F393215

General Info

Members Datasets Scaffolds Average Seq Length
296 117 570 196

Family's Representative Sequence

Representative Sequence 3300025906|Ga0207699_10333207|Ga0207699_103332071
Length 232
Sequence VSVIKRDENKHTYADYLIWSRTYGDELVDGTAYVREPPSPSWSHQMIVGEVYRQLAAALEDRSSQVVSAPLDVRLPKSTQEDDQIDTVVQPDVLIVCDPQKIDTRGVCGAPDWLAEVLSPGTTTHDQRVKLPAYERAGVREVWLISPVERTVAIYRLEAGRYGRATVLELKGKTQLTAVPDVTVDFRCHLLATNHGATWSGRLRGDSTWARAAVTVYDWFKSQDLRGCQLTK

Samples

Sample ID Description Type Environment
1 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
35 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
78 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
81 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
82 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
83 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
84 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
85 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
86 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
87 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
88 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
89 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
90 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
91 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
92 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
93 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
94 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
95 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
96 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
97 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
98 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
99 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
100 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
101 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
102 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
103 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
104 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
105 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
106 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
107 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
108 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
109 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
110 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
111 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
112 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
113 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
114 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
115 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
116 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
117 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.03
Nodule 0
Rhizoplane 1.01
Rhizosphere 80.07
Stem 0
Stem Tuber 0
Unclassified 28.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207699_10333207 3300025906 Bacteria 1067
2 rootH1_10101488 3300003323 Bacteria 6264
3 Ga0070658_10185658 3300005327 Unclassified 1751
4 Ga0070683_100012763 3300005329 Bacteria 7307
5 Ga0070683_100124500 3300005329 Bacteria 2436
