0495586_0189896 3300046535 Bacteria 1163
213 Ga0495587_0036954 3300046536 Bacteria 2935
214 Ga0495587_0060878 3300046536 Bacteria 2212
215 Ga0495645_0035820 3300046543 Bacteria 3618
216 Ga0495645_0147355 3300046543 Bacteria 1638
217 Ga0495645_0339779 3300046543 Bacteria 970
218 Ga0495667_0008228 3300046559 Bacteria 7076
219 Ga0495634_0002201 3300046642 Bacteria 16374
220 Ga0495634_0019941 3300046642 Bacteria 4758
221 Ga0495634_0048996 3300046642 Bacteria 2842
222 Ga0495635_0018994 3300046663 Bacteria 4797
223 Ga0495635_0032996 3300046663 Bacteria 3592
224 Ga0495635_0273163 3300046663 Bacteria 1136
225 Ga0495657_0107099 3300046675 Bacteria 1774
226 Ga0495657_0125023 3300046675 Bacteria 1616
227 Ga0495599_0000922 3300046678 Bacteria 16443
228 Ga0495599_0036347 3300046678 Bacteria 3093
229 Ga0495623_0010985 3300046679 Bacteria 5859
230 Ga0495646_0002639 3300046680 Bacteria 11074
231 Ga0495646_0009373 3300046680 Bacteria 6210
232 Ga0495658_0013391 3300046683 Bacteria 4174
233 Ga0495613_0165091 3300046689 Bacteria 1573
234 Ga0495600_0002987 3300046809 Bacteria 9877
235 Ga0495600_0026197 3300046809 Bacteria 3761
236 Ga0495581_0084042 3300047315 Bacteria 1844
237 Ga0495604_0015082 3300047317 Bacteria 6165
238 Ga0495604_0263414 3300047317 Bacteria 1171
239 Ga0495674_0022064 3300047319 Bacteria 5876
240 Ga0495674_0041229 3300047319 Bacteria 4125
241 Ga0495672_0042504 3300047320 Bacteria 2740
242 Ga0495680_0006944 3300047322 Bacteria 10448
243 Ga0495675_0005417 3300047444 Bacteria 7778
244 Ga0495675_0008284 3300047444 Bacteria 6432
245 Ga0495675_0486848 3300047444 Bacteria 710
246 Ga0495684_0000032 3300047471 Bacteria 113195
247 Ga0495684_0026719 3300047471 Bacteria 4436
248 Ga0495684_0055978 3300047471 Bacteria 3007
249 Ga0495593_0000619 3300047673 Bacteria 20301
250 Ga0495602_0036495 3300048088 Bacteria 4574
251 Ga0495602_0140547 3300048088 Bacteria 1911
252 Ga0495602_0300087 3300048088 Bacteria 1176
253 Ga0496102_0346363 3300048905 Bacteria 1399
254 Ga0496103_0188064 3300048906 Bacteria 1328
255 Ga0496104_0078610 3300048907 Bacteria 3144
256 Ga0496105_0020283 3300048908 Bacteria 5371
257 Ga0496108_0170116 3300048911 Bacteria 1885
258 Ga0496109_0354883 3300048912 Bacteria 1385
259 Ga0496110_0004888 3300048913 Bacteria 10458
260 Ga0496110_0010579 3300048913 Bacteria 7511
261 Ga0496111_0151300 3300048914 Bacteria 1721
262 Ga0496112_0025627 3300048915 Bacteria 5664
263 Ga0496112_0028436 3300048915 Bacteria 5396
264 Ga0496112_0173951 3300048915 Bacteria 2118
265 Ga0496112_0214659 3300048915 Bacteria 1881
266 Ga0496113_0013879 3300048916 Bacteria 5476
267 Ga0496115_0045814 3300048918 Bacteria 3493
268 Ga0496117_0095194 3300048920 Bacteria 1904
269 Ga0496118_0426673 3300048921 Bacteria 680
270 Ga0496121_0177468 3300048924 Bacteria 1541
271 Ga0496121_0198844 3300048924 Bacteria 1430
272 Ga0496121_0300946 3300048924 Bacteria 1088
273 Ga0496124_0408421 3300048927 Bacteria 940
274 Ga0496125_0033141 3300048928 Bacteria 4577
275 Ga0496125_0152796 3300048928 Bacteria 1582
276 Ga0496126_0017788 3300048929 Bacteria 7075
277 Ga0496126_0087743 3300048929 Bacteria 2741
