F393288

General Info

Members Datasets Scaffolds Average Seq Length
296 224 592 66

Family's Representative Sequence

Representative Sequence 3300035725|Ga0373947_0341990|Ga0373947_0341990_315_524
Length 69
Sequence MKMSACTQESMINHHGSGFLADLRETLHVWRERQDRRRQLAELSERDLHDVGLSWRDVAFEAEKAFWRA

Samples

Sample ID Description Type Environment
1 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
43 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
44 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
45 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
100 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
101 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
102 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
108 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
109 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
110 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
113 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
114 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
118 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
119 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
120 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
121 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
123 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
124 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
127 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
128 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
129 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
130 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
131 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
134 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
135 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
136 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
137 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
138 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
139 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
140 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
141 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
142 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
143 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
144 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
145 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
146 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
147 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
148 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
149 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
150 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
151 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
152 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
153 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
154 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
162 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
163 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
164 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
165 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
166 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
167 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
170 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
173 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
174 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
175 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
176 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
177 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
178 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
179 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
180 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
181 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
182 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
183 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
184 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
185 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
186 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
187 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
188 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
189 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
190 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
191 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
192 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
193 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
194 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
195 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
196 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
197 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
198 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
199 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
200 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
201 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
202 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
203 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
204 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
205 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
206 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
207 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
208 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
209 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
210 2904699407
211 2906610324
212 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
213 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
214 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
215 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
216 2922425934
217 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
218 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
219 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
220 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
221 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
222 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
223 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
224 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.76
Metatranscriptomes 2.39
Isolates 7.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.18
Nodule 8.11
Rhizoplane 4.05
Rhizosphere 66.55
Stem 0
Stem Tuber 0
Unclassified 4.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373947_0341990 3300035725 Unclassified 1003
2 LJQas_1040146 3300000549 Bacteria 554
3 JGI25153J46596_10052439 3300003215 Bacteria 1161
4 Ga0070658_10204476 3300005327 Bacteria 1667
5 Ga0070683_102243598 3300005329 Bacteria 524
6 Ga0070682_100670862 3300005337 Bacteria 828
7 Ga0070682_100944486 3300005337 Bacteria 712
8 Ga0070660_100320065 3300005339 Bacteria 1274
9 Ga0070691_10258291 3300005341 Bacteria 937
10 Ga0070661_100317216 3300005344 Bacteria 1217
11 Ga0070692_10288654 3300005345 Bacteria 997
12 Ga0070714_101204434 3300005435 Bacteria 739
13 Ga0070713_100215821 3300005436 Bacteria 1739
14 Ga0070710_10171216 3300005437 Bacteria 1353
15 Ga0070711_100007696 3300005439 Bacteria 6560
16 Ga0070663_100034886 3300005455 Bacteria 3487
17 Ga0070663_100414871 3300005455 Bacteria 1103
18 Ga0070678_100994167 3300005456 Bacteria 771
19 Ga0070681_10042018 3300005458 Bacteria 4583
20 Ga0070681_11343849 3300005458 Bacteria 638
21 Ga0070679_100452462 3300005530 Bacteria 1229
22 Ga0070679_100882520 3300005530 Bacteria 838
23 Ga0070684_101243030 3300005535 Bacteria 701
24 Ga0070697_100015057 3300005536 Bacteria 6071
25 Ga0068853_101030391 3300005539 Bacteria 793
26 Ga0070665_101154607 3300005548 Bacteria 786
27 Ga0068855_100461005 3300005563 Bacteria 1386