6 Ga0070683_101266420 3300005329 Unclassified 709
7 Ga0070666_10044444 3300005335 Bacteria 2975
8 Ga0070680_100031942 3300005336 Unclassified 4234
9 Ga0070680_100086211 3300005336 Bacteria 2596
10 Ga0070689_100730070 3300005340 Unclassified 867
11 Ga0070661_100421718 3300005344 Unclassified 1058
12 Ga0070671_100024465 3300005355 Bacteria 4943
13 Ga0070667_100016610 3300005367 Bacteria 6091
14 Ga0070667_100127866 3300005367 Bacteria 2216
15 Ga0070667_100265585 3300005367 Unclassified 1538
16 Ga0070709_10330230 3300005434 Unclassified 1122
17 Ga0070713_100013918 3300005436 Bacteria 5957
18 Ga0070713_100038049 3300005436 Unclassified 3895
19 Ga0070713_100509710 3300005436 Bacteria 1136
20 Ga0070713_101051439 3300005436 Unclassified 786
21 Ga0070710_10095226 3300005437 Bacteria 1763
22 Ga0070663_100281803 3300005455 Unclassified 1325
23 Ga0070681_10276091 3300005458 Bacteria 1592
24 Ga0070681_10361982 3300005458 Bacteria 1361
25 Ga0070679_100085446 3300005530 Bacteria 3143
26 Ga0070679_100109303 3300005530 Bacteria 2751
27 Ga0070684_100025634 3300005535 Bacteria 4960
28 Ga0070684_100026195 3300005535 Unclassified 4910
29 Ga0070684_100252242 3300005535 Bacteria 1613
30 Ga0070684_101194104 3300005535 Unclassified 715
31 Ga0068853_100174236 3300005539 Bacteria 1948
32 Ga0070665_100000780 3300005548 Bacteria 41940
33 Ga0070665_100024922 3300005548 Bacteria 6029
34 Ga0070665_100079573 3300005548 Bacteria 3283
35 Ga0070665_100121966 3300005548 Bacteria 2608
36 Ga0070665_100326995 3300005548 Unclassified 1537
37 Ga0070665_100635424 3300005548 Bacteria 1081
38 Ga0068855_100006388 3300005563 Bacteria 14358
39 Ga0068855_100010640 3300005563 Bacteria 11095
40 Ga0068855_100324438 3300005563 Unclassified 1701
41 Ga0068855_100856981 3300005563 Bacteria 962
42 Ga0068855_101460074 3300005563 Unclassified 703
43 Ga0070664_100746545 3300005564 Bacteria 913
44 Ga0068854_100729552 3300005578 Bacteria 858
45 Ga0068856_100900216 3300005614 Unclassified 904
46 Ga0068852_100492929 3300005616 Bacteria 1219
47 Ga0068852_100851814 3300005616 Unclassified 927
48 Ga0068859_100008064 3300005617 Bacteria 10678
49 Ga0068861_100222558 3300005719 Unclassified 1596
50 Ga0068863_100010829 3300005841 Bacteria 8842
51 Ga0068863_101149999 3300005841 Unclassified 781
52 Ga0068858_100003122 3300005842 Bacteria 16586
53 Ga0068858_100006536 3300005842 Bacteria 11337
54 Ga0068858_100241882 3300005842 Bacteria 1713
55 Ga0068860_100037293 3300005843 Bacteria 4653
56 Ga0068862_100164204 3300005844 Bacteria 1984
57 Ga0097621_100077707 3300006237 Bacteria 2756
58 Ga0068871_100059458 3300006358 Bacteria 3114
59 Ga0097620_100008063 3300006931 Bacteria 10678
60 Ga0099795_10168945 3300007788 Unclassified 907
61 Ga0105250_10028227 3300009092 Bacteria 2261
62 Ga0105250_10069083 3300009092 Unclassified 1426
63 Ga0105240_10002224 3300009093 Bacteria 31569
64 Ga0105240_10012717 3300009093 Bacteria 11601
65 Ga0105240_10020670 3300009093 Bacteria 8774
66 Ga0105240_10027045 3300009093 Bacteria 7519
67 Ga0105240_10045709 3300009093 Bacteria 5553
68 Ga0105240_10081785 3300009093 Bacteria 3967
69 Ga0105240_10090820 3300009093 Bacteria 3732