278 Ga0496126_0136230 3300048929 Bacteria 2118
279 Ga0501047_0149599 3300049581 Bacteria 2211
280 Ga0501067_0028111 3300049583 Bacteria 3115
281 Ga0501068_0289718 3300049584 Bacteria 1047
282 Ga0501070_0023752 3300049586 Bacteria 5138
283 Ga0501073_0079606 3300049589 Bacteria 2280
284 Ga0501074_0093075 3300049590 Bacteria 2158
285 Ga0501079_0483972 3300049741 Bacteria 973
286 Ga0501080_0007219 3300049742 Bacteria 10030
287 Ga0501080_0183063 3300049742 Bacteria 1927
288 Ga0495601_0247669 3300053077 Bacteria 1164
289 Ga0495612_0010936 3300053078 Bacteria 3665
290 Ga0495595_0026529 3300053084 Bacteria 2574
291 Ga0495619_0012499 3300053085 Bacteria 5347
292 Ga0495619_0177562 3300053085 Bacteria 1473
293 Ga0495619_0581816 3300053085 Bacteria 767
294 Ga0500603_020188 3300053150 Bacteria 1625
295 Ga0500636_0029772 3300053177 Bacteria 3227
296 Ga0466962_0069608 3300061719 Bacteria 1680
297 2885385335 2885383462 Bacteria 9473874
298 Ga0055539_1011580
299 rootL2_10109589
300 Ga0055539_1010463
301 Ga0070683_100013800
302 Ga0070683_100352107
303 Ga0070690_100501132
304 Ga0070680_100114303
305 Ga0070680_100190537
306 Ga0070682_100031810
307 Ga0070661_100317216
308 Ga0070709_10006849
309 Ga0070709_10087142
310 Ga0070714_100242221
311 Ga0070713_100038767
312 Ga0070713_100045873
313 Ga0070713_100215821
314 Ga0070710_10001636
315 Ga0070711_100009849
316 Ga0070711_100503123
317 Ga0070663_100081941
318 Ga0070681_10008570
319 Ga0070681_10042018
320 Ga0070681_10462101
321 Ga0070681_10582957
322 Ga0070681_10632981
323 Ga0070679_100009080
324 Ga0070679_100121787
325 Ga0070679_100270731
326 Ga0070684_100018082
327 Ga0070684_100093185
328 Ga0070684_100546620
329 Ga0070696_100495522
330 Ga0070693_100139353
331 Ga0068855_100087579
332 Ga0068855_100105229
333 Ga0068855_100410317
334 Ga0068855_100461005
335 Ga0070664_100421686
336 Ga0068857_100607725
337 Ga0068857_101065386
338 Ga0068854_100045344
339 Ga0068856_100462756
340 Ga0068856_100621647
341 Ga0068856_100897594
342 Ga0068852_100152150
343 Ga0068852_100542226
344 Ga0068859_100422632
345 Ga0068858_100616454
346 Ga0070717_10000445
347 Ga0070716_100049503
348 Ga0070716_100082888
349 Ga0070712_100145963
350 Ga0097620_100422659
351 Ga0105240_10142537
352 Ga0105240_10256599
353 Ga0105240_10434709
354 Ga0105247_10320284
355 Ga0105237_10658755
356 Ga0105237_10922053
357 Ga0105238_10051770
358 Ga0105238_10057860
359 Ga0105238_10065950
360 Ga0105238_10534577
361 Ga0105239_10126367
362 Ga0105239_10990135
363 Ga0157369_10209646
364 Ga0157369_10240071
365 Ga0157369_10762539
366 Ga0157369_10883625
367 Ga0157374_10322022
368 Ga0157372_10145006
369 Ga0157372_10669961
370 Ga0163163_10161794
371 Ga0157379_10069691
372 Ga0213876_10152855
373 Ga0213876_10257995
374 Ga0209677_102544
375 Ga0209148_1008525
376 Ga0209233_1014728
377 Ga0209455_1004130
378 Ga0207692_10034140
379 Ga0207699_10023700
380 Ga0207699_10055007
381 Ga0207707_10000143
382 Ga0207707_10058755
383 Ga0207707_10110079
384 Ga0207695_10101197
385 Ga0207695_10297216
386 Ga0207695_10430710
387 Ga0207671_10611664
388 Ga0207693_10021338
389 Ga0207663_10011205
390 Ga0207663_10256250
391 Ga0207660_10053522
