F393120
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 296 | 152 | 296 | 114 |
Family's Representative Sequence
| Representative Sequence | 3300006846|Ga0075430_100988442|Ga0075430_1009884421 |
| Length | 121 |
| Sequence | MTFEEAVAFALTLPDTELSTSYGKPAVKVAANGRAFLFPSHEAETSFGVAIDLDTIELLKATEPETYWQTPHYEGWEGVLIRFDSQDEDRVREIIGRARDWVAAKPKARPRKKANPSLRGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 28 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 47 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 48 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 49 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 66 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 111 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 112 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 113 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 114 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 115 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 116 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 117 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 118 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 119 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 120 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 121 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 122 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 123 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 124 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 125 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 126 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 127 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 128 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 129 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 130 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 131 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 132 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 140 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 141 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 142 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 143 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 144 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 145 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 146 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 147 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 148 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 149 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 150 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 151 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 152 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.69 |
| Nodule | 0 |
| Rhizoplane | 2.7 |
| Rhizosphere | 93.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.69 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10050116 | 3300001979 | Bacteria | 1202 |
| 2 | JGI24739J22299_10021013 | 3300001989 | Bacteria | 2328 |
| 3 | JGI24737J22298_10000449 | 3300001990 | Bacteria | 14158 |
| 4 | JGI24735J21928_10018127 | 3300002067 | Bacteria | 2172 |
| 5 | JGI24738J21930_10015999 | 3300002075 | Bacteria | 1589 |
| 6 | Ga0070658_10043537 | 3300005327 | Bacteria | 3626 |
| 7 | Ga0070683_100002084 | 3300005329 | Bacteria | 15788 |
| 8 | Ga0070683_100533715 | 3300005329 | Bacteria | 1121 |
| 9 | Ga0070683_101351190 | 3300005329 | Bacteria | 685 |
| 10 | Ga0070670_100054132 | 3300005331 | Bacteria | 3445 |
| 11 | Ga0070670_101155148 | 3300005331 | Bacteria | 707 |
| 12 | Ga0068869_100536538 | 3300005334 | Bacteria | 981 |
| 13 | Ga0070680_100359913 | 3300005336 | Bacteria | 1238 |
| 14 | Ga0070680_100564910 | 3300005336 | Bacteria | 975 |
| 15 | Ga0070680_101202092 | 3300005336 | Bacteria | 656 |
| 16 | Ga0068868_100000005 | 3300005338 | Bacteria | 132403 |
| 17 | Ga0068868_100099367 | 3300005338 | Bacteria | 2354 |
| 18 | Ga0068868_100279650 | 3300005338 | Bacteria | 1412 |
| 19 | Ga0068868_100610676 | 3300005338 | Bacteria | 967 |
| 20 | Ga0070660_100000655 | 3300005339 | Bacteria | 22906 |
| 21 | Ga0070660_100260686 | 3300005339 | Bacteria | 1415 |
| 22 | Ga0070661_100000050 | 3300005344 | Bacteria | 90752 |
| 23 | Ga0070661_100028272 | 3300005344 | Bacteria | 4043 |
| 24 | Ga0070661_100249422 | 3300005344 | Bacteria | 1369 |
| 25 | Ga0070661_100629060 | 3300005344 | Bacteria | 870 |
| 26 | Ga0070661_100871143 | 3300005344 | Bacteria | 742 |
| 27 | Ga0070692_10340520 | 3300005345 | Bacteria | 929 |
| 28 | Ga0070671_100046993 | 3300005355 | Bacteria | 3590 |
| 29 | Ga0070671_100136153 | 3300005355 | Bacteria | 2071 |
| 30 | Ga0070674_100332861 | 3300005356 | Bacteria | 1221 |
| 31 | Ga0070673_100884669 | 3300005364 | Bacteria | 828 |
| 32 | Ga0070659_100000081 | 3300005366 | Bacteria | 73150 |