70 Ga0105240_10120417 3300009093 Bacteria 3161
71 Ga0105240_10224918 3300009093 Bacteria 2184
72 Ga0105240_10309557 3300009093 Bacteria 1804
73 Ga0105240_10456723 3300009093 Bacteria 1428
74 Ga0105240_10607593 3300009093 Bacteria 1203
75 Ga0105245_10792021 3300009098 Bacteria 986
76 Ga0105247_10006672 3300009101 Bacteria 7125
77 Ga0105247_10091143 3300009101 Unclassified 1935
78 Ga0105247_10611089 3300009101 Bacteria 810
79 Ga0105241_10468712 3300009174 Bacteria 1117
80 Ga0105242_11314914 3300009176 Bacteria 747
81 Ga0105248_10141217 3300009177 Bacteria 2717
82 Ga0105248_10388075 3300009177 Unclassified 1572
83 Ga0105237_10011290 3300009545 Bacteria 9452
84 Ga0105237_10020214 3300009545 Bacteria 6872
85 Ga0105237_10118889 3300009545 Unclassified 2636
86 Ga0105237_10179202 3300009545 Bacteria 2119
87 Ga0105237_10340174 3300009545 Bacteria 1505
88 Ga0105237_10452111 3300009545 Unclassified 1290
89 Ga0105237_10772045 3300009545 Unclassified 968
90 Ga0105237_11297352 3300009545 Unclassified 734
91 Ga0105238_10065889 3300009551 Bacteria 3623
92 Ga0105238_10074530 3300009551 Unclassified 3386
93 Ga0105238_10172355 3300009551 Unclassified 2140
94 Ga0105238_10446921 3300009551 Bacteria 1289
95 Ga0105249_10017850 3300009553 Bacteria 6304
96 Ga0105249_10074810 3300009553 Unclassified 3136
97 Ga0099796_10309834 3300010159 Unclassified 671
98 Ga0105239_10041745 3300010375 Bacteria 5027
99 Ga0105239_10158065 3300010375 Unclassified 2532
100 Ga0105239_11087186 3300010375 Bacteria 920
101 Ga0105239_11567922 3300010375 Bacteria 761
102 Ga0157369_10029873 3300013105 Bacteria 6019
103 Ga0157369_10061770 3300013105 Bacteria 4038
104 Ga0157369_10072945 3300013105 Bacteria 3683
105 Ga0157369_10171403 3300013105 Bacteria 2287
106 Ga0157369_10311400 3300013105 Bacteria 1637
107 Ga0157369_10534658 3300013105 Bacteria 1212
108 Ga0157374_10169686 3300013296 Bacteria 2128
109 Ga0157374_11327113 3300013296 Unclassified 742
110 Ga0157374_11330006 3300013296 Bacteria 741
111 Ga0157372_10158735 3300013307 Unclassified 2613
112 Ga0163163_10007884 3300014325 Bacteria 9414
113 Ga0157379_10083131 3300014968 Unclassified 2870
114 Ga0157379_10520696 3300014968 Bacteria 1104
115 Ga0157379_10668404 3300014968 Unclassified 973
116 Ga0157376_10308711 3300014969 Bacteria 1500
117 Ga0157376_10481334 3300014969 Unclassified 1216
118 Ga0207680_10134825 3300025903 Unclassified 1631
119 Ga0207680_10432126 3300025903 Bacteria 933
120 Ga0207699_10159089 3300025906 Unclassified 1502
121 Ga0207699_10448288 3300025906 Unclassified 925
122 Ga0207654_10218653 3300025911 Bacteria 1262
123 Ga0207707_10256999 3300025912 Bacteria 1516
124 Ga0207695_10013091 3300025913 Bacteria 9903
125 Ga0207695_10023291 3300025913 Bacteria 7002
126 Ga0207695_10037244 3300025913 Bacteria 5249
127 Ga0207695_10052480 3300025913 Bacteria 4271
128 Ga0207695_10055865 3300025913 Unclassified 4112
129 Ga0207695_10088696 3300025913 Bacteria 3112
130 Ga0207695_10257133 3300025913 Bacteria 1645
131 Ga0207695_10308641 3300025913 Bacteria 1472
132 Ga0207695_10357199 3300025913 Bacteria 1348
133 Ga0207695_10369112 3300025913 Bacteria 1321
134 Ga0207695_10421197 3300025913 Bacteria 1219