392 Ga0207652_10008815
393 Ga0207652_10077431
394 Ga0207694_10149259
395 Ga0207694_10154768
396 Ga0207687_10561826
397 Ga0207700_10165544
398 Ga0207700_10295518
399 Ga0207665_10062389
400 Ga0207661_10005550
401 Ga0207661_10050977
402 Ga0207679_10935800
403 Ga0207667_10145688
404 Ga0207667_10360217
405 Ga0207667_10376161
406 Ga0207703_10238638
407 Ga0207678_10435724
408 Ga0207702_10452682
409 Ga0207674_10099170
410 Ga0207674_10406872
411 Ga0265326_10008158
412 Ga0265319_1004675
413 Ga0265334_10004652
414 Ga0265318_10127372
415 Ga0265323_10023330
416 Ga0265336_10005667
417 Ga0265338_10001172
418 Ga0265324_10011263
419 Ga0265330_10010663
420 Ga0265330_10041225
421 Ga0265330_10050469
422 Ga0265332_10120970
423 Ga0265328_10137477
424 Ga0265325_10031143
425 Ga0265340_10021829
426 Ga0265340_10252587
427 Ga0265339_10006769
428 Ga0265339_10126842
429 Ga0265316_10257257
430 Ga0307508_10002880
431 Ga0265314_10124612
432 Ga0373934_0023318
433 Ga0373934_0041961
434 Ga0373934_0064956
435 Ga0373923_0002139
436 Ga0373953_0006329
437 Ga0373953_0033657
438 Ga0373954_0002404
439 Ga0373954_0012051
440 Ga0373956_0137173
441 Ga0373946_0008031
442 Ga0373955_0001440
443 Ga0373955_0004176
444 Ga0373955_0014696
445 Ga0373924_0001113
446 Ga0373924_0004613
447 Ga0373924_0087888
448 Ga0373931_0068818
449 Ga0373935_0083009
450 Ga0373935_0403286
451 Ga0373927_0008562
452 Ga0373933_0000158
453 Ga0373933_0004414
454 Ga0373933_0028622
455 Ga0373933_0054021
456 Ga0373933_0077657
457 Ga0373947_0005836
458 Ga0373937_0296068
459 Ga0373937_0385895
460 Ga0373925_0186368
461 Ga0395900_0327204
462 Ga0395898_0003446
463 Ga0395901_0263664
464 Ga0436365_0079568
465 Ga0436365_0498686
466 Ga0436365_0853689
467 Ga0436365_1187744
468 Ga0436365_1273535
469 Ga0436365_1432525
470 Ga0436360_0221672
471 Ga0436360_0658785
472 Ga0436363_0593094
473 Ga0436363_0910317
474 Ga0451853_0091520
475 Ga0466966_0086739
476 Ga0466963_0032461
477 Ga0466964_0396649
478 Ga0466971_0095930
479 Ga0466957_0026302
480 Ga0466957_0164208
481 Ga0466959_0081242
482 Ga0466967_0034016
483 Ga0466967_0143068
484 Ga0466967_0170215
485 Ga0495592_0000496
486 Ga0495592_0038849
487 Ga0495629_0000419
488 Ga0495629_0053197
489 Ga0495641_0050103
490 Ga0495651_0123116
491 Ga0495653_0025307
492 Ga0495580_0349045
493 Ga0495582_0153368
494 Ga0495639_0141907
495 Ga0495662_0147169
496 Ga0495664_0014777
497 Ga0495664_0080311
498 Ga0495608_0048681
499 Ga0495618_0011307
500 Ga0495618_0024435
501 Ga0495628_0015191
502 Ga0495628_0062092
503 Ga0495630_0202362
504 Ga0495630_0323282
505 Ga0495652_0001897
506 Ga0495652_0120242
507 Ga0495652_0253140
508 Ga0495640_0003269
509 Ga0495586_0189896
510 Ga0495587_0036954
511 Ga0495587_0060878
512 Ga0495645_0035820
513 Ga0495645_0147355
514 Ga0495645_0339779
515 Ga0495667_0008228
516 Ga0495634_0002201
517 Ga0495634_0019941
518 Ga0495634_0048996
519 Ga0495635_0018994
520 Ga0495635_0032996
521 Ga0495635_0273163
522 Ga0495657_0107099
523 Ga0495657_0125023
524 Ga0495599_0000922
525 Ga0495599_0036347
526 Ga0495623_0010985
527 Ga0495646_0002639
528 Ga0495646_0009373
529 Ga0495658_0013391
530 Ga0495613_0165091