| 33 | Ga0070659_100012246 | 3300005366 | Bacteria | 6359 |
| 34 | Ga0070659_100078701 | 3300005366 | Bacteria | 2630 |
| 35 | Ga0070659_100128688 | 3300005366 | Bacteria | 2055 |
| 36 | Ga0070659_100274058 | 3300005366 | Bacteria | 1402 |
| 37 | Ga0070659_100708581 | 3300005366 | Unclassified | 871 |
| 38 | Ga0070667_100006855 | 3300005367 | Bacteria | 9462 |
| 39 | Ga0070667_100006864 | 3300005367 | Bacteria | 9458 |
| 40 | Ga0070709_10029226 | 3300005434 | Bacteria | 3295 |
| 41 | Ga0070714_100157121 | 3300005435 | Bacteria | 2054 |
| 42 | Ga0070714_100249853 | 3300005435 | Bacteria | 1639 |
| 43 | Ga0070713_100535718 | 3300005436 | Bacteria | 1108 |
| 44 | Ga0070663_100000770 | 3300005455 | Bacteria | 17463 |
| 45 | Ga0070663_100109771 | 3300005455 | Bacteria | 2071 |
| 46 | Ga0070663_100144435 | 3300005455 | Bacteria | 1819 |
| 47 | Ga0070662_100000025 | 3300005457 | Bacteria | 87144 |
| 48 | Ga0070662_100457077 | 3300005457 | Bacteria | 1061 |
| 49 | Ga0070662_100895458 | 3300005457 | Bacteria | 757 |
| 50 | Ga0070681_10068412 | 3300005458 | Bacteria | 3518 |
| 51 | Ga0070679_100372368 | 3300005530 | Bacteria | 1375 |
| 52 | Ga0070679_101316344 | 3300005530 | Unclassified | 668 |
| 53 | Ga0068853_100000061 | 3300005539 | Bacteria | 77461 |
| 54 | Ga0068853_100072900 | 3300005539 | Bacteria | 2993 |
| 55 | Ga0068853_100249297 | 3300005539 | Bacteria | 1629 |
| 56 | Ga0068853_100311886 | 3300005539 | Bacteria | 1456 |
| 57 | Ga0068853_101134654 | 3300005539 | Bacteria | 754 |
| 58 | Ga0070672_100111837 | 3300005543 | Bacteria | 2227 |
| 59 | Ga0070686_100343623 | 3300005544 | Bacteria | 1119 |
| 60 | Ga0070686_100581358 | 3300005544 | Bacteria | 880 |
| 61 | Ga0070695_100029893 | 3300005545 | Bacteria | 3388 |
| 62 | Ga0070696_100560549 | 3300005546 | Bacteria | 916 |
| 63 | Ga0070696_101608051 | 3300005546 | Bacteria | 558 |
| 64 | Ga0070693_100000262 | 3300005547 | Bacteria | 24728 |
| 65 | Ga0070693_100181610 | 3300005547 | Bacteria | 1355 |
| 66 | Ga0070693_100290581 | 3300005547 | Unclassified | 1098 |
| 67 | Ga0070693_101221615 | 3300005547 | Bacteria | 578 |
| 68 | Ga0070665_100003772 | 3300005548 | Bacteria | 16039 |
| 69 | Ga0070665_100016112 | 3300005548 | Bacteria | 7501 |
| 70 | Ga0070665_100338274 | 3300005548 | Bacteria | 1510 |
| 71 | Ga0070704_100927954 | 3300005549 | Bacteria | 784 |
| 72 | Ga0068855_100000326 | 3300005563 | Bacteria | 59175 |
| 73 | Ga0068855_100196832 | 3300005563 | Bacteria | 2270 |
| 74 | Ga0068855_100364042 | 3300005563 | Bacteria | 1591 |
| 75 | Ga0068855_100429941 | 3300005563 | Bacteria | 1443 |
| 76 | Ga0068855_100776746 | 3300005563 | Bacteria | 1020 |
| 77 | Ga0070664_100000012 | 3300005564 | Bacteria | 162011 |
| 78 | Ga0070664_100011146 | 3300005564 | Bacteria | 7291 |
| 79 | Ga0070664_100710987 | 3300005564 | Bacteria | 936 |
| 80 | Ga0070664_100957569 | 3300005564 | Bacteria | 804 |
| 81 | Ga0068857_100076334 | 3300005577 | Bacteria | 2988 |
| 82 | Ga0068857_100763471 | 3300005577 | Bacteria | 921 |
| 83 | Ga0068854_100017414 | 3300005578 | Bacteria | 4808 |
| 84 | Ga0068854_100035698 | 3300005578 | Bacteria | 3481 |
| 85 | Ga0068854_100088802 | 3300005578 | Bacteria | 2296 |
| 86 | Ga0068854_101200530 | 3300005578 | Bacteria | 680 |
| 87 | Ga0068856_100018219 | 3300005614 | Bacteria | 6807 |
| 88 | Ga0068856_100103624 | 3300005614 | Bacteria | 2839 |
| 89 | Ga0068852_100004772 | 3300005616 | Bacteria | 9629 |
| 90 | Ga0068852_100018647 | 3300005616 | Bacteria | 5469 |
| 91 | Ga0068852_100474936 | 3300005616 | Bacteria | 1242 |
| 92 | Ga0068852_101028940 | 3300005616 | Bacteria | 843 |
| 93 | Ga0068859_100177662 | 3300005617 | Bacteria | 2211 |
| 94 | Ga0068859_100977435 | 3300005617 | Bacteria | 929 |
| 95 | Ga0068864_100108986 | 3300005618 | Bacteria | 2465 |
| 96 | Ga0068864_100328427 | 3300005618 | Bacteria | 1438 |
| 97 | Ga0068851_10325041 | 3300005834 | Bacteria | 889 |
| 98 | Ga0068858_101005764 | 3300005842 | Bacteria | 817 |
| 99 | Ga0097621_100236355 | 3300006237 | Bacteria | 1596 |
| 100 | Ga0075428_100566682 | 3300006844 | Bacteria | 1214 |
| 101 | Ga0075430_100988442 | 3300006846 | Bacteria | 693 |
| 102 | Ga0075429_100438106 | 3300006880 | Bacteria | 1145 |
| 103 | Ga0097620_100177663 | 3300006931 | Bacteria | 2211 |
| 104 | Ga0097620_100977329 | 3300006931 | Bacteria | 929 |
| 105 | Ga0105240_10222233 | 3300009093 | Bacteria | 2200 |
| 106 | Ga0111539_10019592 | 3300009094 | Bacteria | 8347 |
| 107 | Ga0105241_10292296 | 3300009174 | Bacteria | 1395 |
| 108 | Ga0105241_10659303 | 3300009174 | Bacteria | 951 |
| 109 | Ga0105248_10000299 | 3300009177 | Bacteria | 58871 |
| 110 | Ga0105248_10017257 | 3300009177 | Bacteria | 7954 |
| 111 | Ga0105248_10189796 | 3300009177 | Bacteria | 2315 |
| 112 | Ga0105237_10549400 | 3300009545 | Bacteria | 1162 |
