F393507

General Info

Members Datasets Scaffolds Average Seq Length
297 177 594 510

Family's Representative Sequence

Representative Sequence 3300003203|JGI25406J46586_10002501|JGI25406J46586_100025017
Length 550
Sequence VAYVCPPGEDKRKPPPSIPPLNAAVDVRRDIVHAQMKPFTNEPILELRRGPIRAQLAGALAEHDKRPALHVPVWIGDDQREGADIVSTDPGRPERVVAEAAAAAKDEVDAALRAARPWTAPAEERAQVLVRAAXWLRERRLEVAALEVRECAKPWPEADADVCEAIDFLEYYARGAVDLAQGAPLLQVPGERNEMTYAPRGVVAVISPWNFPVAIALGMTAAALATGNAAILKPAEQSPGCAFVLTRALREAGVPPSALALLPGEGEVGAALVRDPRVHTIAFTGSNKVGLDIVRAAAEVPPGQKHLKRVIAEMGGKNCVIVDSDADLDEVVPALVKSAFLYAGQKCSAAARVLCHEAIHDALVERLAGAIEVLEVGQADDLEIDVPPVIEEDAQQRVARYAAEAERGGRIAARARSVPDGSGWFAAPTLAADLPTDSPVLSDEIFGPLLAVERVRDVDDACDRVDASPFALTGGLFARNPDTVDRVIERSPVGNLYVNRAITGAMVARQPFGGNRLSGTGTKAGGPGYLLQFVEPHVVTENTMRHGLVV

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
62 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
63 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
64 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
99 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
100 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
110 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
111 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
112 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
113 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
114 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
115 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
116 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
117 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
118 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
119 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
122 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
123 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
124 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
125 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
126 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
127 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
128 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
129 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
130 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
131 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
132 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
133 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
134 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
135 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
136 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
137 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
142 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
143 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
144 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
147 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
158 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
159 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
160 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
161 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
162 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
163 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
166 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
172 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