28 Ga0068852_101649103 3300005616 Bacteria 664
29 Ga0068852_102044859 3300005616 Bacteria 595
30 Ga0068859_101459484 3300005617 Bacteria 755
31 Ga0068864_101108858 3300005618 Bacteria 788
32 Ga0068861_100846113 3300005719 Bacteria 862
33 Ga0068858_101079084 3300005842 Bacteria 788
34 Ga0068860_100002627 3300005843 Bacteria 18684
35 Ga0081538_10075406 3300005981 Bacteria 1830
36 Ga0070717_10784405 3300006028 Bacteria 867
37 Ga0070717_10889262 3300006028 Bacteria 811
38 Ga0070717_11827717 3300006028 Bacteria 549
39 Ga0075365_10065209 3300006038 Bacteria 2440
40 Ga0075368_10077312 3300006042 Bacteria 1351
41 Ga0075363_100026436 3300006048 Bacteria 2969
42 Ga0075364_10048467 3300006051 Bacteria 2768
43 Ga0070715_10611700 3300006163 Bacteria 640
44 Ga0070712_101722356 3300006175 Bacteria 549
45 Ga0075367_10071460 3300006178 Bacteria 2087
46 Ga0075367_10244029 3300006178 Bacteria 1126
47 Ga0075366_10083196 3300006195 Bacteria 1913
48 Ga0068871_100954538 3300006358 Bacteria 797
49 Ga0097620_101459442 3300006931 Bacteria 755
50 Ga0099822_1010547 3300006943 Bacteria 11443
51 Ga0099794_10011910 3300007265 Bacteria 3738
52 Ga0099794_10044220 3300007265 Bacteria 2128
53 Ga0099794_10053105 3300007265 Bacteria 1954
54 Ga0099794_10096751 3300007265 Bacteria 1470
55 Ga0099794_10129666 3300007265 Bacteria 1273
56 Ga0099794_10187117 3300007265 Bacteria 1058
57 Ga0099795_10016146 3300007788 Bacteria 2355
58 Ga0099795_10260009 3300007788 Bacteria 751
59 Ga0105250_10449001 3300009092 Bacteria 578
60 Ga0105240_10979036 3300009093 Bacteria 906
61 Ga0105240_12195129 3300009093 Bacteria 572
62 Ga0105247_10067368 3300009101 Bacteria 2230
63 Ga0105247_10138977 3300009101 Bacteria 1590
64 Ga0105241_11770628 3300009174 Bacteria 602
65 Ga0105241_11886158 3300009174 Bacteria 585
66 Ga0105248_11629534 3300009177 Bacteria 731
67 Ga0105248_13308047 3300009177 Unclassified 512
68 Ga0105237_10089992 3300009545 Bacteria 3059
69 Ga0105237_10318625 3300009545 Bacteria 1558
70 Ga0105237_10481652 3300009545 Bacteria 1247
71 Ga0105237_10706659 3300009545 Bacteria 1015
72 Ga0105238_10550059 3300009551 Bacteria 1158
73 Ga0105249_11780427 3300009553 Bacteria 688
74 Ga0099796_10006389 3300010159 Bacteria 3012
75 Ga0099796_10154275 3300010159 Bacteria 906
76 Ga0099796_10507378 3300010159 Bacteria 540
77 Ga0105239_10277349 3300010375 Bacteria 1887
78 Ga0105239_10362958 3300010375 Bacteria 1636
79 Ga0105239_10620156 3300010375 Bacteria 1234
80 Ga0105239_11162106 3300010375 Bacteria 889
81 Ga0105246_10821456 3300011119 Bacteria 826
82 Ga0157369_10008387 3300013105 Bacteria 11853
83 Ga0157369_10209646 3300013105 Bacteria 2043
84 Ga0157378_11961178 3300013297 Bacteria 635
85 Ga0163162_10589359 3300013306 Bacteria 1238
86 Ga0163162_12156979 3300013306 Bacteria 639
87 Ga0157372_10145006 3300013307 Bacteria 2738
88 Ga0157372_12961152 3300013307 Bacteria 543
89 Ga0157375_12455897 3300013308 Bacteria 622
90 Ga0157380_11738727 3300014326 Bacteria 682
91 Ga0157379_12142420 3300014968 Bacteria 555
92 Ga0157376_11368798 3300014969 Bacteria 739
93 Ga0157376_11989045 3300014969 Bacteria 619
94 Ga0197907_10524309 3300020069 Bacteria 533
95 Ga0206356_11554274 3300020070 Bacteria 1325
96 Ga0206350_10635489 3300020080 Unclassified 577
97 Ga0206350_10829716 3300020080 Bacteria 553
98 Ga0206350_11158932 3300020080 Bacteria 809
99 Ga0206354_10518427 3300020081 Bacteria 1095
100 Ga0224712_10112869 3300022467 Bacteria 1168
101 Ga0209758_1004632 3300025297 Bacteria 11268
102 Ga0207692_10058883 3300025898 Bacteria 1981
103 Ga0207692_10614848 3300025898 Bacteria 700
104 Ga0207647_10179370 3300025904 Bacteria 1231
105 Ga0207647_10559795 3300025904 Bacteria 633
106 Ga0207685_10126620 3300025905 Bacteria 1128
107 Ga0207699_10225498 3300025906 Bacteria 1281
108 Ga0207705_10283578 3300025909 Bacteria 1268
109 Ga0207684_10635074 3300025910 Bacteria 910
