F393360

General Info

Members Datasets Scaffolds Average Seq Length
296 207 263 139

Family's Representative Sequence

Representative Sequence 3300046615|Ga0495656_0096256|Ga0495656_0096256_626_1138
Length 170
Sequence MRATVAIADLDGWRGGFAHQSTPSRIGVTIMKTALETFIYTAHTHVTGGRNGVGRSSDGELDVTLSRPGSGQPGTNPEQLFGIGYSACFIGAIQLAATARKVAMPKDASIDTEVTLGKTAAGEFQLAVKLNVNLPGLDEALKRELVEAAHQTCPYSRMTRGHVEVELAVA

Samples

Sample ID Description Type Environment
1 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
2 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
3 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
4 2643221559 Lysobacter sp. Root559 Isolate Unclassified
5 2643221586 Lysobacter sp. Root667 Isolate Unclassified
6 2643221599 Rhizobium sp. Root708 Isolate Unclassified
7 2643221612 Lysobacter sp. Root76 Isolate Unclassified
8 2643221618 Ensifer sp. Root231 Isolate Unclassified
9 2643221626 Ensifer sp. Root31 Isolate Unclassified
10 2643221651 Afipia sp. Root123D2 Isolate Unclassified
11 2643221655 Ensifer sp. Root1252 Isolate Unclassified
12 2643221659 Ensifer sp. Root127 Isolate Unclassified
13 2643221698 Ensifer sp. Root142 Isolate Unclassified
14 2643221712 Ensifer sp. Root258 Isolate Unclassified
15 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
16 2643221727 Lysobacter sp. Root96 Isolate Unclassified
17 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
18 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
19 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
20 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
21 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
22 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
23 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
24 2844163670 Ensifer sp. 1H6 Isolate Unclassified
25 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
26 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
27 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
28 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
29 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
30 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
31 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
32 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
33 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
34 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
35 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
36 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
37 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
38 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
39 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
40 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
41 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
42 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
43 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
44 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
45 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
55 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
61 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
62 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
67 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
68 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
71 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
74 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
82 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
83 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
88 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
89 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
90 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
91 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
92 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
93 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
94 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
95 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
96 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
97 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
98 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
99 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
100 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
101 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
102 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
103 3300044668 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E2 Metagenome Unclassified
104 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
105 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
106 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
107 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
108 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
109 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
110 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
111 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
112 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
115 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
116 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
117 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
118 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