173 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
174 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
175 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
176 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
177 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.35
Nodule 0
Rhizoplane 13.47
Rhizosphere 75.42
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10002501 3300003203 Bacteria 8695
2 Ga0070658_10007361 3300005327 Bacteria 8892
3 Ga0070658_10041988 3300005327 Bacteria 3691
4 Ga0070683_100014417 3300005329 Bacteria 6913
5 Ga0070680_100001583 3300005336 Bacteria 16610
6 Ga0070682_100005763 3300005337 Bacteria 6911
7 Ga0068868_100008117 3300005338 Bacteria 7510
8 Ga0068868_100044762 3300005338 Bacteria 3461
9 Ga0068868_100109607 3300005338 Bacteria 2242
10 Ga0070660_100007732 3300005339 Bacteria 7496
11 Ga0070660_100009869 3300005339 Bacteria 6732
12 Ga0070689_100072154 3300005340 Bacteria 2698
13 Ga0070668_100097162 3300005347 Bacteria 2329
14 Ga0070669_100001187 3300005353 Bacteria 18972
15 Ga0070675_100011015 3300005354 Bacteria 7080
16 Ga0070674_100089675 3300005356 Bacteria 2216
17 Ga0070673_100022676 3300005364 Bacteria 4573
18 Ga0070659_100016521 3300005366 Bacteria 5540
19 Ga0070659_100078539 3300005366 Bacteria 2633
20 Ga0070714_100021329 3300005435 Bacteria 5301
21 Ga0070714_100065710 3300005435 Bacteria 3125
22 Ga0070714_100146885 3300005435 Bacteria 2122
23 Ga0070710_10000001 3300005437 Bacteria 552187
24 Ga0070710_10018920 3300005437 Bacteria 3551
25 Ga0070711_100048354 3300005439 Bacteria 2908
26 Ga0070700_100018999 3300005441 Bacteria 3962
27 Ga0070700_100027994 3300005441 Bacteria 3348
28 Ga0070678_100086135 3300005456 Bacteria 2396
29 Ga0070662_100022214 3300005457 Bacteria 4340
30 Ga0068867_100015799 3300005459 Bacteria 5358
31 Ga0068867_100022423 3300005459 Bacteria 4515
32 Ga0068867_100102938 3300005459 Bacteria 2183
33 Ga0070685_10075376 3300005466 Bacteria 2009
34 Ga0070679_100228896 3300005530 Bacteria 1819
35 Ga0070684_100052809 3300005535 Bacteria 3535
36 Ga0070684_100122754 3300005535 Bacteria 2337
37 Ga0070665_100042716 3300005548 Bacteria 4557
38 Ga0070704_100007064 3300005549 Bacteria 6666
39 Ga0070664_100020328 3300005564 Bacteria 5466
40 Ga0068857_100111904 3300005577 Bacteria 2454
41 Ga0068852_100024087 3300005616 Bacteria 4914
42 Ga0068852_100037145 3300005616 Bacteria 4081
43 Ga0068852_100083208 3300005616 Bacteria 2845
44 Ga0068859_100126932 3300005617 Bacteria 2620
45 Ga0068851_10027904 3300005834 Bacteria 2786
46 Ga0081455_10008580 3300005937 Bacteria 10607
47 Ga0081538_10000632 3300005981 Bacteria 39001
48 Ga0081538_10003536 3300005981 Bacteria 14696
49 Ga0081538_10003571 3300005981 Bacteria 14633
50 Ga0081540_1001536 3300005983 Bacteria 19829
51 Ga0081539_10004603 3300005985 Bacteria 15051
52 Ga0081539_10010705 3300005985 Bacteria 7395
53 Ga0081539_10023486 3300005985 Bacteria 4040
54 Ga0070717_10000010 3300006028 Bacteria 283501
55 Ga0070717_10034882 3300006028 Bacteria 4069
56 Ga0070717_10097831 3300006028 Bacteria 2487
57 Ga0070717_10132969 3300006028 Bacteria 2141
58 Ga0075363_100031940 3300006048 Bacteria 2732
59 Ga0075364_10005245 3300006051 Bacteria 7520
60 Ga0075432_10024510 3300006058 Bacteria 2068
61 Ga0070712_100005849 3300006175 Bacteria 7614
62 Ga0070712_100043259 3300006175 Bacteria 3100
63 Ga0075430_100059691 3300006846 Bacteria 3206