110 Ga0207707_10110079 3300025912 Bacteria 2407
111 Ga0207707_11073593 3300025912 Bacteria 657
112 Ga0207707_11183684 3300025912 Bacteria 619
113 Ga0207695_10110135 3300025913 Bacteria 2734
114 Ga0207671_10033210 3300025914 Bacteria 3839
115 Ga0207671_10728889 3300025914 Bacteria 788
116 Ga0207693_10024092 3300025915 Bacteria 4832
117 Ga0207663_10042076 3300025916 Bacteria 2789
118 Ga0207657_10270355 3300025919 Bacteria 1351
119 Ga0207652_10635670 3300025921 Bacteria 955
120 Ga0207652_10759247 3300025921 Bacteria 863
121 Ga0207652_11090008 3300025921 Unclassified 699
122 Ga0207694_10884302 3300025924 Bacteria 755
123 Ga0207700_10165544 3300025928 Bacteria 1840
124 Ga0207700_10295518 3300025928 Bacteria 1397
125 Ga0207644_11285266 3300025931 Bacteria 615
126 Ga0207686_10800662 3300025934 Bacteria 755
127 Ga0207669_10395203 3300025937 Bacteria 1081
128 Ga0207704_10509579 3300025938 Bacteria 971
129 Ga0207665_10071067 3300025939 Bacteria 2375
130 Ga0207665_11360127 3300025939 Bacteria 566
131 Ga0207661_11541800 3300025944 Bacteria 609
132 Ga0207667_10376161 3300025949 Bacteria 1447
133 Ga0207668_10825490 3300025972 Bacteria 822
134 Ga0207639_10582110 3300026041 Bacteria 1030
135 Ga0207678_10083304 3300026067 Bacteria 2735
136 Ga0207678_10130125 3300026067 Bacteria 2147
137 Ga0207702_10001100 3300026078 Bacteria 27642
138 Ga0207702_10305969 3300026078 Bacteria 1510
139 Ga0207641_11482023 3300026088 Bacteria 680
140 Ga0207676_11279799 3300026095 Bacteria 728
141 Ga0207683_10405044 3300026121 Bacteria 1255
142 Ga0209589_1000015 3300027357 Bacteria 225913
143 Ga0209489_100015 3300027361 Bacteria 225913
144 Ga0209700_100025 3300027363 Bacteria 225913
145 Ga0209179_1008830 3300027512 Bacteria 1711
146 Ga0209179_1026245 3300027512 Bacteria 1168
147 Ga0209179_1148935 3300027512 Bacteria 523
148 Ga0209588_1004158 3300027671 Bacteria 4061
149 Ga0209588_1022441 3300027671 Bacteria 1985
150 Ga0209588_1058448 3300027671 Bacteria 1246
151 Ga0209588_1213210 3300027671 Bacteria 599
152 Ga0209813_10216213 3300027866 Unclassified 716
153 Ga0268266_11086499 3300028379 Bacteria 774
154 Ga0268264_10000073 3300028381 Bacteria 260615
155 Ga0268264_12185103 3300028381 Bacteria 561
156 Ga0265340_10171051 3300031247 Bacteria 984
157 Ga0265339_10006769 3300031249 Bacteria 7478
158 Ga0265316_11308449 3300031344 Bacteria 500
159 Ga0307509_10081238 3300031507 Bacteria 3349
160 Ga0307408_100138892 3300031548 Bacteria 1905
161 Ga0265314_10004832 3300031711 Bacteria 12326
162 Ga0265342_10121090 3300031712 Bacteria 1473
163 Ga0307406_11649302 3300031901 Unclassified 567
164 Ga0307406_11935613 3300031901 Unclassified 526
165 Ga0307412_11200874 3300031911 Unclassified 679
166 Ga0307416_100577799 3300032002 Bacteria 1201
167 Ga0307411_11413665 3300032005 Bacteria 637
168 Ga0315911_1000021 3300033442 Bacteria 124874
169 Ga0373926_0078416 3300035083 Bacteria 1219
170 Ga0373944_0014980 3300035089 Bacteria 2171
171 Ga0373923_0022124 3300035111 Bacteria 2489
172 Ga0373945_0149709 3300035116 Bacteria 945
173 Ga0373935_1253650 3300035692 Bacteria 553
174 Ga0373927_0013784 3300035695 Bacteria 5365
175 Ga0373947_0005836 3300035725 Bacteria 7175
176 Ga0373947_0496284 3300035725 Bacteria 829
177 Ga0395898_1177563 3300037466 Bacteria 698
178 Ga0436365_0079568 3300039437 Bacteria 1689
179 Ga0436360_0221672 3300039438 Bacteria 1743
180 Ga0436363_0593094 3300039450 Bacteria 1415
181 Ga0436363_0910317 3300039450 Bacteria 1718
182 Ga0451800_0968244 3300041459 Bacteria 651
183 Ga0451804_1074604 3300041463 Bacteria 664
184 Ga0466963_0010645 3300044694 Bacteria 5578
185 Ga0466967_0010521 3300045976 Bacteria 6947
186 Ga0495592_0140257 3300046454 Bacteria 1682
187 Ga0495603_0410460 3300046455 Unclassified 776
188 Ga0495580_0865502 3300046472 Bacteria 583
189 Ga0495582_0143275 3300046473 Unclassified 1355
190 Ga0495639_0160845 3300046475 Unclassified 1087