135 Ga0207695_10935791 3300025913 Bacteria 746
136 Ga0207671_10051423 3300025914 Unclassified 3053
137 Ga0207671_10091289 3300025914 Bacteria 2295
138 Ga0207671_10120833 3300025914 Unclassified 2002
139 Ga0207671_10222917 3300025914 Bacteria 1477
140 Ga0207671_10319310 3300025914 Unclassified 1229
141 Ga0207671_10561438 3300025914 Unclassified 910
142 Ga0207671_10615164 3300025914 Unclassified 866
143 Ga0207671_10928456 3300025914 Unclassified 687
144 Ga0207660_10064796 3300025917 Bacteria 2638
145 Ga0207660_10624439 3300025917 Unclassified 878
146 Ga0207649_10333306 3300025920 Unclassified 1118
147 Ga0207652_10161214 3300025921 Bacteria 2011
148 Ga0207694_10140234 3300025924 Unclassified 1944
149 Ga0207694_10248279 3300025924 Bacteria 1456
150 Ga0207694_10313474 3300025924 Bacteria 1294
151 Ga0207700_10010409 3300025928 Bacteria 5867
152 Ga0207700_10012832 3300025928 Bacteria 5420
153 Ga0207700_10501759 3300025928 Bacteria 1074
154 Ga0207644_10823932 3300025931 Unclassified 776
155 Ga0207711_10174086 3300025941 Bacteria 1954
156 Ga0207661_10092787 3300025944 Bacteria 2518
157 Ga0207661_10551968 3300025944 Bacteria 1055
158 Ga0207661_10664525 3300025944 Unclassified 958
159 Ga0207661_10700967 3300025944 Unclassified 931
160 Ga0207667_10001368 3300025949 Bacteria 30575
161 Ga0207667_10014357 3300025949 Bacteria 9033
162 Ga0207667_10062693 3300025949 Unclassified 3886
163 Ga0207667_10388223 3300025949 Bacteria 1422
164 Ga0207667_10731561 3300025949 Bacteria 990
165 Ga0207712_10101403 3300025961 Bacteria 2141
166 Ga0207712_10180397 3300025961 Bacteria 1658
167 Ga0207658_10018708 3300025986 Unclassified 4788
168 Ga0207703_10001305 3300026035 Bacteria 23068
169 Ga0207703_10190880 3300026035 Unclassified 1814
170 Ga0207639_10175891 3300026041 Bacteria 1817
171 Ga0207641_10174925 3300026088 Unclassified 1962
172 Ga0207641_10369486 3300026088 Unclassified 1371
173 Ga0207675_100855417 3300026118 Unclassified 924
174 Ga0207698_10551279 3300026142 Unclassified 1130
175 Ga0268266_10018875 3300028379 Bacteria 5874
176 Ga0268266_10034584 3300028379 Bacteria 4297
177 Ga0268266_10037043 3300028379 Bacteria 4156
178 Ga0268266_10050604 3300028379 Bacteria 3565
179 Ga0268266_10180933 3300028379 Unclassified 1919
180 Ga0268266_10429484 3300028379 Bacteria 1253
181 Ga0268265_10098968 3300028380 Bacteria 2350
182 Ga0268264_10056075 3300028381 Unclassified 3293
183 Ga0268264_10076295 3300028381 Unclassified 2851
184 Ga0265334_10001105 3300028573 Bacteria 13202
185 Ga0265334_10042581 3300028573 Bacteria 1769
186 Ga0265318_10034818 3300028577 Bacteria 1939
187 Ga0265318_10047465 3300028577 Bacteria 1619
188 Ga0265338_10401615 3300028800 Unclassified 977
189 Ga0307511_10000147 3300030521 Bacteria 66706
190 Ga0307511_10000859 3300030521 Bacteria 32371
191 Ga0307511_10002751 3300030521 Bacteria 18290
192 Ga0265340_10068964 3300031247 Bacteria 1679
193 Ga0265331_10001139 3300031250 Bacteria 20266
194 Ga0265331_10003697 3300031250 Bacteria 9734
195 Ga0265331_10033957 3300031250 Bacteria 2519
196 Ga0307509_10000036 3300031507 Bacteria 190164
197 Ga0307509_10000152 3300031507 Bacteria 106873