119 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
120 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
121 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
122 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
123 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
124 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
125 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
126 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
127 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
128 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
129 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
130 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
131 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
132 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
133 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
134 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
135 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
136 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
137 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
138 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
139 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
140 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
141 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
142 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
143 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
144 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
145 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
146 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
147 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
148 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
149 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
150 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
151 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
152 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
153 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
154 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
155 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
156 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
157 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
158 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
159 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
160 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
161 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
172 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
173 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
174 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
175 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
176 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
177 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
178 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
179 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
183 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
184 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
185 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
186 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
187 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
188 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
189 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
190 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
191 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
192 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
193 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
194 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
195 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
196 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
197 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
198 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
199 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
200 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
201 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
202 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
203 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
204 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
205 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
206 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
207 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.85
Metatranscriptomes 0
Isolates 11.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.88
Nodule 5.07
Rhizoplane 4.73
Rhizosphere 62.5
Stem 0
Stem Tuber 0
Unclassified 11.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1001122 3300002737 Bacteria 16127
2 JGI25164J39214_1002229 3300002772 Bacteria 3166
3 JGI25165J46597_1004310 3300003214 Bacteria 3105
4 rootH1_10009456 3300003323 Bacteria 35353
5 rootH1_10015682 3300003323 Bacteria 9007
6 Ga0055532_1000073 3300003758 Bacteria 131021
7 Ga0055527_1001285 3300003760 Bacteria 5486
8 Ga0055535_1000055 3300003761 Bacteria 131021
9 Ga0055542_1029045 3300003762 Bacteria 723
10 Ga0055529_1000149 3300003763 Bacteria 100620
11 Ga0055536_1074061 3300003781 Bacteria 663
12 Ga0055541_1005496 3300003841 Bacteria 2206
13 Ga0065165_1003407 3300005262 Bacteria 11214