191 Ga0495664_0205150 3300046477 Bacteria 1194
192 Ga0495594_0100888 3300046499 Unclassified 1624
193 Ga0495606_0296531 3300046507 Bacteria 878
194 Ga0495628_0089107 3300046516 Bacteria 2390
195 Ga0495628_0128980 3300046516 Bacteria 1936
196 Ga0495630_0323282 3300046517 Bacteria 1179
197 Ga0495630_1016027 3300046517 Bacteria 630
198 Ga0495648_0012261 3300046524 Bacteria 6403
199 Ga0495652_0253140 3300046529 Bacteria 1304
200 Ga0495645_0307467 3300046543 Bacteria 1033
201 Ga0495622_0023744 3300046557 Bacteria 2860
202 Ga0495657_0326555 3300046675 Bacteria 911
203 Ga0495624_0182347 3300046690 Bacteria 1279
204 Ga0495600_0458266 3300046809 Bacteria 788
205 Ga0495581_0160937 3300047315 Unclassified 1312
206 Ga0495604_0893248 3300047317 Bacteria 555
207 Ga0495674_0400170 3300047319 Bacteria 1108
208 Ga0495674_1018074 3300047319 Bacteria 634
209 Ga0495684_0026719 3300047471 Bacteria 4436
210 Ga0496100_0267261 3300048903 Bacteria 1270
211 Ga0496102_0366497 3300048905 Bacteria 1356
212 Ga0496102_1302440 3300048905 Bacteria 646
213 Ga0496103_0990943 3300048906 Bacteria 524
214 Ga0496106_0126038 3300048909 Bacteria 2005
215 Ga0496107_0508622 3300048910 Bacteria 893
216 Ga0496112_0000169 3300048915 Bacteria 41507
217 Ga0496114_0198696 3300048917 Bacteria 1756
218 Ga0496115_0233528 3300048918 Bacteria 1516
219 Ga0496118_0288731 3300048921 Bacteria 908
220 Ga0496118_0625397 3300048921 Bacteria 511
221 Ga0496119_0051808 3300048922 Bacteria 2519
222 Ga0496119_0150640 3300048922 Bacteria 1247
223 Ga0496121_0008571 3300048924 Bacteria 11978
224 Ga0496121_0088108 3300048924 Bacteria 2434
225 Ga0496121_0303355 3300048924 Bacteria 1083
226 Ga0496121_0430935 3300048924 Bacteria 855
227 Ga0496122_0037141 3300048925 Bacteria 3927
228 Ga0496126_0028324 3300048929 Bacteria 5340
229 Ga0496126_0261929 3300048929 Bacteria 1437
230 Ga0496126_0315571 3300048929 Bacteria 1286
231 Ga0496126_0329434 3300048929 Bacteria 1253
232 Ga0496126_0442547 3300048929 Bacteria 1047
233 Ga0501037_0000041 3300049573 Bacteria 118457
234 Ga0501047_0149599 3300049581 Bacteria 2211
235 Ga0501070_0023752 3300049586 Bacteria 5138
236 Ga0501073_0079606 3300049589 Bacteria 2280
237 Ga0501080_0007219 3300049742 Bacteria 10030
238 Ga0501044_0046571 3300049823 Bacteria 4489
239 nmdc:mga03683_100987_c1 3300050489 Bacteria 1268
240 nmdc:mga03n38_320838_c1 3300050490 Bacteria 836
241 nmdc:mga00v17_235463_c1 3300050491 Bacteria 1187
242 nmdc:mga00v17_42596_c1 3300050491 Bacteria 2731
243 nmdc:mga0yw44_33114_c1 3300050492 Bacteria 3017
244 nmdc:mga0yw44_383471_c1 3300050492 Bacteria 949
245 nmdc:mga0k408_213276_c1 3300050493 Bacteria 1153
246 nmdc:mga06z11_216414_c1 3300050494 Bacteria 1118
247 nmdc:mga06z11_340763_c1 3300050494 Bacteria 896
248 nmdc:mga04h51_33536_c1 3300050495 Bacteria 1635
249 nmdc:mga07m45_458668_c1 3300050496 Bacteria 739
250 Ga0495601_0275216 3300053077 Bacteria 1098
251 Ga0495612_0044409 3300053078 Bacteria 1818
252 Ga0500635_0111523 3300053080 Bacteria 1016
253 Ga0495655_0098451 3300053083 Bacteria 863
254 Ga0500647_0343353 3300053091 Bacteria 624
255 Ga0500648_076482 3300053097 Bacteria 1889
256 Ga0500595_002282 3300053119 Bacteria 9644
257 Ga0500595_003385 3300053119 Bacteria 7469
258 Ga0500608_257113 3300053122 Bacteria 677
259 Ga0500559_0043688 3300053136 Bacteria 1958
260 Ga0500568_0038637 3300053139 Bacteria 1931
261 Ga0500573_0012139 3300053140 Bacteria 4833
262 Ga0500590_068001 3300053148 Bacteria 1776
263 Ga0500590_141106 3300053148 Bacteria 1101
264 Ga0500619_097763 3300053154 Bacteria 995
265 Ga0500639_260607 3300053163 Bacteria 686
266 Ga0500636_0123690 3300053177 Bacteria 1448
267 Ga0500636_0246959 3300053177 Bacteria 912
268 Ga0500570_126968 3300053724 Bacteria 981
269 Ga0500609_012874 3300053731 Bacteria 1132
270 Ga0500596_007512 3300053735 Bacteria 1783
271 2513659836 2513237096 Bacteria 8722461