198 Ga0307518_10295347 3300031838 Unclassified 990
199 Ga0307510_10000006 3300033180 Bacteria 566474
200 Ga0307510_10001430 3300033180 Bacteria 26243
201 Ga0307510_10024198 3300033180 Bacteria 7021
202 Ga0307510_10046840 3300033180 Bacteria 4643
203 Ga0373936_0006337 3300035113 Bacteria 4458
204 Ga0373936_0009510 3300035113 Bacteria 3664
205 Ga0373936_0014476 3300035113 Unclassified 3016
206 Ga0373936_0016635 3300035113 Bacteria 2830
207 Ga0373936_0426730 3300035113 Unclassified 611
208 Ga0466969_0005701 3300044656 Bacteria 6620
209 Ga0466969_0014178 3300044656 Bacteria 4192
210 Ga0466969_0030007 3300044656 Unclassified 2772
211 Ga0466965_0057345 3300044683 Bacteria 1941
212 Ga0466966_0003323 3300044684 Bacteria 10596
213 Ga0466966_0044769 3300044684 Bacteria 2832
214 Ga0466966_0109612 3300044684 Bacteria 1703
215 Ga0466966_0157618 3300044684 Bacteria 1382
216 Ga0466961_0001341 3300044693 Bacteria 15161
217 Ga0466961_0013617 3300044693 Bacteria 5210
218 Ga0466961_0203312 3300044693 Bacteria 1224
219 Ga0466964_0009500 3300044706 Bacteria 3665
220 Ga0466964_0023965 3300044706 Unclassified 2375
221 Ga0466971_0024656 3300044719 Bacteria 2683
222 Ga0466968_0062596 3300044735 Bacteria 1607
223 Ga0466970_0000284 3300044765 Bacteria 24793
224 Ga0466970_0096036 3300044765 Bacteria 1611
225 Ga0466957_0017992 3300044842 Bacteria 4145
226 Ga0466959_0004617 3300045049 Bacteria 9255
227 Ga0466959_0005867 3300045049 Bacteria 8457
228 Ga0466959_0026588 3300045049 Bacteria 4289
229 Ga0466959_0220971 3300045049 Unclassified 1314
230 Ga0466959_0541784 3300045049 Bacteria 785
231 Ga0495606_0218945 3300046507 Bacteria 1074
232 Ga0495648_0162558 3300046524 Unclassified 1153
233 Ga0495597_0202409 3300046542 Bacteria 795
234 Ga0495625_0277773 3300046660 Unclassified 1079
235 Ga0495674_0512134 3300047319 Bacteria 959
236 Ga0495683_0156445 3300047323 Bacteria 1057
237 Ga0495687_055308 3300047443 Bacteria 1660
238 Ga0496106_0530854 3300048909 Unclassified 945
239 Ga0496108_0350059 3300048911 Unclassified 1289
240 Ga0496112_0064206 3300048915 Unclassified 3623
241 Ga0496116_0002912 3300048919 Bacteria 17468
242 Ga0496116_0020289 3300048919 Bacteria 5052
243 Ga0496117_0000523 3300048920 Bacteria 63335
244 Ga0496117_0000851 3300048920 Bacteria 47282
245 Ga0496118_0000180 3300048921 Bacteria 112199
246 Ga0496119_0000998 3300048922 Bacteria 36271
247 Ga0496119_0001340 3300048922 Bacteria 30138
248 Ga0496119_0011056 3300048922 Bacteria 7524
249 Ga0496119_0012617 3300048922 Bacteria 6841
250 Ga0496119_0027167 3300048922 Unclassified 3943
251 Ga0496119_0161574 3300048922 Bacteria 1190
252 Ga0496120_0000226 3300048923 Bacteria 96713
253 Ga0496120_0000814 3300048923 Bacteria 44686
254 Ga0496120_0009398 3300048923 Bacteria 6948
255 Ga0496120_0049614 3300048923 Bacteria 2408
256 Ga0496121_0010401 3300048924 Bacteria 10501
257 Ga0496121_0023090 3300048924 Bacteria 6006
258 Ga0496121_0026380 3300048924 Bacteria 5478
259 Ga0496121_0139567 3300048924 Unclassified 1800
260 Ga0496121_0273238 3300048924 Bacteria 1160
261 Ga0496124_0153479 3300048927 Bacteria 1803
262 Ga0496125_0004127 3300048928 Bacteria 16962
263 Ga0496125_0005453 3300048928 Bacteria 14135