14 Ga0065714_10160212 3300005288 Bacteria 1056
15 Ga0065715_10175239 3300005293 Bacteria 1502
16 Ga0070671_100153425 3300005355 Bacteria 1945
17 Ga0070673_100548552 3300005364 Bacteria 1050
18 Ga0068852_100266414 3300005616 Bacteria 1647
19 Ga0068861_101500539 3300005719 Bacteria 661
20 Ga0068860_102548788 3300005843 Bacteria 531
21 Ga0105244_10081857 3300009036 Bacteria 1597
22 Ga0105249_10545582 3300009553 Bacteria 1209
23 Ga0105246_10068470 3300011119 Bacteria 2490
24 Ga0157337_1003796 3300012483 Bacteria 935
25 Ga0157327_1000748 3300012512 Bacteria 1837
26 Ga0163162_10365744 3300013306 Bacteria 1575
27 Ga0157380_12068028 3300014326 Bacteria 632
28 Ga0157376_11123966 3300014969 Bacteria 812
29 Ga0163161_10206575 3300017792 Bacteria 1515
30 Ga0214542_1000400 3300021321 Bacteria 76349
31 Ga0214543_1000019 3300021327 Bacteria 267908
32 Ga0209674_102049 3300025226 Bacteria 4616
33 Ga0209672_100128 3300025228 Bacteria 77946
34 Ga0209672_100575 3300025228 Bacteria 19521
35 Ga0209147_100005 3300025229 Bacteria 1036530
36 Ga0209563_116374 3300025230 Bacteria 913
37 Ga0207427_100243 3300025231 Bacteria 43831
38 Ga0209437_100034 3300025233 Bacteria 494007
39 Ga0209258_100007 3300025242 Bacteria 1036530
40 Ga0209148_1004014 3300025254 Bacteria 3763
41 Ga0209233_1000038 3300025261 Bacteria 548972
42 Ga0209455_1000011 3300025272 Bacteria 947242
43 Ga0209676_1005467 3300025292 Bacteria 6634
44 Ga0209025_1181912 3300025294 Bacteria 538
45 Ga0207655_1029962 3300025728 Bacteria 2538
46 Ga0207650_10225232 3300025925 Bacteria 1510
47 Ga0207644_10065976 3300025931 Bacteria 2634
48 Ga0207706_10200449 3300025933 Bacteria 1750
49 Ga0207703_10521751 3300026035 Bacteria 1117
50 Ga0207675_100580454 3300026118 Bacteria 1122
51 Ga0268265_10430223 3300028380 Bacteria 1228
52 Ga0268265_10445037 3300028380 Bacteria 1209
53 Ga0268265_12463875 3300028380 Bacteria 526
54 Ga0265328_10304912 3300031239 Bacteria 615
55 Ga0307513_10503132 3300031456 Bacteria 929
56 Ga0307410_11322624 3300031852 Bacteria 631
57 Ga0395898_0012073 3300037466 Bacteria 8943
58 Ga0395905_0041030 3300037471 Bacteria 4342
59 Ga0395901_0042784 3300038443 Bacteria 4697
60 Ga0439436_0005775 3300041404 Bacteria 3790
61 Ga0439439_0000183 3300041406 Bacteria 9496
62 Ga0439461_0004036 3300041410 Bacteria 2436
63 Ga0439466_0000148 3300041411 Bacteria 27859
64 Ga0439466_0037527 3300041411 Bacteria 1631
65 Ga0439465_0052447 3300041413 Bacteria 1338
66 Ga0439465_0084573 3300041413 Bacteria 1079
67 Ga0439431_0028561 3300041997 Bacteria 1374
68 Ga0439445_0006735 3300042004 Bacteria 2647
69 Ga0439449_0047295 3300042007 Bacteria 1594
70 Ga0439449_0075714 3300042007 Bacteria 1240
71 Ga0439451_001554 3300042009 Bacteria 4539
72 Ga0439462_0011180 3300042015 Bacteria 2282
73 Ga0439463_035599 3300042016 Bacteria 1260
74 Ga0450905_006593 3300042142 Bacteria 1572
75 Ga0439434_0015236 3300042435 Bacteria 2291
76 Ga0439434_0161157 3300042435 Bacteria 745
77 Ga0439440_0103491 3300042993 Bacteria 777
78 Ga0466969_0047663 3300044656 Bacteria 2120
79 Ga0466972_0032683 3300044658 Bacteria 2554
80 Ga0466972_0216794 3300044658 Bacteria 895
81 Ga0466972_0573875 3300044658 Bacteria 532
82 Ga0466980_0183644 3300044668 Bacteria 1359
83 Ga0466965_0017535 3300044683 Bacteria 3423
84 Ga0466965_0210946 3300044683 Bacteria 1032
85 Ga0466966_0031462 3300044684 Bacteria 3440
86 Ga0466966_0064004 3300044684 Bacteria 2316
87 Ga0466961_0026097 3300044693 Bacteria 3756
88 Ga0466971_0298530 3300044719 Bacteria 773
89 Ga0466968_0002074 3300044735 Bacteria 7297
90 Ga0466970_0001879 3300044765 Bacteria 10156
91 Ga0466970_0028961 3300044765 Bacteria 2913
92 Ga0466970_0107089 3300044765 Bacteria 1525
93 Ga0466957_0099938 3300044842 Bacteria 1827
94 Ga0466957_0228265 3300044842 Bacteria 1232
95 Ga0466960_0000645 3300044901 Bacteria 12084
96 Ga0466960_0014429 3300044901 Bacteria 3381
97 Ga0466960_0563504 3300044901 Bacteria 673
98 Ga0466959_0007491 3300045049 Bacteria 7662
99 Ga0466959_0076610 3300045049 Bacteria 2414
100 Ga0466967_0044719 3300045976 Bacteria 3843
101 Ga0495617_000690 3300046452 Bacteria 16913
102 Ga0495617_012383 3300046452 Bacteria 2906
103 Ga0495603_0120609 3300046455 Bacteria 1528
104 Ga0495590_0109656 3300046457 Bacteria 985
105 Ga0495590_0140845 3300046457 Bacteria 870
106 Ga0495638_0205799 3300046460 Bacteria 1108
107 Ga0495605_0050341 3300046474 Bacteria 2032
108 Ga0495584_0000002 3300046491 Bacteria 512179
109 Ga0495584_0000160 3300046491 Bacteria 47133
110 Ga0495584_0000249 3300046491 Bacteria 38940
111 Ga0495584_0035323 3300046491 Bacteria 2527
112 Ga0495584_0079492 3300046491 Bacteria 1649
113 Ga0495585_0000398 3300046492 Bacteria 42060
114 Ga0495585_0012634 3300046492 Bacteria 4970
115 Ga0495585_0013100 3300046492 Bacteria 4861
116 Ga0495585_0021903 3300046492 Bacteria 3669
117 Ga0495585_0031415 3300046492 Bacteria 3014
118 Ga0495585_0265424 3300046492 Bacteria 852
119 Ga0495585_0311793 3300046492 Bacteria 771
120 Ga0495596_0000659 3300046500 Bacteria 21597
121 Ga0495607_0019258 3300046501 Bacteria 4337
122 Ga0495607_0054778 3300046501 Bacteria 2297
123 Ga0495607_0062400 3300046501 Bacteria 2112
124 Ga0495607_0427043 3300046501 Bacteria 598
125 Ga0495583_0000009 3300046506 Bacteria 372527