272 2513857294 2513237137 Bacteria 9558895
273 2513918912 2513237145 Bacteria 8979722
274 2517888238 2517572143 Bacteria 9484767
275 2524533414 2524023228 Bacteria 10118060
276 2671123417 2667528175 Bacteria 7532676
277 2728753896 2728368998 Bacteria 8720350
278 2793073939 2791355197 Bacteria 8420563
279 2885375698 2885374607 Bacteria 8927485
280 2903757647 2903748898 Bacteria 9972761
281 2904692343 2904690495 Bacteria 9412302
282 2904709837
283 2906614404
284 2906638076 2906635258 Bacteria 8601019
285 2906666661 2906660503 Bacteria 8595048
286 2908746769 2908739725 Bacteria 8628932
287 2908764337 2908756301 Bacteria 8864324
288 2922426234
289 2935632628 2935630451 Bacteria 8169952
290 2941508708 2941507105 Bacteria 8166816
291 2941516538 2941515067 Bacteria 8166720
292 2941524446 2941523033 Bacteria 8169134
293 3005475604 3005474847 Bacteria 9259049
294 8019561742 8019555841 Bacteria 9642137
295 8019571812 8019565922 Bacteria 9639779
296 8056690874 8056689827 Bacteria 6712655
297 Ga0373947_0341990
298 LJQas_1040146
299 JGI25153J46596_10052439
300 Ga0070658_10204476
301 Ga0070683_102243598
302 Ga0070682_100670862
303 Ga0070682_100944486
304 Ga0070660_100320065
305 Ga0070691_10258291
306 Ga0070661_100317216
307 Ga0070692_10288654
308 Ga0070714_101204434
309 Ga0070713_100215821
310 Ga0070710_10171216
311 Ga0070711_100007696
312 Ga0070663_100034886
313 Ga0070663_100414871
314 Ga0070678_100994167
315 Ga0070681_10042018
316 Ga0070681_11343849
317 Ga0070679_100452462
318 Ga0070679_100882520
319 Ga0070684_101243030
320 Ga0070697_100015057
321 Ga0068853_101030391
322 Ga0070665_101154607
323 Ga0068855_100461005
324 Ga0068852_101649103
325 Ga0068852_102044859
326 Ga0068859_101459484
327 Ga0068864_101108858
328 Ga0068861_100846113
329 Ga0068858_101079084
330 Ga0068860_100002627
331 Ga0081538_10075406
332 Ga0070717_10784405
333 Ga0070717_10889262
334 Ga0070717_11827717
335 Ga0075365_10065209
336 Ga0075368_10077312
337 Ga0075363_100026436
338 Ga0075364_10048467
339 Ga0070715_10611700
340 Ga0070712_101722356
341 Ga0075367_10071460
342 Ga0075367_10244029
343 Ga0075366_10083196
344 Ga0068871_100954538
345 Ga0097620_101459442
346 Ga0099822_1010547
347 Ga0099794_10011910
348 Ga0099794_10044220
349 Ga0099794_10053105
350 Ga0099794_10096751
351 Ga0099794_10129666
352 Ga0099794_10187117
353 Ga0099795_10016146
354 Ga0099795_10260009
355 Ga0105250_10449001
356 Ga0105240_10979036
357 Ga0105240_12195129
358 Ga0105247_10067368
359 Ga0105247_10138977
360 Ga0105241_11770628
361 Ga0105241_11886158
362 Ga0105248_11629534
363 Ga0105248_13308047
364 Ga0105237_10089992
365 Ga0105237_10318625
366 Ga0105237_10481652
367 Ga0105237_10706659
368 Ga0105238_10550059
369 Ga0105249_11780427
370 Ga0099796_10006389
371 Ga0099796_10154275
372 Ga0099796_10507378
373 Ga0105239_10277349
374 Ga0105239_10362958
375 Ga0105239_10620156
376 Ga0105239_11162106
377 Ga0105246_10821456
378 Ga0157369_10008387
379 Ga0157369_10209646
380 Ga0157378_11961178
381 Ga0163162_10589359
382 Ga0163162_12156979
383 Ga0157372_10145006
384 Ga0157372_12961152
385 Ga0157375_12455897
386 Ga0157380_11738727
387 Ga0157379_12142420
388 Ga0157376_11368798
389 Ga0157376_11989045
390 Ga0197907_10524309
391 Ga0206356_11554274
392 Ga0206350_10635489
393 Ga0206350_10829716
394 Ga0206350_11158932
395 Ga0206354_10518427
396 Ga0224712_10112869
397 Ga0209758_1004632
398 Ga0207692_10058883
399 Ga0207692_10614848
400 Ga0207647_10179370
401 Ga0207647_10559795
402 Ga0207685_10126620
403 Ga0207699_10225498
404 Ga0207705_10283578
405 Ga0207684_10635074
406 Ga0207707_10110079
407 Ga0207707_11073593
408 Ga0207707_11183684
409 Ga0207695_10110135
410 Ga0207671_10033210
411 Ga0207671_10728889
412 Ga0207693_10024092
413 Ga0207663_10042076
414 Ga0207657_10270355
415 Ga0207652_10635670
416 Ga0207652_10759247
417 Ga0207652_11090008
418 Ga0207694_10884302
419 Ga0207700_10165544