| 113 | Ga0105238_10015731 | 3300009551 | Bacteria | 7660 |
| 114 | Ga0105238_10060292 | 3300009551 | Bacteria | 3799 |
| 115 | Ga0105238_10110891 | 3300009551 | Bacteria | 2724 |
| 116 | Ga0105238_13076491 | 3300009551 | Unclassified | 500 |
| 117 | Ga0157373_10014133 | 3300013100 | Bacteria | 5853 |
| 118 | Ga0157373_10283973 | 3300013100 | Bacteria | 1173 |
| 119 | Ga0157373_10482280 | 3300013100 | Bacteria | 894 |
| 120 | Ga0157373_10484993 | 3300013100 | Bacteria | 892 |
| 121 | Ga0157371_10015665 | 3300013102 | Bacteria | 5678 |
| 122 | Ga0157371_10264200 | 3300013102 | Bacteria | 1241 |
| 123 | Ga0157370_10085435 | 3300013104 | Bacteria | 2964 |
| 124 | Ga0157370_10549237 | 3300013104 | Bacteria | 1059 |
| 125 | Ga0157369_10002992 | 3300013105 | Bacteria | 20229 |
| 126 | Ga0157369_10127806 | 3300013105 | Bacteria | 2693 |
| 127 | Ga0157369_10479276 | 3300013105 | Bacteria | 1288 |
| 128 | Ga0157378_11593221 | 3300013297 | Bacteria | 699 |
| 129 | Ga0163162_10037566 | 3300013306 | Bacteria | 4833 |
| 130 | Ga0157372_10056913 | 3300013307 | Bacteria | 4370 |
| 131 | Ga0163163_10000341 | 3300014325 | Bacteria | 45103 |
| 132 | Ga0163161_11523236 | 3300017792 | Bacteria | 588 |
| 133 | Ga0213876_10049816 | 3300021384 | Bacteria | 2213 |
| 134 | Ga0209050_1043474 | 3300025298 | Bacteria | 1214 |
| 135 | Ga0207697_10126410 | 3300025315 | Bacteria | 1103 |
| 136 | Ga0207656_10078270 | 3300025321 | Bacteria | 1482 |
| 137 | Ga0207682_10000924 | 3300025893 | Bacteria | 13606 |
| 138 | Ga0207680_10000887 | 3300025903 | Bacteria | 14125 |
| 139 | Ga0207680_10130522 | 3300025903 | Bacteria | 1656 |
| 140 | Ga0207647_10004363 | 3300025904 | Bacteria | 10492 |
| 141 | Ga0207647_10076073 | 3300025904 | Bacteria | 2020 |
| 142 | Ga0207699_10263910 | 3300025906 | Bacteria | 1191 |
| 143 | Ga0207705_10000095 | 3300025909 | Bacteria | 106506 |
| 144 | Ga0207705_10050846 | 3300025909 | Bacteria | 2984 |
| 145 | Ga0207707_10869506 | 3300025912 | Bacteria | 747 |
| 146 | Ga0207671_10562035 | 3300025914 | Bacteria | 909 |
| 147 | Ga0207693_10015864 | 3300025915 | Bacteria | 6034 |
| 148 | Ga0207660_10006609 | 3300025917 | Bacteria | 7525 |
| 149 | Ga0207660_11076701 | 3300025917 | Bacteria | 655 |
| 150 | Ga0207662_10277833 | 3300025918 | Bacteria | 1107 |
| 151 | Ga0207657_10000028 | 3300025919 | Bacteria | 141576 |
| 152 | Ga0207657_10184162 | 3300025919 | Bacteria | 1687 |
| 153 | Ga0207657_10516205 | 3300025919 | Bacteria | 935 |
| 154 | Ga0207649_10000014 | 3300025920 | Bacteria | 255001 |
| 155 | Ga0207649_10887294 | 3300025920 | Bacteria | 699 |
| 156 | Ga0207652_10294378 | 3300025921 | Bacteria | 1465 |
| 157 | Ga0207694_10018630 | 3300025924 | Bacteria | 5249 |
| 158 | Ga0207694_10036590 | 3300025924 | Bacteria | 3768 |
| 159 | Ga0207694_10095571 | 3300025924 | Bacteria | 2349 |
| 160 | Ga0207694_10435372 | 3300025924 | Bacteria | 1093 |
| 161 | Ga0207650_10940412 | 3300025925 | Bacteria | 734 |
| 162 | Ga0207700_10122287 | 3300025928 | Bacteria | 2112 |
| 163 | Ga0207700_10379499 | 3300025928 | Bacteria | 1236 |
| 164 | Ga0207644_10006329 | 3300025931 | Bacteria | 7709 |
| 165 | Ga0207644_10241991 | 3300025931 | Bacteria | 1437 |
| 166 | Ga0207690_10000042 | 3300025932 | Bacteria | 120002 |
| 167 | Ga0207690_10016774 | 3300025932 | Bacteria | 4464 |
| 168 | Ga0207690_10030737 | 3300025932 | Bacteria | 3429 |
| 169 | Ga0207690_10081138 | 3300025932 | Bacteria | 2265 |
| 170 | Ga0207690_10086416 | 3300025932 | Bacteria | 2204 |
| 171 | Ga0207706_10000029 | 3300025933 | Bacteria | 146113 |
| 172 | Ga0207706_10120110 | 3300025933 | Bacteria | 2311 |
| 173 | Ga0207706_10540305 | 3300025933 | Bacteria | 1004 |
| 174 | Ga0207706_10890414 | 3300025933 | Bacteria | 752 |
| 175 | Ga0207669_10269916 | 3300025937 | Bacteria | 1277 |
| 176 | Ga0207665_10045403 | 3300025939 | Bacteria | 2942 |
| 177 | Ga0207691_10123283 | 3300025940 | Bacteria | 2294 |
| 178 | Ga0207711_10004966 | 3300025941 | Bacteria | 11290 |
| 179 | Ga0207711_10018913 | 3300025941 | Bacteria | 5729 |
| 180 | Ga0207711_10361332 | 3300025941 | Bacteria | 1345 |
| 181 | Ga0207689_10292394 | 3300025942 | Bacteria | 1350 |
| 182 | Ga0207661_10002316 | 3300025944 | Bacteria | 13122 |
| 183 | Ga0207661_10505451 | 3300025944 | Bacteria | 1104 |
| 184 | Ga0207679_10000092 | 3300025945 | Bacteria | 78331 |
| 185 | Ga0207679_10006544 | 3300025945 | Bacteria | 7362 |
| 186 | Ga0207679_11343459 | 3300025945 | Bacteria | 656 |
| 187 | Ga0207667_10007919 | 3300025949 | Bacteria | 12689 |
| 188 | Ga0207667_10231318 | 3300025949 | Bacteria | 1893 |
| 189 | Ga0207667_11191731 | 3300025949 | Bacteria | 742 |
| 190 | Ga0207651_10196950 | 3300025960 | Bacteria | 1611 |
| 191 | Ga0207640_10008846 | 3300025981 | Bacteria | 5606 |
| 192 | Ga0207640_10015676 | 3300025981 | Bacteria | 4391 |