64 Ga0075431_100000608 3300006847 Bacteria 30234
65 Ga0075431_100072525 3300006847 Bacteria 3553
66 Ga0075433_10017188 3300006852 Bacteria 5984
67 Ga0075434_100009641 3300006871 Bacteria 9020
68 Ga0075434_100011357 3300006871 Bacteria 8397
69 Ga0075434_100030466 3300006871 Bacteria 5313
70 Ga0068865_100007087 3300006881 Bacteria 6882
71 Ga0068865_100109241 3300006881 Bacteria 2037
72 Ga0075436_100069325 3300006914 Bacteria 2436
73 Ga0097620_100126929 3300006931 Bacteria 2620
74 Ga0075435_100011491 3300007076 Bacteria 6518
75 Ga0111539_10044194 3300009094 Bacteria 5338
76 Ga0111539_10047506 3300009094 Bacteria 5129
77 Ga0111539_10104845 3300009094 Bacteria 3317
78 Ga0111539_10177947 3300009094 Bacteria 2485
79 Ga0105245_10001783 3300009098 Bacteria 19591
80 Ga0114129_10000737 3300009147 Bacteria 41607
81 Ga0105243_10006459 3300009148 Bacteria 9067
82 Ga0105248_10102861 3300009177 Bacteria 3219
83 Ga0105238_10143312 3300009551 Bacteria 2366
84 Ga0105249_10014690 3300009553 Bacteria 6922
85 Ga0105249_10091367 3300009553 Bacteria 2848
86 Ga0105239_10025657 3300010375 Bacteria 6490
87 Ga0105239_10242142 3300010375 Bacteria 2024
88 Ga0157375_10199925 3300013308 Bacteria 2154
89 Ga0157377_10005131 3300014745 Bacteria 6122
90 Ga0157379_10026946 3300014968 Bacteria 5117
91 Ga0157379_10032607 3300014968 Bacteria 4644
92 Ga0206353_11291291 3300020082 Bacteria 8767
93 Ga0213874_10000905 3300021377 Bacteria 6045
94 Ga0213874_10002717 3300021377 Bacteria 3841
95 Ga0213876_10002876 3300021384 Bacteria 9998
96 Ga0213876_10005964 3300021384 Bacteria 6656
97 Ga0213876_10017475 3300021384 Bacteria 3787
98 Ga0213876_10031415 3300021384 Bacteria 2802
99 Ga0213875_10000477 3300021388 Bacteria 34125
100 Ga0213875_10009430 3300021388 Bacteria 4943
101 Ga0213875_10020927 3300021388 Bacteria 3137
102 Ga0207692_10000004 3300025898 Bacteria 413600
103 Ga0207692_10012143 3300025898 Bacteria 3691
104 Ga0207710_10019759 3300025900 Bacteria 2876
105 Ga0207688_10066211 3300025901 Bacteria 2043
106 Ga0207699_10013706 3300025906 Bacteria 4158
107 Ga0207705_10053372 3300025909 Bacteria 2912
108 Ga0207693_10004275 3300025915 Bacteria 12113
109 Ga0207693_10016671 3300025915 Bacteria 5869
110 Ga0207693_10031905 3300025915 Bacteria 4162
111 Ga0207663_10072151 3300025916 Bacteria 2230
112 Ga0207660_10007978 3300025917 Bacteria 6843
113 Ga0207662_10039991 3300025918 Bacteria 2754
114 Ga0207657_10002743 3300025919 Bacteria 18965
115 Ga0207657_10044618 3300025919 Bacteria 3896
116 Ga0207657_10068558 3300025919 Bacteria 3013
117 Ga0207652_10138075 3300025921 Bacteria 2178
118 Ga0207681_10001013 3300025923 Bacteria 18329
119 Ga0207687_10030673 3300025927 Bacteria 3626
120 Ga0207687_10112823 3300025927 Bacteria 2021
121 Ga0207700_10064106 3300025928 Bacteria 2798
122 Ga0207664_10010111 3300025929 Bacteria 6653
123 Ga0207664_10022921 3300025929 Bacteria 4671
124 Ga0207706_10069232 3300025933 Bacteria 3104
125 Ga0207706_10121826 3300025933 Bacteria 2294
126 Ga0207709_10006730 3300025935 Bacteria 6438
127 Ga0207670_10090287 3300025936 Bacteria 2164
128 Ga0207669_10043722 3300025937 Bacteria 2626
129 Ga0207704_10023181 3300025938 Bacteria 3341
130 Ga0207691_10008432 3300025940 Bacteria 9898
131 Ga0207689_10050446 3300025942 Bacteria 3431
132 Ga0207677_10022600 3300026023 Bacteria 3869
133 Ga0207678_10018605 3300026067 Bacteria 6099