420 Ga0207700_10295518
421 Ga0207644_11285266
422 Ga0207686_10800662
423 Ga0207669_10395203
424 Ga0207704_10509579
425 Ga0207665_10071067
426 Ga0207665_11360127
427 Ga0207661_11541800
428 Ga0207667_10376161
429 Ga0207668_10825490
430 Ga0207639_10582110
431 Ga0207678_10083304
432 Ga0207678_10130125
433 Ga0207702_10001100
434 Ga0207702_10305969
435 Ga0207641_11482023
436 Ga0207676_11279799
437 Ga0207683_10405044
438 Ga0209589_1000015
439 Ga0209489_100015
440 Ga0209700_100025
441 Ga0209179_1008830
442 Ga0209179_1026245
443 Ga0209179_1148935
444 Ga0209588_1004158
445 Ga0209588_1022441
446 Ga0209588_1058448
447 Ga0209588_1213210
448 Ga0209813_10216213
449 Ga0268266_11086499
450 Ga0268264_10000073
451 Ga0268264_12185103
452 Ga0265340_10171051
453 Ga0265339_10006769
454 Ga0265316_11308449
455 Ga0307509_10081238
456 Ga0307408_100138892
457 Ga0265314_10004832
458 Ga0265342_10121090
459 Ga0307406_11649302
460 Ga0307406_11935613
461 Ga0307412_11200874
462 Ga0307416_100577799
463 Ga0307411_11413665
464 Ga0315911_1000021
465 Ga0373926_0078416
466 Ga0373944_0014980
467 Ga0373923_0022124
468 Ga0373945_0149709
469 Ga0373935_1253650
470 Ga0373927_0013784
471 Ga0373947_0005836
472 Ga0373947_0496284
473 Ga0395898_1177563
474 Ga0436365_0079568
475 Ga0436360_0221672
476 Ga0436363_0593094
477 Ga0436363_0910317
478 Ga0451800_0968244
479 Ga0451804_1074604
480 Ga0466963_0010645
481 Ga0466967_0010521
482 Ga0495592_0140257
483 Ga0495603_0410460
484 Ga0495580_0865502
485 Ga0495582_0143275
486 Ga0495639_0160845
487 Ga0495664_0205150
488 Ga0495594_0100888
489 Ga0495606_0296531
490 Ga0495628_0089107
491 Ga0495628_0128980
492 Ga0495630_0323282
493 Ga0495630_1016027
494 Ga0495648_0012261
495 Ga0495652_0253140
496 Ga0495645_0307467
497 Ga0495622_0023744
498 Ga0495657_0326555
499 Ga0495624_0182347
500 Ga0495600_0458266
501 Ga0495581_0160937
502 Ga0495604_0893248
503 Ga0495674_0400170
504 Ga0495674_1018074
505 Ga0495684_0026719
506 Ga0496100_0267261
507 Ga0496102_0366497
508 Ga0496102_1302440
509 Ga0496103_0990943
510 Ga0496106_0126038
511 Ga0496107_0508622
512 Ga0496112_0000169
513 Ga0496114_0198696
514 Ga0496115_0233528
515 Ga0496118_0288731
516 Ga0496118_0625397
517 Ga0496119_0051808
518 Ga0496119_0150640
519 Ga0496121_0008571
520 Ga0496121_0088108
521 Ga0496121_0303355
522 Ga0496121_0430935
523 Ga0496122_0037141
524 Ga0496126_0028324
525 Ga0496126_0261929
526 Ga0496126_0315571
527 Ga0496126_0329434
528 Ga0496126_0442547
529 Ga0501037_0000041
530 Ga0501047_0149599
531 Ga0501070_0023752
532 Ga0501073_0079606
533 Ga0501080_0007219
534 Ga0501044_0046571
535 nmdc:mga03683_100987_c1
536 nmdc:mga03n38_320838_c1
537 nmdc:mga00v17_235463_c1
538 nmdc:mga00v17_42596_c1
539 nmdc:mga0yw44_33114_c1
540 nmdc:mga0yw44_383471_c1
541 nmdc:mga0k408_213276_c1
542 nmdc:mga06z11_216414_c1
543 nmdc:mga06z11_340763_c1
544 nmdc:mga04h51_33536_c1
545 nmdc:mga07m45_458668_c1
546 Ga0495601_0275216
547 Ga0495612_0044409
548 Ga0500635_0111523
549 Ga0495655_0098451
550 Ga0500647_0343353
551 Ga0500648_076482
552 Ga0500595_002282
553 Ga0500595_003385
554 Ga0500608_257113
555 Ga0500559_0043688
556 Ga0500568_0038637
557 Ga0500573_0012139
558 Ga0500590_068001
559 Ga0500590_141106
560 Ga0500619_097763
561 Ga0500639_260607
562 Ga0500636_0123690
563 Ga0500636_0246959
564 Ga0500570_126968
565 Ga0500609_012874
566 Ga0500596_007512
567 2513659836
568 2513857294
569 2513918912
570 2517888238
571 2524533414
572 2671123417
573 2728753896
574 2793073939
575 2885375698
576 2903757647
577 2904692343
578 2904709837
579 2906614404
580 2906638076
581 2906666661
582 2908746769
583 2908764337
584 2922426234
585 2935632628
586 2941508708
587 2941516538
588 2941524446
589 3005475604
590 8019561742
591 8019571812
592 8056690874

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06568

DUF1127

Domain of unknown function (DUF1127)

23

59

0.95

Map