| 193 | Ga0207640_10203214 | 3300025981 | Bacteria | 1503 |
| 194 | Ga0207658_10068079 | 3300025986 | Bacteria | 2684 |
| 195 | Ga0207658_10161808 | 3300025986 | Bacteria | 1835 |
| 196 | Ga0207658_10261275 | 3300025986 | Bacteria | 1476 |
| 197 | Ga0207677_10300959 | 3300026023 | Bacteria | 1325 |
| 198 | Ga0207677_10651410 | 3300026023 | Bacteria | 930 |
| 199 | Ga0207677_11073069 | 3300026023 | Bacteria | 733 |
| 200 | Ga0207703_10630192 | 3300026035 | Bacteria | 1016 |
| 201 | Ga0207639_10001173 | 3300026041 | Bacteria | 17796 |
| 202 | Ga0207639_10001913 | 3300026041 | Bacteria | 13980 |
| 203 | Ga0207639_10156231 | 3300026041 | Bacteria | 1916 |
| 204 | Ga0207639_11077343 | 3300026041 | Bacteria | 753 |
| 205 | Ga0207678_10075506 | 3300026067 | Bacteria | 2887 |
| 206 | Ga0207678_10197243 | 3300026067 | Bacteria | 1721 |
| 207 | Ga0207678_10247224 | 3300026067 | Bacteria | 1527 |
| 208 | Ga0207678_10644513 | 3300026067 | Bacteria | 930 |
| 209 | Ga0207702_10001460 | 3300026078 | Bacteria | 23509 |
| 210 | Ga0207702_10076517 | 3300026078 | Bacteria | 2893 |
| 211 | Ga0207702_10092297 | 3300026078 | Bacteria | 2653 |
| 212 | Ga0207702_10804581 | 3300026078 | Unclassified | 929 |
| 213 | Ga0207702_11201002 | 3300026078 | Bacteria | 753 |
| 214 | Ga0207641_11592277 | 3300026088 | Unclassified | 655 |
| 215 | Ga0207676_10066212 | 3300026095 | Bacteria | 2880 |
| 216 | Ga0207674_10015792 | 3300026116 | Bacteria | 8281 |
| 217 | Ga0207674_10037552 | 3300026116 | Bacteria | 5036 |
| 218 | Ga0207698_10028690 | 3300026142 | Bacteria | 3972 |
| 219 | Ga0207698_10054136 | 3300026142 | Bacteria | 3085 |
| 220 | Ga0207698_10144482 | 3300026142 | Bacteria | 2055 |
| 221 | Ga0207698_11141923 | 3300026142 | Bacteria | 792 |
| 222 | Ga0268266_10004995 | 3300028379 | Bacteria | 12536 |
| 223 | Ga0268266_10008332 | 3300028379 | Bacteria | 9229 |
| 224 | Ga0268264_10015006 | 3300028381 | Bacteria | 6355 |
| 225 | Ga0307517_10033528 | 3300028786 | Bacteria | 5893 |
| 226 | Ga0307405_10349728 | 3300031731 | Bacteria | 1140 |
| 227 | Ga0307413_10217820 | 3300031824 | Bacteria | 1392 |
| 228 | Ga0307406_11136868 | 3300031901 | Bacteria | 676 |
| 229 | Ga0307412_10392129 | 3300031911 | Bacteria | 1128 |
| 230 | Ga0307414_11358201 | 3300032004 | Bacteria | 660 |
| 231 | Ga0307414_11823359 | 3300032004 | Bacteria | 568 |
| 232 | Ga0307411_10362557 | 3300032005 | Bacteria | 1186 |
| 233 | Ga0373951_0182564 | 3300035091 | Bacteria | 603 |
| 234 | Ga0373931_0039805 | 3300035691 | Bacteria | 2463 |
| 235 | Ga0395899_0024337 | 3300037312 | Bacteria | 4578 |
| 236 | Ga0395899_0171750 | 3300037312 | Bacteria | 1526 |
| 237 | Ga0395899_0671109 | 3300037312 | Unclassified | 653 |
| 238 | Ga0395899_0924232 | 3300037312 | Unclassified | 531 |
| 239 | Ga0395900_0098849 | 3300037418 | Bacteria | 2998 |
| 240 | Ga0395900_0157993 | 3300037418 | Bacteria | 2315 |
| 241 | Ga0395900_0172587 | 3300037418 | Bacteria | 2200 |
| 242 | Ga0395900_0264978 | 3300037418 | Bacteria | 1714 |
| 243 | Ga0395900_0692205 | 3300037418 | Bacteria | 953 |
| 244 | Ga0395900_0741212 | 3300037418 | Bacteria | 913 |
| 245 | Ga0395900_0744258 | 3300037418 | Bacteria | 911 |
| 246 | Ga0395898_0056222 | 3300037466 | Bacteria | 3836 |
| 247 | Ga0395898_0117199 | 3300037466 | Bacteria | 2551 |
| 248 | Ga0395898_0505671 | 3300037466 | Bacteria | 1149 |
| 249 | Ga0395905_0009546 | 3300037471 | Bacteria | 9477 |
| 250 | Ga0395905_0013901 | 3300037471 | Bacteria | 7700 |
| 251 | Ga0395905_0067031 | 3300037471 | Bacteria | 3361 |
| 252 | Ga0395905_0070527 | 3300037471 | Bacteria | 3275 |
| 253 | Ga0395905_0132411 | 3300037471 | Bacteria | 2345 |
| 254 | Ga0395905_0984333 | 3300037471 | Bacteria | 746 |
| 255 | Ga0395905_0995443 | 3300037471 | Bacteria | 741 |
| 256 | Ga0395905_1673055 | 3300037471 | Unclassified | 541 |
| 257 | Ga0395905_1816756 | 3300037471 | Unclassified | 515 |
| 258 | Ga0395901_0006769 | 3300038443 | Bacteria | 11577 |
| 259 | Ga0395901_0028274 | 3300038443 | Bacteria | 5766 |
| 260 | Ga0395901_0186451 | 3300038443 | Bacteria | 2176 |
| 261 | Ga0395901_0229819 | 3300038443 | Bacteria | 1937 |
| 262 | Ga0395901_0736353 | 3300038443 | Bacteria | 980 |
| 263 | Ga0436365_0470515 | 3300039437 | Bacteria | 34514 |
| 264 | Ga0436363_1359564 | 3300039450 | Bacteria | 813 |
| 265 | Ga0451833_0917483 | 3300041491 | Bacteria | 697 |
| 266 | Ga0466963_0043015 | 3300044694 | Bacteria | 2968 |
| 267 | Ga0466963_0133237 | 3300044694 | Bacteria | 1718 |
| 268 | Ga0466964_0002180 | 3300044706 | Bacteria | 6925 |
| 269 | Ga0466957_0277008 | 3300044842 | Bacteria | 1122 |
| 270 | Ga0466958_0613679 | 3300045836 | Bacteria | 708 |
| 271 | Ga0466967_0006341 | 3300045976 | Bacteria | 8356 |
| 272 | Ga0466967_0011909 | 3300045976 | Bacteria | 6622 |
| 273 | Ga0466967_0775609 | 3300045976 | Bacteria | 951 |