134 Ga0207708_10030977 3300026075 Bacteria 4059
135 Ga0207708_10036847 3300026075 Bacteria 3725
136 Ga0207702_10041643 3300026078 Bacteria 3852
137 Ga0207648_10085623 3300026089 Bacteria 2749
138 Ga0207648_10091496 3300026089 Bacteria 2659
139 Ga0207674_10096283 3300026116 Bacteria 2945
140 Ga0207675_100160942 3300026118 Bacteria 2141
141 Ga0207683_10016376 3300026121 Bacteria 6309
142 Ga0207683_10030234 3300026121 Bacteria 4693
143 Ga0207428_10018580 3300027907 Bacteria 5935
144 Ga0207428_10081132 3300027907 Bacteria 2533
145 Ga0268266_10048553 3300028379 Bacteria 3639
146 Ga0268264_10029444 3300028381 Bacteria 4497
147 Ga0307405_10020941 3300031731 Bacteria 3666
148 Ga0307410_10057684 3300031852 Bacteria 2645
149 Ga0307407_10059291 3300031903 Bacteria 2229
150 Ga0307409_100187798 3300031995 Bacteria 1836
151 Ga0307415_100001297 3300032126 Bacteria 11801
152 Ga0307415_100037953 3300032126 Bacteria 3171
153 Ga0395899_0021733 3300037312 Bacteria 4867
154 Ga0395900_0130986 3300037418 Bacteria 2570
155 Ga0395898_0018862 3300037466 Bacteria 7028
156 Ga0395898_0208174 3300037466 Bacteria 1866
157 Ga0395898_0239409 3300037466 Bacteria 1731
158 Ga0395905_0198118 3300037471 Bacteria 1883
159 Ga0436364_0139396 3300037853 Bacteria 11823
160 Ga0436364_0312014 3300037853 Bacteria 4761
161 Ga0436364_0372631 3300037853 Bacteria 4603
162 Ga0436364_0388560 3300037853 Bacteria 34324
163 Ga0436364_1458151 3300037853 Bacteria 8961
164 Ga0436364_1532665 3300037853 Bacteria 2899
165 Ga0436364_1541424 3300037853 Bacteria 1924
166 Ga0395901_0078800 3300038443 Bacteria 3440
167 Ga0395901_0119111 3300038443 Bacteria 2774
168 Ga0395901_0143587 3300038443 Bacteria 2509
169 Ga0436365_0626783 3300039437 Bacteria 19138
170 Ga0436365_0700388 3300039437 Bacteria 19437
171 Ga0436365_0706206 3300039437 Bacteria 23664
172 Ga0436365_0830384 3300039437 Bacteria 17524
173 Ga0436365_1152762 3300039437 Bacteria 2580
174 Ga0436365_1164127 3300039437 Bacteria 3800
175 Ga0436365_1663055 3300039437 Bacteria 16089
176 Ga0436365_1754079 3300039437 Bacteria 8063
177 Ga0436365_1855971 3300039437 Bacteria 20585
178 Ga0436363_0665643 3300039450 Bacteria 2271
179 Ga0436363_0743057 3300039450 Bacteria 2571
180 Ga0436363_1222382 3300039450 Bacteria 3167
181 Ga0436363_1625665 3300039450 Bacteria 8304
182 Ga0436362_0001324 3300039453 Bacteria 5559
183 Ga0436362_0376761 3300039453 Bacteria 2440
184 Ga0439448_0013755 3300042005 Bacteria 2436
185 Ga0466966_0061617 3300044684 Bacteria 2366
186 Ga0466961_0006976 3300044693 Bacteria 7184
187 Ga0466963_0005088 3300044694 Bacteria 7684
188 Ga0466963_0005570 3300044694 Bacteria 7380
189 Ga0466963_0044712 3300044694 Bacteria 2915
190 Ga0466963_0070510 3300044694 Bacteria 2351
191 Ga0466971_0023034 3300044719 Bacteria 2775
192 Ga0466970_0047303 3300044765 Bacteria 2292
193 Ga0466957_0028143 3300044842 Bacteria 3345
194 Ga0466959_0006568 3300045049 Bacteria 8072
195 Ga0466959_0012289 3300045049 Bacteria 6181
196 Ga0466959_0019700 3300045049 Bacteria 4964
197 Ga0466959_0177206 3300045049 Bacteria 1493
198 Ga0466958_0001010 3300045836 Bacteria 12767
199 Ga0466958_0003277 3300045836 Bacteria 8374
200 Ga0466958_0005422 3300045836 Bacteria 6863
201 Ga0466958_0048179 3300045836 Bacteria 2574
202 Ga0466967_0007945 3300045976 Bacteria 7717
203 Ga0466967_0014737 3300045976 Bacteria 6105