126 Ga0495583_0000113 3300046506 Bacteria 136475
127 Ga0495583_0004711 3300046506 Bacteria 9598
128 Ga0495583_0103491 3300046506 Bacteria 1213
129 Ga0495606_0005327 3300046507 Bacteria 12366
130 Ga0495606_0012876 3300046507 Bacteria 6659
131 Ga0495606_0169698 3300046507 Bacteria 1267
132 Ga0495610_0063772 3300046512 Bacteria 1743
133 Ga0495616_0000742 3300046513 Bacteria 23894
134 Ga0495616_0000761 3300046513 Bacteria 23546
135 Ga0495616_0007412 3300046513 Bacteria 6565
136 Ga0495616_0012219 3300046513 Bacteria 4883
137 Ga0495616_0445164 3300046513 Bacteria 525
138 Ga0495620_0223504 3300046515 Bacteria 720
139 Ga0495631_0000940 3300046518 Bacteria 18180
140 Ga0495643_0049667 3300046522 Bacteria 2261
141 Ga0495643_0265571 3300046522 Bacteria 795
142 Ga0495644_0002479 3300046523 Bacteria 7358
143 Ga0495648_0000403 3300046524 Bacteria 47579
144 Ga0495648_0069012 3300046524 Bacteria 2059
145 Ga0495663_0012190 3300046525 Bacteria 2396
146 Ga0495663_0025042 3300046525 Bacteria 1738
147 Ga0495654_0002591 3300046530 Bacteria 11547
148 Ga0495609_0001335 3300046538 Bacteria 16726
149 Ga0495609_0010759 3300046538 Bacteria 4377
150 Ga0495609_0047627 3300046538 Bacteria 1918
151 Ga0495609_0295822 3300046538 Bacteria 660
152 Ga0495621_0187795 3300046539 Bacteria 827
153 Ga0495633_0001110 3300046558 Bacteria 21652
154 Ga0495633_0001540 3300046558 Bacteria 17708
155 Ga0495633_0008133 3300046558 Bacteria 5946
156 Ga0495656_0011820 3300046615 Bacteria 3209
157 Ga0495656_0017716 3300046615 Bacteria 2722
158 Ga0495656_0022179 3300046615 Bacteria 2483
159 Ga0495656_0026877 3300046615 Bacteria 2294
160 Ga0495656_0096256 3300046615 Bacteria 1362
161 Ga0495668_0001376 3300046616 Bacteria 23821
162 Ga0495668_0067030 3300046616 Bacteria 1975
163 Ga0495611_0004155 3300046648 Bacteria 6301
164 Ga0495611_0021873 3300046648 Bacteria 2764
165 Ga0495611_0111415 3300046648 Bacteria 1274
166 Ga0495625_0042056 3300046660 Bacteria 3323
167 Ga0495625_0080079 3300046660 Bacteria 2275
168 Ga0495625_0130188 3300046660 Bacteria 1705
169 Ga0495635_0149442 3300046663 Bacteria 1590
170 Ga0495659_0000101 3300046664 Bacteria 37957
171 Ga0495659_0440490 3300046664 Bacteria 566
172 Ga0495661_0038722 3300046665 Bacteria 2967
173 Ga0495661_0039113 3300046665 Bacteria 2949
174 Ga0495661_0066078 3300046665 Bacteria 2129
175 Ga0495588_0005994 3300046674 Bacteria 5453
176 Ga0495588_0181120 3300046674 Bacteria 1113
177 Ga0495658_0557489 3300046683 Bacteria 734
178 Ga0495624_0281702 3300046690 Bacteria 1004
179 Ga0495670_0000515 3300046691 Bacteria 18226
180 Ga0495670_0000962 3300046691 Bacteria 13947
181 Ga0495670_0422266 3300046691 Bacteria 721
182 Ga0495671_0089786 3300046692 Bacteria 1504
183 Ga0495589_0293296 3300046794 Bacteria 755
184 Ga0495660_0004238 3300046810 Bacteria 8705
185 Ga0495636_0003512 3300047318 Bacteria 6078
186 Ga0495636_0006691 3300047318 Bacteria 4532
187 Ga0495636_0045966 3300047318 Bacteria 1820
188 Ga0495636_0050969 3300047318 Bacteria 1734
189 Ga0495636_0064445 3300047318 Bacteria 1554
190 Ga0495636_0068630 3300047318 Bacteria 1509
191 Ga0495672_0001979 3300047320 Bacteria 19353
192 Ga0495672_0064206 3300047320 Bacteria 2103
193 Ga0495683_0000342 3300047323 Bacteria 38556
194 Ga0495683_0011292 3300047323 Bacteria 4702
195 Ga0495687_000807 3300047443 Bacteria 33697
196 Ga0495687_157328 3300047443 Bacteria 769
197 Ga0495687_173108 3300047443 Bacteria 713
198 Ga0495687_217848 3300047443 Bacteria 593
199 Ga0495677_0044440 3300047445 Bacteria 1628
200 Ga0495685_000112 3300047447 Bacteria 28941
201 Ga0495685_140067 3300047447 Bacteria 788
202 Ga0495673_0007527 3300047469 Bacteria 6240
203 Ga0495681_0238298 3300047470 Bacteria 723
204 Ga0495614_0016354 3300048089 Bacteria 3229
205 Ga0495626_0104346 3300048091 Bacteria 1233
206 Ga0496100_0272214 3300048903 Bacteria 1260
207 Ga0496101_0055801 3300048904 Bacteria 2855
208 Ga0496101_1168827 3300048904 Bacteria 603
209 Ga0496102_0000334 3300048905 Bacteria 57709
210 Ga0496102_0034070 3300048905 Bacteria 4580
211 Ga0496107_0159903 3300048910 Bacteria 1669
212 Ga0496109_0010832 3300048912 Bacteria 7808
213 Ga0496110_0068139 3300048913 Bacteria 3149
214 Ga0496111_0319622 3300048914 Bacteria 1150
215 Ga0496111_0699273 3300048914 Bacteria 737
216 Ga0496112_0081210 3300048915 Bacteria 3206
217 Ga0496112_1194262 3300048915 Bacteria 678
218 Ga0496113_0159018 3300048916 Bacteria 1785
219 Ga0496114_1659354 3300048917 Bacteria 527
220 Ga0496117_0292220 3300048920 Bacteria 867
221 Ga0496120_0139618 3300048923 Bacteria 1232
222 Ga0496121_0255301 3300048924 Bacteria 1213
223 Ga0496121_0723083 3300048924 Bacteria 596
224 Ga0496122_0091728 3300048925 Bacteria 2067
225 Ga0496122_0347150 3300048925 Bacteria 777
226 Ga0496123_0091230 3300048926 Bacteria 1808
227 Ga0496123_0221622 3300048926 Bacteria 953
228 Ga0496124_0017409 3300048927 Bacteria 6772
229 Ga0496124_0038305 3300048927 Bacteria 4164
230 Ga0496126_0157814 3300048929 Bacteria 1940
231 Ga0496126_0229459 3300048929 Bacteria 1556
232 Ga0496126_0385790 3300048929 Bacteria 1139
233 Ga0495678_001908 3300049459 Bacteria 15146
234 Ga0495682_0000522 3300049460 Bacteria 26585
235 Ga0495682_0000532 3300049460 Bacteria 26301
236 Ga0495682_0076445 3300049460 Bacteria 1204