| 274 | Ga0495590_0208226 | 3300046457 | Bacteria | 720 |
| 275 | Ga0495638_0299030 | 3300046460 | Bacteria | 868 |
| 276 | Ga0495583_0033180 | 3300046506 | Bacteria | 2484 |
| 277 | Ga0495606_0070162 | 3300046507 | Bacteria | 2211 |
| 278 | Ga0495625_0002466 | 3300046660 | Bacteria | 19994 |
| 279 | Ga0495625_0040688 | 3300046660 | Bacteria | 3387 |
| 280 | Ga0495669_0037397 | 3300046684 | Bacteria | 2148 |
| 281 | Ga0495677_0079168 | 3300047445 | Bacteria | 1230 |
| 282 | Ga0496104_0158458 | 3300048907 | Bacteria | 2172 |
| 283 | Ga0496105_1129128 | 3300048908 | Bacteria | 580 |
| 284 | Ga0496107_0212602 | 3300048910 | Bacteria | 1438 |
| 285 | Ga0496107_0632890 | 3300048910 | Bacteria | 789 |
| 286 | Ga0496109_1439469 | 3300048912 | Bacteria | 624 |
| 287 | Ga0496111_0119419 | 3300048914 | Bacteria | 1947 |
| 288 | Ga0496113_0398085 | 3300048916 | Bacteria | 1106 |
| 289 | Ga0496114_0000006 | 3300048917 | Bacteria | 472921 |
| 290 | Ga0501068_0232381 | 3300049584 | Bacteria | 1173 |
| 291 | nmdc:mga09592_349957_c1 | 3300050508 | Bacteria | 1279 |
| 292 | nmdc:mga0qj67_981454_c1 | 3300050509 | Bacteria | 663 |
| 293 | Ga0500643_000648 | 3300053087 | Bacteria | 23388 |
| 294 | Ga0500646_0048056 | 3300053090 | Bacteria | 1222 |
| 295 | Ga0500645_000173 | 3300053730 | Bacteria | 50903 |
| 296 | Ga0500587_000103 | 3300053739 | Bacteria | 7534 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005366 | Ga0070659_100128688 | Ga0070659_1001286882 | 105 |
| 2 | 3300005434 | Ga0070709_10029226 | Ga0070709_100292262 | 105 |
| 3 | 3300025893 | Ga0207682_10000924 | Ga0207682_100009244 | 105 |
| 4 | 3300025906 | Ga0207699_10263910 | Ga0207699_102639102 | 105 |
| 5 | 3300025915 | Ga0207693_10015864 | Ga0207693_100158646 | 105 |
| 6 | 3300025928 | Ga0207700_10122287 | Ga0207700_101222872 | 105 |
| 7 | 3300025932 | Ga0207690_10030737 | Ga0207690_100307373 | 105 |
| 8 | 3300025939 | Ga0207665_10045403 | Ga0207665_100454033 | 105 |
| 9 | 3300037312 | Ga0395899_0171750 | Ga0395899_0171750_23_367 | 105 |
| 10 | 3300048917 | Ga0496114_0000006 | Ga0496114_0000006_213189_213533 | 106 |
| 11 | 3300005345 | Ga0070692_10340520 | Ga0070692_103405202 | 107 |
| 12 | 3300037471 | Ga0395905_0070527 | Ga0395905_0070527_2857_3201 | 107 |
| 13 | 3300037418 | Ga0395900_0172587 | Ga0395900_0172587_958_1302 | 109 |
| 14 | 3300037466 | Ga0395898_0056222 | Ga0395898_0056222_2499_2843 | 109 |
| 15 | 3300037471 | Ga0395905_0067031 | Ga0395905_0067031_2472_2816 | 109 |
| 16 | 3300038443 | Ga0395901_0186451 | Ga0395901_0186451_1547_1891 | 109 |
| 17 | 3300005338 | Ga0068868_100000005 | Ga0068868_10000000540 | 112 |
| 18 | 3300031731 | Ga0307405_10349728 | Ga0307405_103497282 | 112 |
| 19 | 3300031824 | Ga0307413_10217820 | Ga0307413_102178202 | 112 |
| 20 | 3300031901 | Ga0307406_11136868 | Ga0307406_111368682 | 112 |
| 21 | 3300031911 | Ga0307412_10392129 | Ga0307412_103921292 | 112 |
| 22 | 3300032004 | Ga0307414_11358201 | Ga0307414_113582012 | 112 |
| 23 | 3300032004 | Ga0307414_11823359 | Ga0307414_118233592 | 112 |
| 24 | 3300032005 | Ga0307411_10362557 | Ga0307411_103625572 | 112 |
| 25 | 3300039450 | Ga0436363_1359564 | Ga0436363_1359564_410_763 | 112 |
| 26 | 3300046507 | Ga0495606_0070162 | Ga0495606_0070162_521_862 | 112 |
| 27 | 3300013100 | Ga0157373_10484993 | Ga0157373_104849931 | 113 |
| 28 | 3300025917 | Ga0207660_10006609 | Ga0207660_100066098 | 113 |
| 29 | 3300026078 | Ga0207702_10092297 | Ga0207702_100922972 | 113 |
| 30 | 3300028786 | Ga0307517_10033528 | Ga0307517_100335281 | 113 |
| 31 | 3300053087 | Ga0500643_000648 | Ga0500643_000648_2762_3109 | 113 |
| 32 | 3300001979 | JGI24740J21852_10050116 | JGI24740J21852_100501162 | 114 |
| 33 | 3300001989 | JGI24739J22299_10021013 | JGI24739J22299_100210132 | 114 |
| 34 | 3300001990 | JGI24737J22298_10000449 | JGI24737J22298_100004499 | 114 |
| 35 | 3300002067 | JGI24735J21928_10018127 | JGI24735J21928_100181272 | 114 |
| 36 | 3300002075 | JGI24738J21930_10015999 | JGI24738J21930_100159992 | 114 |
| 37 | 3300005327 | Ga0070658_10043537 | Ga0070658_100435373 | 114 |
| 38 | 3300005329 | Ga0070683_100002084 | Ga0070683_10000208410 | 114 |
| 39 | 3300005329 | Ga0070683_100533715 | Ga0070683_1005337151 | 114 |
| 40 | 3300005329 | Ga0070683_101351190 | Ga0070683_1013511901 | 114 |
| 41 | 3300005331 | Ga0070670_100054132 | Ga0070670_1000541323 | 114 |
| 42 | 3300005331 | Ga0070670_101155148 | Ga0070670_1011551482 | 114 |
| 43 | 3300005334 | Ga0068869_100536538 | Ga0068869_1005365382 | 114 |
| 44 | 3300005336 | Ga0070680_100359913 | Ga0070680_1003599132 | 114 |
| 45 | 3300005336 | Ga0070680_100564910 | Ga0070680_1005649101 | 114 |
| 46 | 3300005336 | Ga0070680_101202092 | Ga0070680_1012020921 | 114 |
| 47 | 3300005338 | Ga0068868_100099367 | Ga0068868_1000993673 | 114 |
| 48 | 3300005338 | Ga0068868_100279650 | Ga0068868_1002796502 | 114 |