204 Ga0466967_0020208 3300045976 Bacteria 5375
205 Ga0466967_0038516 3300045976 Bacteria 4101
206 Ga0466967_0044438 3300045976 Bacteria 3853
207 Ga0466967_0085287 3300045976 Bacteria 2859
208 Ga0466967_0108338 3300045976 Bacteria 2549
209 Ga0495651_0023399 3300046462 Bacteria 4803
210 Ga0495662_0004868 3300046476 Bacteria 6729
211 Ga0495608_0018825 3300046511 Bacteria 4757
212 Ga0495616_0063225 3300046513 Bacteria 1810
213 Ga0495618_0019926 3300046514 Bacteria 4129
214 Ga0495640_0034848 3300046533 Bacteria 3564
215 Ga0495587_0021768 3300046536 Bacteria 3956
216 Ga0495667_0109725 3300046559 Bacteria 1783
217 Ga0495599_0036713 3300046678 Bacteria 3078
218 Ga0495646_0007687 3300046680 Bacteria 6850
219 Ga0495658_0109715 3300046683 Bacteria 1658
220 Ga0495613_0044121 3300046689 Bacteria 3299
221 Ga0495600_0079526 3300046809 Bacteria 2140
222 Ga0495680_0015765 3300047322 Bacteria 6507
223 Ga0495684_0047899 3300047471 Bacteria 3268
224 Ga0495602_0102888 3300048088 Bacteria 2339
225 Ga0496101_0001434 3300048904 Bacteria 14237
226 Ga0496101_0002396 3300048904 Bacteria 11503
227 Ga0496102_0004320 3300048905 Bacteria 12019
228 Ga0496103_0025998 3300048906 Bacteria 3541
229 Ga0496103_0042025 3300048906 Bacteria 2811
230 Ga0496104_0006669 3300048907 Bacteria 10160
231 Ga0496104_0011468 3300048907 Bacteria 7940
232 Ga0496104_0017641 3300048907 Bacteria 6505
233 Ga0496104_0051567 3300048907 Bacteria 3883
234 Ga0496105_0002337 3300048908 Bacteria 13744
235 Ga0496105_0012442 3300048908 Bacteria 6737
236 Ga0496105_0018701 3300048908 Bacteria 5577
237 Ga0496105_0053657 3300048908 Bacteria 3329
238 Ga0496105_0144280 3300048908 Bacteria 1958
239 Ga0496105_0188178 3300048908 Bacteria 1689
240 Ga0496106_0002675 3300048909 Bacteria 13255
241 Ga0496106_0031646 3300048909 Bacteria 3942
242 Ga0496107_0024611 3300048910 Bacteria 4259
243 Ga0496108_0011003 3300048911 Bacteria 7347
244 Ga0496108_0046235 3300048911 Bacteria 3636
245 Ga0496109_0003415 3300048912 Bacteria 13290
246 Ga0496109_0029335 3300048912 Bacteria 4928
247 Ga0496109_0044441 3300048912 Bacteria 4030
248 Ga0496109_0058742 3300048912 Bacteria 3513
249 Ga0496110_0000925 3300048913 Bacteria 20585
250 Ga0496110_0031969 3300048913 Bacteria 4542
251 Ga0496110_0054766 3300048913 Bacteria 3508
252 Ga0496110_0067209 3300048913 Bacteria 3172
253 Ga0496111_0004933 3300048914 Bacteria 8474
254 Ga0496111_0010328 3300048914 Bacteria 6260
255 Ga0496112_0067962 3300048915 Bacteria 3518
256 Ga0496113_0002753 3300048916 Bacteria 10332
257 Ga0496113_0007510 3300048916 Bacteria 7025
258 Ga0496113_0009103 3300048916 Bacteria 6507
259 Ga0496113_0052720 3300048916 Bacteria 3039
260 Ga0496114_0014128 3300048917 Bacteria 6402
261 Ga0496114_0082020 3300048917 Bacteria 2725
262 Ga0496114_0133005 3300048917 Bacteria 2149
263 Ga0496115_0053289 3300048918 Bacteria 3246
264 Ga0496115_0222074 3300048918 Bacteria 1559
265 Ga0501038_0043483 3300049574 Bacteria 3906
266 Ga0501039_0013860 3300049575 Bacteria 6167
267 Ga0501039_0015501 3300049575 Bacteria 5834
268 Ga0501039_0017397 3300049575 Bacteria 5514
269 Ga0501040_0073620 3300049576 Bacteria 2361
270 Ga0501041_0028165 3300049577 Bacteria 3388
271 Ga0501042_0121269 3300049578 Bacteria 1882
272 Ga0501068_0117744 3300049584 Bacteria 1655
273 Ga0501069_0033758 3300049585 Bacteria 2819
274 Ga0501071_0010643 3300049587 Bacteria 6170