531 Ga0495600_0002987
532 Ga0495600_0026197
533 Ga0495581_0084042
534 Ga0495604_0015082
535 Ga0495604_0263414
536 Ga0495674_0022064
537 Ga0495674_0041229
538 Ga0495672_0042504
539 Ga0495680_0006944
540 Ga0495675_0005417
541 Ga0495675_0008284
542 Ga0495675_0486848
543 Ga0495684_0000032
544 Ga0495684_0026719
545 Ga0495684_0055978
546 Ga0495593_0000619
547 Ga0495602_0036495
548 Ga0495602_0140547
549 Ga0495602_0300087
550 Ga0496102_0346363
551 Ga0496103_0188064
552 Ga0496104_0078610
553 Ga0496105_0020283
554 Ga0496108_0170116
555 Ga0496109_0354883
556 Ga0496110_0004888
557 Ga0496110_0010579
558 Ga0496111_0151300
559 Ga0496112_0025627
560 Ga0496112_0028436
561 Ga0496112_0173951
562 Ga0496112_0214659
563 Ga0496113_0013879
564 Ga0496115_0045814
565 Ga0496117_0095194
566 Ga0496118_0426673
567 Ga0496121_0177468
568 Ga0496121_0198844
569 Ga0496121_0300946
570 Ga0496124_0408421
571 Ga0496125_0033141
572 Ga0496125_0152796
573 Ga0496126_0017788
574 Ga0496126_0087743
575 Ga0496126_0136230
576 Ga0501047_0149599
577 Ga0501067_0028111
578 Ga0501068_0289718
579 Ga0501070_0023752
580 Ga0501073_0079606
581 Ga0501074_0093075
582 Ga0501079_0483972
583 Ga0501080_0007219
584 Ga0501080_0183063
585 Ga0495601_0247669
586 Ga0495612_0010936
587 Ga0495595_0026529
588 Ga0495619_0012499
589 Ga0495619_0177562
590 Ga0495619_0581816
591 Ga0500603_020188
592 Ga0500636_0029772
593 Ga0466962_0069608
594 2885385335

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

38

160

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
6e7t-assembly2.cif.gz_C heterodimer of the glun1b-glun2b nmda receptor amino-terminal domains bound to allosteric inhibitor 93-6 0.8884 77 94
6e7x-assembly2.cif.gz_C heterodimer of the glun1b-glun2b nmda receptor amino-terminal domains bound to allosteric inhibitor 93-97 0.8782 77 94
4u5y-assembly1.cif.gz_A crystal structure of the complex between the gnat domain of s. lividans pat and the acetyl-coa synthetase c-terminal domain of s. enterica 0.8662 13 179
3v8h-assembly2.cif.gz_B crystal structure of thymidylate synthase from burkholderia thailandensis 0.8544 140 179
4nxy-assembly1.cif.gz_A crystal structure of the gnat domain of s. lividans pat 0.8424 13 179
ID Description Score Start End Superfamily
af_A0A0R0KY63_116_283_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8826 75 180 3.40.630.30
4u5yA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8662 13 179 3.40.630.30
af_P76594_717_886_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8535 16 182 3.40.630.30
af_E7F6N3_74_217_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8453 62 166 3.40.630.30
4u5yA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8372 13 179 3.40.630.30
ID Description Score Start End GO Terms
AF-A5ES73-F1-model_v4 deleted 0.9268 26 183
AF-A0A7C5PF92-F1-model_v4 GNAT family N-acetyltransferase 0.92 91 179 GO:0016747
AF-A0A2V9KBX3-F1-model_v4 Acetyl CoA synthetase subunit alpha 0.9115 75 180 GO:0016747
AF-M4ZG00-F1-model_v4 N-acetyltransferase domain-containing protein 0.911 4 183 GO:0016747
AF-A0A7Y5CYQ6-F1-model_v4 GNAT family N-acetyltransferase 0.9077 83 179 GO:0016747

Map