| 49 | 3300005338 | Ga0068868_100610676 | Ga0068868_1006106762 | 114 |
| 50 | 3300005339 | Ga0070660_100000655 | Ga0070660_10000065520 | 114 |
| 51 | 3300005339 | Ga0070660_100260686 | Ga0070660_1002606862 | 114 |
| 52 | 3300005344 | Ga0070661_100000050 | Ga0070661_1000000503 | 114 |
| 53 | 3300005344 | Ga0070661_100028272 | Ga0070661_1000282724 | 114 |
| 54 | 3300005344 | Ga0070661_100249422 | Ga0070661_1002494222 | 114 |
| 55 | 3300005344 | Ga0070661_100629060 | Ga0070661_1006290602 | 114 |
| 56 | 3300005344 | Ga0070661_100871143 | Ga0070661_1008711432 | 114 |
| 57 | 3300005355 | Ga0070671_100046993 | Ga0070671_1000469933 | 114 |
| 58 | 3300005355 | Ga0070671_100136153 | Ga0070671_1001361533 | 114 |
| 59 | 3300005356 | Ga0070674_100332861 | Ga0070674_1003328612 | 114 |
| 60 | 3300005364 | Ga0070673_100884669 | Ga0070673_1008846692 | 114 |
| 61 | 3300005366 | Ga0070659_100000081 | Ga0070659_10000008122 | 114 |
| 62 | 3300005366 | Ga0070659_100012246 | Ga0070659_1000122463 | 114 |
| 63 | 3300005366 | Ga0070659_100078701 | Ga0070659_1000787014 | 114 |
| 64 | 3300005366 | Ga0070659_100274058 | Ga0070659_1002740582 | 114 |
| 65 | 3300005366 | Ga0070659_100708581 | Ga0070659_1007085811 | 114 |
| 66 | 3300005367 | Ga0070667_100006855 | Ga0070667_1000068557 | 114 |
| 67 | 3300005367 | Ga0070667_100006864 | Ga0070667_1000068644 | 114 |
| 68 | 3300005435 | Ga0070714_100157121 | Ga0070714_1001571212 | 114 |
| 69 | 3300005435 | Ga0070714_100249853 | Ga0070714_1002498532 | 114 |
| 70 | 3300005436 | Ga0070713_100535718 | Ga0070713_1005357182 | 114 |
| 71 | 3300005455 | Ga0070663_100000770 | Ga0070663_1000007702 | 114 |
| 72 | 3300005455 | Ga0070663_100109771 | Ga0070663_1001097712 | 114 |
| 73 | 3300005455 | Ga0070663_100144435 | Ga0070663_1001444352 | 114 |
| 74 | 3300005457 | Ga0070662_100000025 | Ga0070662_10000002521 | 114 |
| 75 | 3300005457 | Ga0070662_100457077 | Ga0070662_1004570772 | 114 |
| 76 | 3300005457 | Ga0070662_100895458 | Ga0070662_1008954581 | 114 |
| 77 | 3300005458 | Ga0070681_10068412 | Ga0070681_100684126 | 114 |
| 78 | 3300005530 | Ga0070679_100372368 | Ga0070679_1003723682 | 114 |
| 79 | 3300005530 | Ga0070679_101316344 | Ga0070679_1013163441 | 114 |
| 80 | 3300005539 | Ga0068853_100000061 | Ga0068853_10000006114 | 114 |
| 81 | 3300005539 | Ga0068853_100072900 | Ga0068853_1000729002 | 114 |
| 82 | 3300005539 | Ga0068853_100249297 | Ga0068853_1002492972 | 114 |
| 83 | 3300005539 | Ga0068853_100311886 | Ga0068853_1003118862 | 114 |
| 84 | 3300005539 | Ga0068853_101134654 | Ga0068853_1011346542 | 114 |
| 85 | 3300005543 | Ga0070672_100111837 | Ga0070672_1001118372 | 114 |
| 86 | 3300005544 | Ga0070686_100343623 | Ga0070686_1003436232 | 114 |
| 87 | 3300005544 | Ga0070686_100581358 | Ga0070686_1005813582 | 114 |
| 88 | 3300005545 | Ga0070695_100029893 | Ga0070695_1000298932 | 114 |
| 89 | 3300005546 | Ga0070696_100560549 | Ga0070696_1005605492 | 114 |
| 90 | 3300005546 | Ga0070696_101608051 | Ga0070696_1016080512 | 114 |
| 91 | 3300005547 | Ga0070693_100000262 | Ga0070693_10000026214 | 114 |
| 92 | 3300005547 | Ga0070693_100181610 | Ga0070693_1001816102 | 114 |
| 93 | 3300005547 | Ga0070693_100290581 | Ga0070693_1002905811 | 114 |
| 94 | 3300005547 | Ga0070693_101221615 | Ga0070693_1012216152 | 114 |
| 95 | 3300005548 | Ga0070665_100003772 | Ga0070665_1000037725 | 114 |
| 96 | 3300005548 | Ga0070665_100016112 | Ga0070665_1000161129 | 114 |
| 97 | 3300005548 | Ga0070665_100338274 | Ga0070665_1003382742 | 114 |
| 98 | 3300005549 | Ga0070704_100927954 | Ga0070704_1009279542 | 114 |
| 99 | 3300005563 | Ga0068855_100000326 | Ga0068855_1000003263 | 114 |
| 100 | 3300005563 | Ga0068855_100196832 | Ga0068855_1001968325 | 114 |
| 101 | 3300005563 | Ga0068855_100364042 | Ga0068855_1003640422 | 114 |
| 102 | 3300005563 | Ga0068855_100429941 | Ga0068855_1004299412 | 114 |
| 103 | 3300005563 | Ga0068855_100776746 | Ga0068855_1007767462 | 114 |
| 104 | 3300005564 | Ga0070664_100000012 | Ga0070664_10000001283 | 114 |
| 105 | 3300005564 | Ga0070664_100011146 | Ga0070664_1000111467 | 114 |
| 106 | 3300005564 | Ga0070664_100710987 | Ga0070664_1007109872 | 114 |
| 107 | 3300005564 | Ga0070664_100957569 | Ga0070664_1009575692 | 114 |
| 108 | 3300005577 | Ga0068857_100076334 | Ga0068857_1000763343 | 114 |
| 109 | 3300005577 | Ga0068857_100763471 | Ga0068857_1007634712 | 114 |
| 110 | 3300005578 | Ga0068854_100017414 | Ga0068854_1000174145 | 114 |
| 111 | 3300005578 | Ga0068854_100035698 | Ga0068854_1000356984 | 114 |
| 112 | 3300005578 | Ga0068854_100088802 | Ga0068854_1000888023 | 114 |
| 113 | 3300005578 | Ga0068854_101200530 | Ga0068854_1012005302 | 114 |
| 114 | 3300005614 | Ga0068856_100018219 | Ga0068856_1000182196 | 114 |
| 115 | 3300005614 | Ga0068856_100103624 | Ga0068856_1001036242 | 114 |