275 Ga0501071_0046828 3300049587 Bacteria 3106
276 Ga0501076_0028694 3300049592 Bacteria 4323
277 Ga0501079_0219908 3300049741 Bacteria 1484
278 Ga0501079_0231252 3300049741 Bacteria 1444
279 Ga0501080_0032734 3300049742 Bacteria 4850
280 Ga0501081_0191294 3300049743 Bacteria 1482
281 Ga0501044_0083669 3300049823 Bacteria 3227
282 Ga0501045_0021824 3300049824 Bacteria 4582
283 nmdc:mga0yw44_6165_c1 3300050492 Bacteria 5765
284 nmdc:mga05p37_3763_c1 3300050507 Bacteria 17759
285 nmdc:mga06r32_1012_c1 3300050510 Bacteria 25245
286 nmdc:mga06r32_24150_c1 3300050510 Bacteria 5637
287 nmdc:mga08y16_18870_c1 3300050511 Bacteria 7265
288 nmdc:mga08y16_34225_c1 3300050511 Bacteria 5337
289 nmdc:mga0n895_32545_c1 3300050512 Bacteria 5006
290 nmdc:mga08x19_15861_c1 3300050514 Bacteria 4588
291 Ga0495619_0012951 3300053085 Bacteria 5254
292 Ga0500556_0001547 3300053104 Bacteria 9386
293 Ga0501084_0186522 3300054114 Bacteria 1750
294 Ga0501082_0191117 3300060353 Bacteria 1781
295 Ga0466962_0001421 3300061719 Bacteria 11147
296 Ga0466962_0011393 3300061719 Bacteria 4282
297 Ga0530510_0033078 3300061734 Bacteria 3722
298 JGI25406J46586_10002501
299 Ga0070658_10007361
300 Ga0070658_10041988
301 Ga0070683_100014417
302 Ga0070680_100001583
303 Ga0070682_100005763
304 Ga0068868_100008117
305 Ga0068868_100044762
306 Ga0068868_100109607
307 Ga0070660_100007732
308 Ga0070660_100009869
309 Ga0070689_100072154
310 Ga0070668_100097162
311 Ga0070669_100001187
312 Ga0070675_100011015
313 Ga0070674_100089675
314 Ga0070673_100022676
315 Ga0070659_100016521
316 Ga0070659_100078539
317 Ga0070714_100021329
318 Ga0070714_100065710
319 Ga0070714_100146885
320 Ga0070710_10000001
321 Ga0070710_10018920
322 Ga0070711_100048354
323 Ga0070700_100018999
324 Ga0070700_100027994
325 Ga0070678_100086135
326 Ga0070662_100022214
327 Ga0068867_100015799
328 Ga0068867_100022423
329 Ga0068867_100102938
330 Ga0070685_10075376
331 Ga0070679_100228896
332 Ga0070684_100052809
333 Ga0070684_100122754
334 Ga0070665_100042716
335 Ga0070704_100007064
336 Ga0070664_100020328
337 Ga0068857_100111904
338 Ga0068852_100024087
339 Ga0068852_100037145
340 Ga0068852_100083208
341 Ga0068859_100126932
342 Ga0068851_10027904
343 Ga0081455_10008580
344 Ga0081538_10000632
345 Ga0081538_10003536
346 Ga0081538_10003571
347 Ga0081540_1001536
348 Ga0081539_10004603
349 Ga0081539_10010705
350 Ga0081539_10023486
351 Ga0070717_10000010
352 Ga0070717_10034882
353 Ga0070717_10097831
354 Ga0070717_10132969
355 Ga0075363_100031940
356 Ga0075364_10005245
357 Ga0075432_10024510
358 Ga0070712_100005849
359 Ga0070712_100043259
360 Ga0075430_100059691
361 Ga0075431_100000608
362 Ga0075431_100072525
363 Ga0075433_10017188
364 Ga0075434_100009641
365 Ga0075434_100011357
366 Ga0075434_100030466
367 Ga0068865_100007087
368 Ga0068865_100109241
369 Ga0075436_100069325
370 Ga0097620_100126929
371 Ga0075435_100011491
372 Ga0111539_10044194
373 Ga0111539_10047506
374 Ga0111539_10104845
375 Ga0111539_10177947
376 Ga0105245_10001783
377 Ga0114129_10000737
378 Ga0105243_10006459
379 Ga0105248_10102861
380 Ga0105238_10143312
381 Ga0105249_10014690
382 Ga0105249_10091367
383 Ga0105239_10025657
384 Ga0105239_10242142
385 Ga0157375_10199925
386 Ga0157377_10005131
387 Ga0157379_10026946
388 Ga0157379_10032607
389 Ga0206353_11291291
390 Ga0213874_10000905
391 Ga0213874_10002717