264 Ga0496125_0056327 3300048928 Bacteria 3193
265 Ga0496125_0081530 3300048928 Bacteria 2471
266 Ga0496125_0088678 3300048928 Unclassified 2330
267 Ga0496126_0001715 3300048929 Bacteria 32548
268 Ga0496126_0003844 3300048929 Bacteria 18580
269 Ga0496126_0016482 3300048929 Bacteria 7385
270 Ga0496126_0018322 3300048929 Bacteria 6942
271 Ga0496126_0018981 3300048929 Bacteria 6790
272 Ga0496126_0038663 3300048929 Bacteria 4436
273 Ga0496126_0064992 3300048929 Bacteria 3266
274 Ga0496126_0154943 3300048929 Bacteria 1961
275 Ga0496126_0508173 3300048929 Unclassified 962
276 Ga0500637_0010236 3300053178 Bacteria 4803
277 Ga0500637_0035998 3300053178 Unclassified 2778
278 Ga0500637_0051843 3300053178 Bacteria 2339
279 Ga0500637_0093456 3300053178 Unclassified 1742
280 Ga0500637_0113840 3300053178 Unclassified 1569
281 Ga0500637_0200453 3300053178 Bacteria 1137
282 Ga0466962_0000367 3300061719 Bacteria 19469
283 Ga0466962_0009513 3300061719 Bacteria 4660
284 Ga0466962_0033532 3300061719 Bacteria 2457
285 Ga0466962_0067301 3300061719 Bacteria 1710
286 Ga0207699_10333207
287 rootH1_10101488
288 Ga0070658_10185658
289 Ga0070683_100012763
290 Ga0070683_100124500
291 Ga0070683_101266420
292 Ga0070666_10044444
293 Ga0070680_100031942
294 Ga0070680_100086211
295 Ga0070689_100730070
296 Ga0070661_100421718
297 Ga0070671_100024465
298 Ga0070667_100016610
299 Ga0070667_100127866
300 Ga0070667_100265585
301 Ga0070709_10330230
302 Ga0070713_100013918
303 Ga0070713_100038049
304 Ga0070713_100509710
305 Ga0070713_101051439
306 Ga0070710_10095226
307 Ga0070663_100281803
308 Ga0070681_10276091
309 Ga0070681_10361982
310 Ga0070679_100085446
311 Ga0070679_100109303
312 Ga0070684_100025634
313 Ga0070684_100026195
314 Ga0070684_100252242
315 Ga0070684_101194104
316 Ga0068853_100174236
317 Ga0070665_100000780
318 Ga0070665_100024922
319 Ga0070665_100079573
320 Ga0070665_100121966
321 Ga0070665_100326995
322 Ga0070665_100635424
323 Ga0068855_100006388
324 Ga0068855_100010640
325 Ga0068855_100324438
326 Ga0068855_100856981
327 Ga0068855_101460074
328 Ga0070664_100746545
329 Ga0068854_100729552
330 Ga0068856_100900216
331 Ga0068852_100492929
332 Ga0068852_100851814
333 Ga0068859_100008064
334 Ga0068861_100222558
335 Ga0068863_100010829
336 Ga0068863_101149999
337 Ga0068858_100003122
338 Ga0068858_100006536
339 Ga0068858_100241882
340 Ga0068860_100037293
341 Ga0068862_100164204
342 Ga0097621_100077707
343 Ga0068871_100059458
344 Ga0097620_100008063
345 Ga0099795_10168945
346 Ga0105250_10028227
347 Ga0105250_10069083
348 Ga0105240_10002224
349 Ga0105240_10012717
350 Ga0105240_10020670
351 Ga0105240_10027045
352 Ga0105240_10045709
353 Ga0105240_10081785
354 Ga0105240_10090820
355 Ga0105240_10120417
356 Ga0105240_10224918
357 Ga0105240_10309557
358 Ga0105240_10456723
359 Ga0105240_10607593
360 Ga0105245_10792021
361 Ga0105247_10006672
362 Ga0105247_10091143
363 Ga0105247_10611089
364 Ga0105241_10468712
365 Ga0105242_11314914
366 Ga0105248_10141217
367 Ga0105248_10388075
368 Ga0105237_10011290
369 Ga0105237_10020214
370 Ga0105237_10118889
371 Ga0105237_10179202
372 Ga0105237_10340174
373 Ga0105237_10452111