| 116 | 3300005616 | Ga0068852_100004772 | Ga0068852_1000047728 | 114 |
| 117 | 3300005616 | Ga0068852_100018647 | Ga0068852_1000186477 | 114 |
| 118 | 3300005616 | Ga0068852_100474936 | Ga0068852_1004749362 | 114 |
| 119 | 3300005616 | Ga0068852_101028940 | Ga0068852_1010289401 | 114 |
| 120 | 3300005617 | Ga0068859_100177662 | Ga0068859_1001776623 | 114 |
| 121 | 3300005617 | Ga0068859_100977435 | Ga0068859_1009774352 | 114 |
| 122 | 3300005618 | Ga0068864_100108986 | Ga0068864_1001089862 | 114 |
| 123 | 3300005618 | Ga0068864_100328427 | Ga0068864_1003284272 | 114 |
| 124 | 3300005834 | Ga0068851_10325041 | Ga0068851_103250412 | 114 |
| 125 | 3300005842 | Ga0068858_101005764 | Ga0068858_1010057642 | 114 |
| 126 | 3300006237 | Ga0097621_100236355 | Ga0097621_1002363552 | 114 |
| 127 | 3300006844 | Ga0075428_100566682 | Ga0075428_1005666822 | 114 |
| 128 | 3300006846 | Ga0075430_100988442 | Ga0075430_1009884421 | 114 |
| 129 | 3300006880 | Ga0075429_100438106 | Ga0075429_1004381062 | 114 |
| 130 | 3300006931 | Ga0097620_100177663 | Ga0097620_1001776633 | 114 |
| 131 | 3300006931 | Ga0097620_100977329 | Ga0097620_1009773292 | 114 |
| 132 | 3300009093 | Ga0105240_10222233 | Ga0105240_102222333 | 114 |
| 133 | 3300009094 | Ga0111539_10019592 | Ga0111539_100195925 | 114 |
| 134 | 3300009174 | Ga0105241_10292296 | Ga0105241_102922962 | 114 |
| 135 | 3300009174 | Ga0105241_10659303 | Ga0105241_106593032 | 114 |
| 136 | 3300009177 | Ga0105248_10000299 | Ga0105248_1000029947 | 114 |
| 137 | 3300009177 | Ga0105248_10017257 | Ga0105248_100172576 | 114 |
| 138 | 3300009177 | Ga0105248_10189796 | Ga0105248_101897962 | 114 |
| 139 | 3300009545 | Ga0105237_10549400 | Ga0105237_105494002 | 114 |
| 140 | 3300009551 | Ga0105238_10015731 | Ga0105238_100157312 | 114 |
| 141 | 3300009551 | Ga0105238_10060292 | Ga0105238_100602927 | 114 |
| 142 | 3300009551 | Ga0105238_10110891 | Ga0105238_101108913 | 114 |
| 143 | 3300009551 | Ga0105238_13076491 | Ga0105238_130764911 | 114 |
| 144 | 3300013100 | Ga0157373_10014133 | Ga0157373_100141337 | 114 |
| 145 | 3300013100 | Ga0157373_10283973 | Ga0157373_102839731 | 114 |
| 146 | 3300013100 | Ga0157373_10482280 | Ga0157373_104822802 | 114 |
| 147 | 3300013102 | Ga0157371_10015665 | Ga0157371_100156652 | 114 |
| 148 | 3300013102 | Ga0157371_10264200 | Ga0157371_102642002 | 114 |
| 149 | 3300013104 | Ga0157370_10085435 | Ga0157370_100854353 | 114 |
| 150 | 3300013104 | Ga0157370_10549237 | Ga0157370_105492371 | 114 |
| 151 | 3300013105 | Ga0157369_10002992 | Ga0157369_1000299212 | 114 |
| 152 | 3300013105 | Ga0157369_10127806 | Ga0157369_101278063 | 114 |
| 153 | 3300013105 | Ga0157369_10479276 | Ga0157369_104792762 | 114 |
| 154 | 3300013297 | Ga0157378_11593221 | Ga0157378_115932212 | 114 |
| 155 | 3300013306 | Ga0163162_10037566 | Ga0163162_100375662 | 114 |
| 156 | 3300013307 | Ga0157372_10056913 | Ga0157372_100569136 | 114 |
| 157 | 3300014325 | Ga0163163_10000341 | Ga0163163_1000034121 | 114 |
| 158 | 3300017792 | Ga0163161_11523236 | Ga0163161_115232361 | 114 |
| 159 | 3300021384 | Ga0213876_10049816 | Ga0213876_100498162 | 114 |
| 160 | 3300025298 | Ga0209050_1043474 | Ga0209050_10434742 | 114 |
| 161 | 3300025315 | Ga0207697_10126410 | Ga0207697_101264102 | 114 |
| 162 | 3300025321 | Ga0207656_10078270 | Ga0207656_100782702 | 114 |
| 163 | 3300025903 | Ga0207680_10000887 | Ga0207680_100008879 | 114 |
| 164 | 3300025903 | Ga0207680_10130522 | Ga0207680_101305221 | 114 |
| 165 | 3300025904 | Ga0207647_10004363 | Ga0207647_100043637 | 114 |
| 166 | 3300025904 | Ga0207647_10076073 | Ga0207647_100760732 | 114 |
| 167 | 3300025909 | Ga0207705_10000095 | Ga0207705_1000009513 | 114 |
| 168 | 3300025909 | Ga0207705_10050846 | Ga0207705_100508462 | 114 |
| 169 | 3300025912 | Ga0207707_10869506 | Ga0207707_108695062 | 114 |
| 170 | 3300025914 | Ga0207671_10562035 | Ga0207671_105620351 | 114 |
| 171 | 3300025917 | Ga0207660_11076701 | Ga0207660_110767012 | 114 |
| 172 | 3300025918 | Ga0207662_10277833 | Ga0207662_102778332 | 114 |
| 173 | 3300025919 | Ga0207657_10000028 | Ga0207657_1000002842 | 114 |
| 174 | 3300025919 | Ga0207657_10184162 | Ga0207657_101841622 | 114 |
| 175 | 3300025919 | Ga0207657_10516205 | Ga0207657_105162052 | 114 |
| 176 | 3300025920 | Ga0207649_10000014 | Ga0207649_10000014228 | 114 |
| 177 | 3300025920 | Ga0207649_10887294 | Ga0207649_108872942 | 114 |
| 178 | 3300025921 | Ga0207652_10294378 | Ga0207652_102943782 | 114 |
| 179 | 3300025924 | Ga0207694_10018630 | Ga0207694_100186303 | 114 |
| 180 | 3300025924 | Ga0207694_10036590 | Ga0207694_100365903 | 114 |
| 181 | 3300025924 | Ga0207694_10095571 | Ga0207694_100955712 | 114 |
| 182 | 3300025924 | Ga0207694_10435372 | Ga0207694_104353722 | 114 |
| 183 | 3300025925 | Ga0207650_10940412 | Ga0207650_109404122 | 114 |