237 Ga0501037_0390769 3300049573 Bacteria 955
238 Ga0501043_0070696 3300049579 Bacteria 2742
239 Ga0501070_0002495 3300049586 Bacteria 16123
240 nmdc:mga00v17_10293_c1 3300050491 Bacteria 5100
241 Ga0500643_018067 3300053087 Bacteria 2348
242 Ga0500651_0000064 3300053093 Bacteria 70497
243 Ga0500566_0136978 3300053094 Bacteria 1303
244 Ga0500560_069537 3300053107 Bacteria 1159
245 Ga0500571_000272 3300053110 Bacteria 19980
246 Ga0500594_0003706 3300053118 Bacteria 3368
247 Ga0500597_151301 3300053120 Bacteria 996
248 Ga0500608_104179 3300053122 Bacteria 1310
249 Ga0500614_196718 3300053123 Bacteria 620
250 Ga0500626_023566 3300053128 Bacteria 2757
251 Ga0500655_002452 3300053133 Bacteria 3381
252 Ga0500658_0000441 3300053134 Bacteria 17798
253 Ga0500658_0000480 3300053134 Bacteria 17084
254 Ga0500559_0009627 3300053136 Bacteria 4172
255 Ga0500564_010950 3300053138 Bacteria 3989
256 Ga0500568_0005555 3300053139 Bacteria 6494
257 Ga0500574_036763 3300053141 Bacteria 1347
258 Ga0500624_064145 3300053157 Bacteria 707
259 Ga0500627_0105138 3300053158 Bacteria 1269
260 Ga0500634_0071680 3300053161 Bacteria 1811
261 Ga0500638_098335 3300053162 Bacteria 1368
262 Ga0500636_0076210 3300053177 Bacteria 1939
263 Ga0466962_0119905 3300061719 Bacteria 1269

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053087 Ga0500643_018067 Ga0500643_018067_47_388 113
2 3300046507 Ga0495606_0005327 Ga0495606_0005327_925_1344 130
3 iso_pu_bacteria 2643221715 2644638653 130
4 iso_pu_bacteria 2902810491 2902811454 130
5 3300025294 Ga0209025_1181912 Ga0209025_11819121 134
6 3300031852 Ga0307410_11322624 Ga0307410_113226242 134
7 3300041410 Ga0439461_0004036 Ga0439461_0004036_517_921 134
8 3300041411 Ga0439466_0000148 Ga0439466_0000148_1668_2072 134
9 3300041413 Ga0439465_0052447 Ga0439465_0052447_233_637 134
10 3300041997 Ga0439431_0028561 Ga0439431_0028561_518_922 134
11 3300042004 Ga0439445_0006735 Ga0439445_0006735_2204_2608 134
12 3300042435 Ga0439434_0015236 Ga0439434_0015236_1843_2247 134
13 3300044658 Ga0466972_0216794 Ga0466972_0216794_441_845 134
14 3300044683 Ga0466965_0017535 Ga0466965_0017535_576_980 134
15 3300044719 Ga0466971_0298530 Ga0466971_0298530_229_633 134
16 3300044735 Ga0466968_0002074 Ga0466968_0002074_1321_1725 134
17 3300044765 Ga0466970_0001879 Ga0466970_0001879_2220_2624 134
18 3300044842 Ga0466957_0099938 Ga0466957_0099938_373_777 134
19 3300044901 Ga0466960_0014429 Ga0466960_0014429_2220_2624 134
20 3300045049 Ga0466959_0007491 Ga0466959_0007491_3375_3779 134
21 3300045976 Ga0466967_0044719 Ga0466967_0044719_819_1223 134
22 3300048904 Ga0496101_1168827 Ga0496101_1168827_23_427 134
23 3300048915 Ga0496112_0081210 Ga0496112_0081210_2326_2730 134
24 3300048916 Ga0496113_0159018 Ga0496113_0159018_186_590 134
25 3300048917 Ga0496114_1659354 Ga0496114_1659354_13_417 134
26 3300048925 Ga0496122_0091728 Ga0496122_0091728_732_1136 134
27 3300048926 Ga0496123_0221622 Ga0496123_0221622_154_558 134
28 3300048929 Ga0496126_0157814 Ga0496126_0157814_177_581 134
29 3300050491 nmdc:mga00v17_10293_c1 nmdc:mga00v17_10293_c1_1654_2058 134
30 3300061719 Ga0466962_0119905 Ga0466962_0119905_265_669 134
31 iso_pu_bacteria 2513237146 2513927134 134
32 iso_pu_bacteria 2513237166 2514049335 134
33 iso_pu_bacteria 2599185170 2599415427 134
34 iso_pu_bacteria 2643221599 2644003047 134
35 iso_pu_bacteria 2643221618 2644108415 134
36 iso_pu_bacteria 2643221626 2644147614 134
37 iso_pu_bacteria 2643221655 2644309467 134
38 iso_pu_bacteria 2643221659 2644331764 134
39 iso_pu_bacteria 2643221698 2644542145 134
40 iso_pu_bacteria 2643221712 2644615970 134
41 iso_pu_bacteria 2791355082 2792584908 134
42 iso_pu_bacteria 2791355091 2792619333 134
43 iso_pu_bacteria 2791355092 2792627105 134
44 iso_pu_bacteria 2838035591 2838038851 134
45 iso_pu_bacteria 2838661181 2838664559 134
46 iso_pu_bacteria 2844163670 2844166099 134
47 iso_pu_bacteria 2920760137 2920764090 134
48 iso_pu_bacteria 2933016740 2933018652 134
49 iso_pu_bacteria 2960617483 2960620648 134
50 iso_pu_bacteria 2977523885 2977529629 134
51 iso_pu_bacteria 3005452660 3005455184 134
52 iso_pu_bacteria 643692032 643822115 134
53 iso_pu_bacteria 8049293176 8049297757 134
54 iso_pu_bacteria 2643221559 2643818308 135
55 iso_pu_bacteria 2643221586 2643937969 135
56 iso_pu_bacteria 2643221612 2644078887 135
57 iso_pu_bacteria 2643221727 2644693664 135
58 iso_pu_bacteria 2808606377 2808930224 135
59 iso_pu_bacteria 2808606381 2808952211 135
60 iso_pu_bacteria 2928084124 2928085260 135
61 3300044656 Ga0466969_0047663 Ga0466969_0047663_1603_2022 136
62 3300044668 Ga0466980_0183644 Ga0466980_0183644_199_618 136
63 3300044684 Ga0466966_0064004 Ga0466966_0064004_1703_2122 136
64 3300044693 Ga0466961_0026097 Ga0466961_0026097_327_746 136
65 3300044765 Ga0466970_0107089 Ga0466970_0107089_445_864 136
66 3300045049 Ga0466959_0076610 Ga0466959_0076610_1865_2284 136
67 3300005616 Ga0068852_100266414 Ga0068852_1002664142 137
68 3300026035 Ga0207703_10521751 Ga0207703_105217511 137
69 3300048912 Ga0496109_0010832 Ga0496109_0010832_5001_5417 137
70 3300049579 Ga0501043_0070696 Ga0501043_0070696_879_1295 137
71 3300049586 Ga0501070_0002495 Ga0501070_0002495_8362_8778 137
72 3300003758 Ga0055532_1000073 Ga0055532_100007390 138