374 Ga0105237_10772045
375 Ga0105237_11297352
376 Ga0105238_10065889
377 Ga0105238_10074530
378 Ga0105238_10172355
379 Ga0105238_10446921
380 Ga0105249_10017850
381 Ga0105249_10074810
382 Ga0099796_10309834
383 Ga0105239_10041745
384 Ga0105239_10158065
385 Ga0105239_11087186
386 Ga0105239_11567922
387 Ga0157369_10029873
388 Ga0157369_10061770
389 Ga0157369_10072945
390 Ga0157369_10171403
391 Ga0157369_10311400
392 Ga0157369_10534658
393 Ga0157374_10169686
394 Ga0157374_11327113
395 Ga0157374_11330006
396 Ga0157372_10158735
397 Ga0163163_10007884
398 Ga0157379_10083131
399 Ga0157379_10520696
400 Ga0157379_10668404
401 Ga0157376_10308711
402 Ga0157376_10481334
403 Ga0207680_10134825
404 Ga0207680_10432126
405 Ga0207699_10159089
406 Ga0207699_10448288
407 Ga0207654_10218653
408 Ga0207707_10256999
409 Ga0207695_10013091
410 Ga0207695_10023291
411 Ga0207695_10037244
412 Ga0207695_10052480
413 Ga0207695_10055865
414 Ga0207695_10088696
415 Ga0207695_10257133
416 Ga0207695_10308641
417 Ga0207695_10357199
418 Ga0207695_10369112
419 Ga0207695_10421197
420 Ga0207695_10935791
421 Ga0207671_10051423
422 Ga0207671_10091289
423 Ga0207671_10120833
424 Ga0207671_10222917
425 Ga0207671_10319310
426 Ga0207671_10561438
427 Ga0207671_10615164
428 Ga0207671_10928456
429 Ga0207660_10064796
430 Ga0207660_10624439
431 Ga0207649_10333306
432 Ga0207652_10161214
433 Ga0207694_10140234
434 Ga0207694_10248279
435 Ga0207694_10313474
436 Ga0207700_10010409
437 Ga0207700_10012832
438 Ga0207700_10501759
439 Ga0207644_10823932
440 Ga0207711_10174086
441 Ga0207661_10092787
442 Ga0207661_10551968
443 Ga0207661_10664525
444 Ga0207661_10700967
445 Ga0207667_10001368
446 Ga0207667_10014357
447 Ga0207667_10062693
448 Ga0207667_10388223
449 Ga0207667_10731561
450 Ga0207712_10101403
451 Ga0207712_10180397
452 Ga0207658_10018708
453 Ga0207703_10001305
454 Ga0207703_10190880
455 Ga0207639_10175891
456 Ga0207641_10174925
457 Ga0207641_10369486
458 Ga0207675_100855417
459 Ga0207698_10551279
460 Ga0268266_10018875
461 Ga0268266_10034584
462 Ga0268266_10037043
463 Ga0268266_10050604
464 Ga0268266_10180933
465 Ga0268266_10429484
466 Ga0268265_10098968
467 Ga0268264_10056075
468 Ga0268264_10076295
469 Ga0265334_10001105
470 Ga0265334_10042581
471 Ga0265318_10034818
472 Ga0265318_10047465
473 Ga0265338_10401615
474 Ga0307511_10000147
475 Ga0307511_10000859
476 Ga0307511_10002751
477 Ga0265340_10068964
478 Ga0265331_10001139
479 Ga0265331_10003697
480 Ga0265331_10033957
481 Ga0307509_10000036
482 Ga0307509_10000152
483 Ga0307518_10295347
484 Ga0307510_10000006
485 Ga0307510_10001430
486 Ga0307510_10024198
487 Ga0307510_10046840
488 Ga0373936_0006337
489 Ga0373936_0009510
490 Ga0373936_0014476
491 Ga0373936_0016635
492 Ga0373936_0426730
493 Ga0466969_0005701
494 Ga0466969_0014178
495 Ga0466969_0030007
496 Ga0466965_0057345
497 Ga0466966_0003323
498 Ga0466966_0044769
499 Ga0466966_0109612
500 Ga0466966_0157618
501 Ga0466961_0001341
502 Ga0466961_0013617
503 Ga0466961_0203312
504 Ga0466964_0009500
505 Ga0466964_0023965
506 Ga0466971_0024656
507 Ga0466968_0062596
508 Ga0466970_0000284
509 Ga0466970_0096036
510 Ga0466957_0017992