392 Ga0213876_10002876
393 Ga0213876_10005964
394 Ga0213876_10017475
395 Ga0213876_10031415
396 Ga0213875_10000477
397 Ga0213875_10009430
398 Ga0213875_10020927
399 Ga0207692_10000004
400 Ga0207692_10012143
401 Ga0207710_10019759
402 Ga0207688_10066211
403 Ga0207699_10013706
404 Ga0207705_10053372
405 Ga0207693_10004275
406 Ga0207693_10016671
407 Ga0207693_10031905
408 Ga0207663_10072151
409 Ga0207660_10007978
410 Ga0207662_10039991
411 Ga0207657_10002743
412 Ga0207657_10044618
413 Ga0207657_10068558
414 Ga0207652_10138075
415 Ga0207681_10001013
416 Ga0207687_10030673
417 Ga0207687_10112823
418 Ga0207700_10064106
419 Ga0207664_10010111
420 Ga0207664_10022921
421 Ga0207706_10069232
422 Ga0207706_10121826
423 Ga0207709_10006730
424 Ga0207670_10090287
425 Ga0207669_10043722
426 Ga0207704_10023181
427 Ga0207691_10008432
428 Ga0207689_10050446
429 Ga0207677_10022600
430 Ga0207678_10018605
431 Ga0207708_10030977
432 Ga0207708_10036847
433 Ga0207702_10041643
434 Ga0207648_10085623
435 Ga0207648_10091496
436 Ga0207674_10096283
437 Ga0207675_100160942
438 Ga0207683_10016376
439 Ga0207683_10030234
440 Ga0207428_10018580
441 Ga0207428_10081132
442 Ga0268266_10048553
443 Ga0268264_10029444
444 Ga0307405_10020941
445 Ga0307410_10057684
446 Ga0307407_10059291
447 Ga0307409_100187798
448 Ga0307415_100001297
449 Ga0307415_100037953
450 Ga0395899_0021733
451 Ga0395900_0130986
452 Ga0395898_0018862
453 Ga0395898_0208174
454 Ga0395898_0239409
455 Ga0395905_0198118
456 Ga0436364_0139396
457 Ga0436364_0312014
458 Ga0436364_0372631
459 Ga0436364_0388560
460 Ga0436364_1458151
461 Ga0436364_1532665
462 Ga0436364_1541424
463 Ga0395901_0078800
464 Ga0395901_0119111
465 Ga0395901_0143587
466 Ga0436365_0626783
467 Ga0436365_0700388
468 Ga0436365_0706206
469 Ga0436365_0830384
470 Ga0436365_1152762
471 Ga0436365_1164127
472 Ga0436365_1663055
473 Ga0436365_1754079
474 Ga0436365_1855971
475 Ga0436363_0665643
476 Ga0436363_0743057
477 Ga0436363_1222382
478 Ga0436363_1625665
479 Ga0436362_0001324
480 Ga0436362_0376761
481 Ga0439448_0013755
482 Ga0466966_0061617
483 Ga0466961_0006976
484 Ga0466963_0005088
485 Ga0466963_0005570
486 Ga0466963_0044712
487 Ga0466963_0070510
488 Ga0466971_0023034
489 Ga0466970_0047303
490 Ga0466957_0028143
491 Ga0466959_0006568
492 Ga0466959_0012289
493 Ga0466959_0019700
494 Ga0466959_0177206
495 Ga0466958_0001010
496 Ga0466958_0003277
497 Ga0466958_0005422
498 Ga0466958_0048179
499 Ga0466967_0007945
500 Ga0466967_0014737
501 Ga0466967_0020208
502 Ga0466967_0038516
503 Ga0466967_0044438
504 Ga0466967_0085287
505 Ga0466967_0108338
506 Ga0495651_0023399
507 Ga0495662_0004868
508 Ga0495608_0018825
509 Ga0495616_0063225
510 Ga0495618_0019926
511 Ga0495640_0034848
512 Ga0495587_0021768
513 Ga0495667_0109725
514 Ga0495599_0036713
515 Ga0495646_0007687
516 Ga0495658_0109715
517 Ga0495613_0044121
518 Ga0495600_0079526
519 Ga0495680_0015765
520 Ga0495684_0047899
521 Ga0495602_0102888
522 Ga0496101_0001434
523 Ga0496101_0002396
524 Ga0496102_0004320
525 Ga0496103_0025998
526 Ga0496103_0042025
527 Ga0496104_0006669
528 Ga0496104_0011468
529 Ga0496104_0017641
530 Ga0496104_0051567
531 Ga0496105_0002337
532 Ga0496105_0012442
533 Ga0496105_0018701
534 Ga0496105_0053657
535 Ga0496105_0144280
536 Ga0496105_0188178
537 Ga0496106_0002675
538 Ga0496106_0031646
539 Ga0496107_0024611
540 Ga0496108_0011003