73 3300003760 Ga0055527_1001285 Ga0055527_10012852 138
74 3300003761 Ga0055535_1000055 Ga0055535_100005590 138
75 3300003762 Ga0055542_1029045 Ga0055542_10290451 138
76 3300003763 Ga0055529_1000149 Ga0055529_100014963 138
77 3300003781 Ga0055536_1074061 Ga0055536_10740611 138
78 3300003841 Ga0055541_1005496 Ga0055541_10054962 138
79 3300005262 Ga0065165_1003407 Ga0065165_10034072 138
80 3300021321 Ga0214542_1000400 Ga0214542_10004008 138
81 3300021327 Ga0214543_1000019 Ga0214543_10000198 138
82 3300025226 Ga0209674_102049 Ga0209674_1020493 138
83 3300025228 Ga0209672_100128 Ga0209672_10012862 138
84 3300025228 Ga0209672_100575 Ga0209672_1005756 138
85 3300025229 Ga0209147_100005 Ga0209147_100005128 138
86 3300025242 Ga0209258_100007 Ga0209258_100007128 138
87 3300025254 Ga0209148_1004014 Ga0209148_10040143 138
88 3300025272 Ga0209455_1000011 Ga0209455_100001153 138
89 3300025292 Ga0209676_1005467 Ga0209676_10054672 138
90 3300031456 Ga0307513_10503132 Ga0307513_105031322 138
91 3300037466 Ga0395898_0012073 Ga0395898_0012073_4866_5282 138
92 3300037471 Ga0395905_0041030 Ga0395905_0041030_1893_2309 138
93 3300038443 Ga0395901_0042784 Ga0395901_0042784_3449_3865 138
94 3300044842 Ga0466957_0228265 Ga0466957_0228265_85_507 138
95 3300044901 Ga0466960_0563504 Ga0466960_0563504_165_587 138
96 3300046452 Ga0495617_000690 Ga0495617_000690_13661_14077 138
97 3300046452 Ga0495617_012383 Ga0495617_012383_2171_2587 138
98 3300046455 Ga0495603_0120609 Ga0495603_0120609_1024_1440 138
99 3300046457 Ga0495590_0140845 Ga0495590_0140845_136_552 138
100 3300046474 Ga0495605_0050341 Ga0495605_0050341_114_530 138
101 3300046491 Ga0495584_0000249 Ga0495584_0000249_14959_15375 138
102 3300046491 Ga0495584_0035323 Ga0495584_0035323_240_656 138
103 3300046491 Ga0495584_0079492 Ga0495584_0079492_985_1401 138
104 3300046492 Ga0495585_0012634 Ga0495585_0012634_1289_1705 138
105 3300046492 Ga0495585_0013100 Ga0495585_0013100_1314_1730 138
106 3300046492 Ga0495585_0021903 Ga0495585_0021903_2207_2623 138
107 3300046492 Ga0495585_0031415 Ga0495585_0031415_743_1159 138
108 3300046492 Ga0495585_0311793 Ga0495585_0311793_141_557 138
109 3300046501 Ga0495607_0019258 Ga0495607_0019258_407_823 138
110 3300046501 Ga0495607_0054778 Ga0495607_0054778_1066_1482 138
111 3300046501 Ga0495607_0062400 Ga0495607_0062400_1125_1541 138
112 3300046501 Ga0495607_0427043 Ga0495607_0427043_119_535 138
113 3300046506 Ga0495583_0000113 Ga0495583_0000113_2472_2888 138
114 3300046507 Ga0495606_0012876 Ga0495606_0012876_5748_6164 138
115 3300046513 Ga0495616_0000761 Ga0495616_0000761_16947_17363 138
116 3300046513 Ga0495616_0012219 Ga0495616_0012219_2562_2978 138
117 3300046513 Ga0495616_0445164 Ga0495616_0445164_39_455 138
118 3300046522 Ga0495643_0265571 Ga0495643_0265571_61_477 138
119 3300046523 Ga0495644_0002479 Ga0495644_0002479_196_612 138
120 3300046524 Ga0495648_0000403 Ga0495648_0000403_25938_26354 138
121 3300046524 Ga0495648_0069012 Ga0495648_0069012_1593_2009 138
122 3300046538 Ga0495609_0001335 Ga0495609_0001335_2599_3015 138
123 3300046538 Ga0495609_0010759 Ga0495609_0010759_1160_1576 138
124 3300046538 Ga0495609_0295822 Ga0495609_0295822_91_507 138
125 3300046558 Ga0495633_0001110 Ga0495633_0001110_3194_3610 138
126 3300046558 Ga0495633_0008133 Ga0495633_0008133_664_1080 138
127 3300046615 Ga0495656_0011820 Ga0495656_0011820_1211_1627 138
128 3300046615 Ga0495656_0026877 Ga0495656_0026877_1609_2025 138
129 3300046648 Ga0495611_0004155 Ga0495611_0004155_2363_2779 138
130 3300046648 Ga0495611_0021873 Ga0495611_0021873_1033_1449 138
131 3300046648 Ga0495611_0111415 Ga0495611_0111415_450_866 138
132 3300046660 Ga0495625_0042056 Ga0495625_0042056_2853_3269 138
133 3300046660 Ga0495625_0080079 Ga0495625_0080079_1818_2234 138
134 3300046660 Ga0495625_0130188 Ga0495625_0130188_286_702 138
135 3300046664 Ga0495659_0000101 Ga0495659_0000101_30794_31210 138
136 3300046664 Ga0495659_0440490 Ga0495659_0440490_11_427 138
137 3300046665 Ga0495661_0038722 Ga0495661_0038722_544_960 138
138 3300046665 Ga0495661_0039113 Ga0495661_0039113_1784_2200 138
139 3300046665 Ga0495661_0066078 Ga0495661_0066078_1598_2014 138
140 3300046674 Ga0495588_0005994 Ga0495588_0005994_4890_5306 138
141 3300046691 Ga0495670_0000515 Ga0495670_0000515_11627_12043 138
142 3300046691 Ga0495670_0000962 Ga0495670_0000962_6784_7200 138
143 3300046692 Ga0495671_0089786 Ga0495671_0089786_122_538 138
144 3300046794 Ga0495589_0293296 Ga0495589_0293296_239_655 138
145 3300046810 Ga0495660_0004238 Ga0495660_0004238_5168_5584 138
146 3300047318 Ga0495636_0045966 Ga0495636_0045966_114_530 138
147 3300047320 Ga0495672_0001979 Ga0495672_0001979_5290_5706 138
148 3300047320 Ga0495672_0064206 Ga0495672_0064206_231_647 138
149 3300047323 Ga0495683_0011292 Ga0495683_0011292_2470_2886 138
150 3300047443 Ga0495687_000807 Ga0495687_000807_6748_7164 138
151 3300047443 Ga0495687_217848 Ga0495687_217848_43_459 138
152 3300047445 Ga0495677_0044440 Ga0495677_0044440_151_567 138
153 3300047447 Ga0495685_000112 Ga0495685_000112_1124_1540 138
154 3300047469 Ga0495673_0007527 Ga0495673_0007527_2505_2921 138
155 3300048905 Ga0496102_0000334 Ga0496102_0000334_6936_7352 138
156 3300048914 Ga0496111_0319622 Ga0496111_0319622_294_710 138