511 Ga0466959_0004617
512 Ga0466959_0005867
513 Ga0466959_0026588
514 Ga0466959_0220971
515 Ga0466959_0541784
516 Ga0495606_0218945
517 Ga0495648_0162558
518 Ga0495597_0202409
519 Ga0495625_0277773
520 Ga0495674_0512134
521 Ga0495683_0156445
522 Ga0495687_055308
523 Ga0496106_0530854
524 Ga0496108_0350059
525 Ga0496112_0064206
526 Ga0496116_0002912
527 Ga0496116_0020289
528 Ga0496117_0000523
529 Ga0496117_0000851
530 Ga0496118_0000180
531 Ga0496119_0000998
532 Ga0496119_0001340
533 Ga0496119_0011056
534 Ga0496119_0012617
535 Ga0496119_0027167
536 Ga0496119_0161574
537 Ga0496120_0000226
538 Ga0496120_0000814
539 Ga0496120_0009398
540 Ga0496120_0049614
541 Ga0496121_0010401
542 Ga0496121_0023090
543 Ga0496121_0026380
544 Ga0496121_0139567
545 Ga0496121_0273238
546 Ga0496124_0153479
547 Ga0496125_0004127
548 Ga0496125_0005453
549 Ga0496125_0056327
550 Ga0496125_0081530
551 Ga0496125_0088678
552 Ga0496126_0001715
553 Ga0496126_0003844
554 Ga0496126_0016482
555 Ga0496126_0018322
556 Ga0496126_0018981
557 Ga0496126_0038663
558 Ga0496126_0064992
559 Ga0496126_0154943
560 Ga0496126_0508173
561 Ga0500637_0010236
562 Ga0500637_0035998
563 Ga0500637_0051843
564 Ga0500637_0093456
565 Ga0500637_0113840
566 Ga0500637_0200453
567 Ga0466962_0000367
568 Ga0466962_0009513
569 Ga0466962_0033532
570 Ga0466962_0067301

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05685

Uma2

Putative restriction endonuclease

13

190

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6okh-assembly1.cif.gz_B structure of an uncharacterized protein from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.8968 10 189
6okh-assembly1.cif.gz_B structure of an uncharacterized protein from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.8729 10 189
1wdj-assembly1.cif.gz_B crystal structure of tt1808 from thermus thermophilus hb8 0.7933 34 189
3ot2-assembly1.cif.gz_B crystal structure of a putative nuclease belonging to duf820 (ava_3926) from anabaena variabilis atcc 29413 at 1.96 a resolution 0.7928 12 194
1wdj-assembly1.cif.gz_B crystal structure of tt1808 from thermus thermophilus hb8 0.7836 34 189
ID Description Score Start End Superfamily
af_A0A1D8PRZ3_426_574_3.40.50.800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.8054 130 156 3.40.50.800
1wdjB00 Alpha Beta;Alpha-Beta Complex;tt1808, chain A;tt1808, chain A 0.7933 34 189 3.90.1570.10
3ot2B00 Alpha Beta;Alpha-Beta Complex;tt1808, chain A;tt1808, chain A 0.7867 12 194 3.90.1570.10
1wdjB00 Alpha Beta;Alpha-Beta Complex;tt1808, chain A;tt1808, chain A 0.7836 34 189 3.90.1570.10
3ot2B00 Alpha Beta;Alpha-Beta Complex;tt1808, chain A;tt1808, chain A 0.7747 12 194 3.90.1570.10
ID Description Score Start End GO Terms
AF-A0A353GEW2-F1-model_v4 Uma2 family endonuclease 0.9736 40 189 GO:0004519
AF-A0A7V2Z3B0-F1-model_v4 Uma2 family endonuclease 0.9712 70 191 GO:0004519
AF-A0A1A8XPC0-F1-model_v4 Putative restriction endonuclease domain-containing protein 0.967 7 191
AF-A0A2W4R3V1-F1-model_v4 Putative restriction endonuclease domain-containing protein 0.967 1 166
AF-A0A3D5EZW1-F1-model_v4 Putative restriction endonuclease domain-containing protein 0.9656 35 194

Map