541 Ga0496108_0046235
542 Ga0496109_0003415
543 Ga0496109_0029335
544 Ga0496109_0044441
545 Ga0496109_0058742
546 Ga0496110_0000925
547 Ga0496110_0031969
548 Ga0496110_0054766
549 Ga0496110_0067209
550 Ga0496111_0004933
551 Ga0496111_0010328
552 Ga0496112_0067962
553 Ga0496113_0002753
554 Ga0496113_0007510
555 Ga0496113_0009103
556 Ga0496113_0052720
557 Ga0496114_0014128
558 Ga0496114_0082020
559 Ga0496114_0133005
560 Ga0496115_0053289
561 Ga0496115_0222074
562 Ga0501038_0043483
563 Ga0501039_0013860
564 Ga0501039_0015501
565 Ga0501039_0017397
566 Ga0501040_0073620
567 Ga0501041_0028165
568 Ga0501042_0121269
569 Ga0501068_0117744
570 Ga0501069_0033758
571 Ga0501071_0010643
572 Ga0501071_0046828
573 Ga0501076_0028694
574 Ga0501079_0219908
575 Ga0501079_0231252
576 Ga0501080_0032734
577 Ga0501081_0191294
578 Ga0501044_0083669
579 Ga0501045_0021824
580 nmdc:mga0yw44_6165_c1
581 nmdc:mga05p37_3763_c1
582 nmdc:mga06r32_1012_c1
583 nmdc:mga06r32_24150_c1
584 nmdc:mga08y16_18870_c1
585 nmdc:mga08y16_34225_c1
586 nmdc:mga0n895_32545_c1
587 nmdc:mga08x19_15861_c1
588 Ga0495619_0012951
589 Ga0500556_0001547
590 Ga0501084_0186522
591 Ga0501082_0191117
592 Ga0466962_0001421
593 Ga0466962_0011393
594 Ga0530510_0033078

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00171

Aldedh

Aldehyde dehydrogenase family

74

539

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qan-assembly2.cif.gz_C-2 crystal structure of 1-pyrroline-5-carboxylate dehydrogenase from bacillus halodurans 0.9745 36 543
3rjl-assembly10.cif.gz_B crystal structure of 1-pyrroline-5-carboxylate dehydrogenase from bacillus licheniformis (target nysgrc-000337) 0.972 37 541
5ur2-assembly1.cif.gz_A crystal structure of proline utilization a (puta) from bdellovibrio bacteriovorus inactivated by n-propargylglycine 0.9665 36 549
5ur2-assembly2.cif.gz_D crystal structure of proline utilization a (puta) from bdellovibrio bacteriovorus inactivated by n-propargylglycine 0.9646 36 549
5ur2-assembly1.cif.gz_B crystal structure of proline utilization a (puta) from bdellovibrio bacteriovorus inactivated by n-propargylglycine 0.9643 36 549
ID Description Score Start End Superfamily
3rjlA01 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9718 38 314 3.40.605.10
af_P80668_278_463_3.40.309.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 0.9579 319 503 3.40.309.10
1uzbB01 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9539 36 312 3.40.605.10
1uzbB02 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 0.953 314 505 3.40.309.10
1t90D02 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 0.9485 314 505 3.40.309.10
ID Description Score Start End GO Terms
AF-W7KTC1-F1-model_v4 L-glutamate gamma-semialdehyde dehydrogenase (EC 1.2.1.88) 0.9785 36 350 GO:0003842
GO:0009898
GO:0010133
AF-A0A4Q6BV76-F1-model_v4 L-glutamate gamma-semialdehyde dehydrogenase (EC 1.2.1.88) 0.9745 85 518 GO:0003842
GO:0009898
GO:0010133
AF-W4RR66-F1-model_v4 L-glutamate gamma-semialdehyde dehydrogenase (EC 1.2.1.88) 0.9727 74 541 GO:0003842
GO:0009898
GO:0010133
AF-A0A1V5IFH1-F1-model_v4 L-glutamate gamma-semialdehyde dehydrogenase (EC 1.2.1.88) 0.9696 37 549 GO:0003842
GO:0004657
GO:0009898
GO:0010133
AF-A0A3L7P239-F1-model_v4 L-glutamate gamma-semialdehyde dehydrogenase (EC 1.2.1.88) 0.9622 37 549 GO:0003700
GO:0003842
GO:0004657
GO:0009898
GO:0010133

Map