157 3300048924 Ga0496121_0723083 Ga0496121_0723083_55_471 138
158 3300048925 Ga0496122_0347150 Ga0496122_0347150_85_501 138
159 3300048927 Ga0496124_0017409 Ga0496124_0017409_62_478 138
160 3300048927 Ga0496124_0038305 Ga0496124_0038305_3731_4147 138
161 3300049459 Ga0495678_001908 Ga0495678_001908_238_654 138
162 3300049460 Ga0495682_0000522 Ga0495682_0000522_17350_17766 138
163 3300049460 Ga0495682_0000532 Ga0495682_0000532_6747_7163 138
164 3300005288 Ga0065714_10160212 Ga0065714_101602121 139
165 3300005719 Ga0068861_101500539 Ga0068861_1015005392 139
166 3300005843 Ga0068860_102548788 Ga0068860_1025487881 139
167 3300009036 Ga0105244_10081857 Ga0105244_100818573 139
168 3300009553 Ga0105249_10545582 Ga0105249_105455822 139
169 3300011119 Ga0105246_10068470 Ga0105246_100684702 139
170 3300017792 Ga0163161_10206575 Ga0163161_102065752 139
171 3300025728 Ga0207655_1029962 Ga0207655_10299623 139
172 3300025933 Ga0207706_10200449 Ga0207706_102004493 139
173 3300026118 Ga0207675_100580454 Ga0207675_1005804541 139
174 3300028380 Ga0268265_10445037 Ga0268265_104450372 139
175 3300028380 Ga0268265_12463875 Ga0268265_124638751 139
176 3300041404 Ga0439436_0005775 Ga0439436_0005775_368_790 139
177 3300041406 Ga0439439_0000183 Ga0439439_0000183_4445_4867 139
178 3300041411 Ga0439466_0037527 Ga0439466_0037527_860_1279 139
179 3300041413 Ga0439465_0084573 Ga0439465_0084573_292_714 139
180 3300042007 Ga0439449_0047295 Ga0439449_0047295_455_877 139
181 3300042007 Ga0439449_0075714 Ga0439449_0075714_115_537 139
182 3300042009 Ga0439451_001554 Ga0439451_001554_1015_1434 139
183 3300042015 Ga0439462_0011180 Ga0439462_0011180_187_609 139
184 3300042016 Ga0439463_035599 Ga0439463_035599_502_921 139
185 3300042142 Ga0450905_006593 Ga0450905_006593_217_636 139
186 3300042435 Ga0439434_0161157 Ga0439434_0161157_295_717 139
187 3300042993 Ga0439440_0103491 Ga0439440_0103491_62_481 139
188 3300044658 Ga0466972_0573875 Ga0466972_0573875_68_487 139
189 3300044901 Ga0466960_0000645 Ga0466960_0000645_8246_8665 139
190 3300046460 Ga0495638_0205799 Ga0495638_0205799_163_582 139
191 3300046491 Ga0495584_0000002 Ga0495584_0000002_103658_104077 139
192 3300046491 Ga0495584_0000160 Ga0495584_0000160_38227_38646 139
193 3300046492 Ga0495585_0000398 Ga0495585_0000398_38352_38771 139
194 3300046492 Ga0495585_0265424 Ga0495585_0265424_183_602 139
195 3300046500 Ga0495596_0000659 Ga0495596_0000659_6352_6771 139
196 3300046506 Ga0495583_0103491 Ga0495583_0103491_21_440 139
197 3300046507 Ga0495606_0169698 Ga0495606_0169698_138_557 139
198 3300046512 Ga0495610_0063772 Ga0495610_0063772_879_1298 139
199 3300046513 Ga0495616_0000742 Ga0495616_0000742_15551_15970 139
200 3300046513 Ga0495616_0007412 Ga0495616_0007412_140_559 139
201 3300046515 Ga0495620_0223504 Ga0495620_0223504_278_697 139
202 3300046518 Ga0495631_0000940 Ga0495631_0000940_15315_15734 139
203 3300046522 Ga0495643_0049667 Ga0495643_0049667_227_646 139
204 3300046525 Ga0495663_0025042 Ga0495663_0025042_403_825 139
205 3300046530 Ga0495654_0002591 Ga0495654_0002591_2970_3389 139
206 3300046538 Ga0495609_0047627 Ga0495609_0047627_589_1008 139
207 3300046539 Ga0495621_0187795 Ga0495621_0187795_366_788 139
208 3300046558 Ga0495633_0001540 Ga0495633_0001540_17118_17537 139
209 3300046615 Ga0495656_0017716 Ga0495656_0017716_581_1003 139
210 3300046616 Ga0495668_0001376 Ga0495668_0001376_7516_7935 139
211 3300046616 Ga0495668_0067030 Ga0495668_0067030_386_805 139
212 3300046663 Ga0495635_0149442 Ga0495635_0149442_343_762 139
213 3300046674 Ga0495588_0181120 Ga0495588_0181120_558_977 139
214 3300046683 Ga0495658_0557489 Ga0495658_0557489_113_532 139
215 3300046690 Ga0495624_0281702 Ga0495624_0281702_55_474 139
216 3300047323 Ga0495683_0000342 Ga0495683_0000342_15980_16399 139
217 3300047443 Ga0495687_173108 Ga0495687_173108_32_451 139
218 3300047447 Ga0495685_140067 Ga0495685_140067_73_495 139
219 3300047470 Ga0495681_0238298 Ga0495681_0238298_240_659 139
220 3300048089 Ga0495614_0016354 Ga0495614_0016354_1706_2125 139
221 3300048920 Ga0496117_0292220 Ga0496117_0292220_198_617 139
222 3300048923 Ga0496120_0139618 Ga0496120_0139618_246_665 139
223 3300048924 Ga0496121_0255301 Ga0496121_0255301_279_698 139
224 3300048926 Ga0496123_0091230 Ga0496123_0091230_1279_1698 139
225 3300048929 Ga0496126_0229459 Ga0496126_0229459_109_528 139
226 3300048929 Ga0496126_0385790 Ga0496126_0385790_696_1118 139
227 3300049460 Ga0495682_0076445 Ga0495682_0076445_644_1063 139
228 3300049573 Ga0501037_0390769 Ga0501037_0390769_363_782 139
229 3300053093 Ga0500651_0000064 Ga0500651_0000064_25634_26053 139
230 3300053094 Ga0500566_0136978 Ga0500566_0136978_198_617 139
231 3300053107 Ga0500560_069537 Ga0500560_069537_152_571 139
232 3300053110 Ga0500571_000272 Ga0500571_000272_2758_3177 139
233 3300053118 Ga0500594_0003706 Ga0500594_0003706_638_1057 139
234 3300053120 Ga0500597_151301 Ga0500597_151301_399_818 139
235 3300053122 Ga0500608_104179 Ga0500608_104179_55_474 139
236 3300053123 Ga0500614_196718 Ga0500614_196718_155_574 139
237 3300053128 Ga0500626_023566 Ga0500626_023566_976_1395 139
238 3300053133 Ga0500655_002452 Ga0500655_002452_1386_1805 139
239 3300053134 Ga0500658_0000441 Ga0500658_0000441_16094_16513 139
240 3300053134 Ga0500658_0000480 Ga0500658_0000480_1290_1709 139
241 3300053136 Ga0500559_0009627 Ga0500559_0009627_897_1316 139
242 3300053138 Ga0500564_010950 Ga0500564_010950_836_1255 139
243 3300053139 Ga0500568_0005555 Ga0500568_0005555_3827_4246 139
244 3300053141 Ga0500574_036763 Ga0500574_036763_766_1185 139
245 3300053157 Ga0500624_064145 Ga0500624_064145_153_572 139
246 3300053158 Ga0500627_0105138 Ga0500627_0105138_540_959 139
247 3300053161 Ga0500634_0071680 Ga0500634_0071680_1192_1611 139
248 3300053162 Ga0500638_098335 Ga0500638_098335_925_1344 139
249 3300053177 Ga0500636_0076210 Ga0500636_0076210_309_728 139
250 3300005355 Ga0070671_100153425 Ga0070671_1001534253 140
251 3300005364 Ga0070673_100548552 Ga0070673_1005485522 140
252 3300014326 Ga0157380_12068028 Ga0157380_120680281 140
253 3300025925 Ga0207650_10225232 Ga0207650_102252323 140
254 3300025931 Ga0207644_10065976 Ga0207644_100659762 140
255 3300028380 Ga0268265_10430223 Ga0268265_104302231 140
256 3300044658 Ga0466972_0032683 Ga0466972_0032683_1034_1459 140
257 3300044765 Ga0466970_0028961 Ga0466970_0028961_1096_1521 140
258 3300046457 Ga0495590_0109656 Ga0495590_0109656_386_808 140
259 3300046506 Ga0495583_0000009 Ga0495583_0000009_265841_266263 140
260 3300047318 Ga0495636_0006691 Ga0495636_0006691_1256_1681 140
261 3300047443 Ga0495687_157328 Ga0495687_157328_101_523 140
262 3300048091 Ga0495626_0104346 Ga0495626_0104346_106_528 140
263 3300048904 Ga0496101_0055801 Ga0496101_0055801_1754_2179 140
264 3300048910 Ga0496107_0159903 Ga0496107_0159903_27_452 140
265 3300048913 Ga0496110_0068139 Ga0496110_0068139_658_1083 140
266 3300048914 Ga0496111_0699273 Ga0496111_0699273_242_667 140
267 iso_pu_bacteria 2643221651 2644291034 142
268 3300046615 Ga0495656_0022179 Ga0495656_0022179_1721_2161 144
269 3300046691 Ga0495670_0422266 Ga0495670_0422266_248_688 144
270 3300047318 Ga0495636_0064445 Ga0495636_0064445_740_1180 144
271 3300013306 Ga0163162_10365744 Ga0163162_103657442 146
272 3300014969 Ga0157376_11123966 Ga0157376_111239662 146
273 3300031239 Ga0265328_10304912 Ga0265328_103049121 146
274 3300012483 Ga0157337_1003796 Ga0157337_10037961 148
275 3300048903 Ga0496100_0272214 Ga0496100_0272214_422_901 148
276 3300048915 Ga0496112_1194262 Ga0496112_1194262_41_520 148
277 3300012512 Ga0157327_1000748 Ga0157327_10007482 150
278 3300046525 Ga0495663_0012190 Ga0495663_0012190_1854_2306 150
279 3300047318 Ga0495636_0068630 Ga0495636_0068630_351_803 150
280 3300044683 Ga0466965_0210946 Ga0466965_0210946_393_872 151
281 3300044684 Ga0466966_0031462 Ga0466966_0031462_632_1111 151
282 3300046615 Ga0495656_0096256 Ga0495656_0096256_626_1138 151
283 3300005293 Ga0065715_10175239 Ga0065715_101752392 153
284 3300046506 Ga0495583_0004711 Ga0495583_0004711_4283_4744 153
285 3300047318 Ga0495636_0003512 Ga0495636_0003512_5554_6015 153
286 3300047318 Ga0495636_0050969 Ga0495636_0050969_747_1208 153
287 3300048905 Ga0496102_0034070 Ga0496102_0034070_1205_1666 153
288 3300002737 JGI25162J39368_1001122 JGI25162J39368_100112216 156
289 3300002772 JGI25164J39214_1002229 JGI25164J39214_10022292 156
290 3300003214 JGI25165J46597_1004310 JGI25165J46597_10043103 156
291 3300003323 rootH1_10009456 rootH1_100094565 156
292 3300003323 rootH1_10015682 rootH1_100156824 156
293 3300025230 Ga0209563_116374 Ga0209563_1163742 156
294 3300025231 Ga0207427_100243 Ga0207427_10024315 156
295 3300025233 Ga0209437_100034 Ga0209437_100034370 156
296 3300025261 Ga0209233_1000038 Ga0209233_1000038370 156

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

69

168

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mh4-assembly1.cif.gz_B crystal structure of osmc-like protein from burkholderia cenocepacia j2315 0.9309 21 156
4mh4-assembly1.cif.gz_B crystal structure of osmc-like protein from burkholderia cenocepacia j2315 0.9181 21 156
6ecy-assembly1.cif.gz_A ohra (organic hydroperoxide resistance protein) wild type from chromobacterium violaceum 0.9147 20 156
6ebg-assembly2.cif.gz_C ohr (organic hydroperoxide resistance protein) mutant - c60s interacting with dihydrolipoamide 0.9085 21 156
6ebd-assembly2.cif.gz_D ohrb (organic hydroperoxide resistance protein) mutant (c60a) from chromobacterium violaceum, interacting with dihydrolipoamide 0.9077 21 156
ID Description Score Start End Superfamily
4xx2A02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9499 63 156 3.30.300.20
6mjnB02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9419 63 156 3.30.300.20
4xx2A02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9401 63 156 3.30.300.20
6mjnB02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9139 63 156 3.30.300.20
af_Q2G1T3_42_139_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9064 63 156 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A7X6EK14-F1-model_v4 deleted 0.9924 72 156
AF-A0A426SWX4-F1-model_v4 deleted 0.9884 65 156
AF-A0A699UET9-F1-model_v4 Organic hydroperoxide resistance protein 0.9884 89 156 GO:0006979
AF-A0A0P9ULJ2-F1-model_v4 Organic hydroperoxide resistance protein 0.9839 62 156 GO:0006979
AF-A0A7X6EK14-F1-model_v4 deleted 0.9809 72 156

Feature Viewer

pLDDT pTM Quality
90.46 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map