| 184 | 3300025928 | Ga0207700_10379499 | Ga0207700_103794992 | 114 |
| 185 | 3300025931 | Ga0207644_10006329 | Ga0207644_100063297 | 114 |
| 186 | 3300025931 | Ga0207644_10241991 | Ga0207644_102419912 | 114 |
| 187 | 3300025932 | Ga0207690_10000042 | Ga0207690_1000004251 | 114 |
| 188 | 3300025932 | Ga0207690_10016774 | Ga0207690_100167745 | 114 |
| 189 | 3300025932 | Ga0207690_10081138 | Ga0207690_100811382 | 114 |
| 190 | 3300025932 | Ga0207690_10086416 | Ga0207690_100864163 | 114 |
| 191 | 3300025933 | Ga0207706_10000029 | Ga0207706_1000002947 | 114 |
| 192 | 3300025933 | Ga0207706_10120110 | Ga0207706_101201105 | 114 |
| 193 | 3300025933 | Ga0207706_10540305 | Ga0207706_105403051 | 114 |
| 194 | 3300025933 | Ga0207706_10890414 | Ga0207706_108904141 | 114 |
| 195 | 3300025937 | Ga0207669_10269916 | Ga0207669_102699162 | 114 |
| 196 | 3300025940 | Ga0207691_10123283 | Ga0207691_101232832 | 114 |
| 197 | 3300025941 | Ga0207711_10004966 | Ga0207711_100049662 | 114 |
| 198 | 3300025941 | Ga0207711_10018913 | Ga0207711_100189135 | 114 |
| 199 | 3300025941 | Ga0207711_10361332 | Ga0207711_103613322 | 114 |
| 200 | 3300025942 | Ga0207689_10292394 | Ga0207689_102923942 | 114 |
| 201 | 3300025944 | Ga0207661_10002316 | Ga0207661_1000231612 | 114 |
| 202 | 3300025944 | Ga0207661_10505451 | Ga0207661_105054512 | 114 |
| 203 | 3300025945 | Ga0207679_10000092 | Ga0207679_1000009212 | 114 |
| 204 | 3300025945 | Ga0207679_10006544 | Ga0207679_100065443 | 114 |
| 205 | 3300025945 | Ga0207679_11343459 | Ga0207679_113434592 | 114 |
| 206 | 3300025949 | Ga0207667_10007919 | Ga0207667_100079196 | 114 |
| 207 | 3300025949 | Ga0207667_10231318 | Ga0207667_102313182 | 114 |
| 208 | 3300025949 | Ga0207667_11191731 | Ga0207667_111917312 | 114 |
| 209 | 3300025960 | Ga0207651_10196950 | Ga0207651_101969502 | 114 |
| 210 | 3300025981 | Ga0207640_10008846 | Ga0207640_100088463 | 114 |
| 211 | 3300025981 | Ga0207640_10015676 | Ga0207640_100156764 | 114 |
| 212 | 3300025981 | Ga0207640_10203214 | Ga0207640_102032142 | 114 |
| 213 | 3300025986 | Ga0207658_10068079 | Ga0207658_100680795 | 114 |
| 214 | 3300025986 | Ga0207658_10161808 | Ga0207658_101618084 | 114 |
| 215 | 3300025986 | Ga0207658_10261275 | Ga0207658_102612752 | 114 |
| 216 | 3300026023 | Ga0207677_10300959 | Ga0207677_103009592 | 114 |
| 217 | 3300026023 | Ga0207677_10651410 | Ga0207677_106514102 | 114 |
| 218 | 3300026023 | Ga0207677_11073069 | Ga0207677_110730691 | 114 |
| 219 | 3300026035 | Ga0207703_10630192 | Ga0207703_106301922 | 114 |
| 220 | 3300026041 | Ga0207639_10001173 | Ga0207639_100011732 | 114 |
| 221 | 3300026041 | Ga0207639_10001913 | Ga0207639_100019133 | 114 |
| 222 | 3300026041 | Ga0207639_10156231 | Ga0207639_101562312 | 114 |
| 223 | 3300026041 | Ga0207639_11077343 | Ga0207639_110773432 | 114 |
| 224 | 3300026067 | Ga0207678_10075506 | Ga0207678_100755063 | 114 |
| 225 | 3300026067 | Ga0207678_10197243 | Ga0207678_101972432 | 114 |
| 226 | 3300026067 | Ga0207678_10247224 | Ga0207678_102472242 | 114 |
| 227 | 3300026067 | Ga0207678_10644513 | Ga0207678_106445132 | 114 |
| 228 | 3300026078 | Ga0207702_10001460 | Ga0207702_1000146020 | 114 |
| 229 | 3300026078 | Ga0207702_10076517 | Ga0207702_100765173 | 114 |
| 230 | 3300026078 | Ga0207702_10804581 | Ga0207702_108045812 | 114 |
| 231 | 3300026078 | Ga0207702_11201002 | Ga0207702_112010022 | 114 |
| 232 | 3300026088 | Ga0207641_11592277 | Ga0207641_115922772 | 114 |
| 233 | 3300026095 | Ga0207676_10066212 | Ga0207676_100662124 | 114 |
| 234 | 3300026116 | Ga0207674_10015792 | Ga0207674_1001579212 | 114 |
| 235 | 3300026116 | Ga0207674_10037552 | Ga0207674_100375525 | 114 |
| 236 | 3300026142 | Ga0207698_10028690 | Ga0207698_100286904 | 114 |
| 237 | 3300026142 | Ga0207698_10054136 | Ga0207698_100541362 | 114 |
| 238 | 3300026142 | Ga0207698_10144482 | Ga0207698_101444822 | 114 |
| 239 | 3300026142 | Ga0207698_11141923 | Ga0207698_111419232 | 114 |
| 240 | 3300028379 | Ga0268266_10004995 | Ga0268266_100049956 | 114 |
| 241 | 3300028379 | Ga0268266_10008332 | Ga0268266_100083325 | 114 |
| 242 | 3300028381 | Ga0268264_10015006 | Ga0268264_100150062 | 114 |
| 243 | 3300035091 | Ga0373951_0182564 | Ga0373951_0182564_11_355 | 114 |
| 244 | 3300035691 | Ga0373931_0039805 | Ga0373931_0039805_324_668 | 114 |
| 245 | 3300037312 | Ga0395899_0024337 | Ga0395899_0024337_3447_3809 | 114 |
| 246 | 3300037312 | Ga0395899_0671109 | Ga0395899_0671109_280_624 | 114 |
| 247 | 3300037312 | Ga0395899_0924232 | Ga0395899_0924232_139_483 | 114 |
| 248 | 3300037418 | Ga0395900_0098849 | Ga0395900_0098849_752_1096 | 114 |
| 249 | 3300037418 | Ga0395900_0157993 | Ga0395900_0157993_1222_1566 | 114 |
| 250 | 3300037418 | Ga0395900_0264978 | Ga0395900_0264978_770_1132 | 114 |
| 251 | 3300037418 | Ga0395900_0692205 | Ga0395900_0692205_214_558 | 114 |
| 252 | 3300037418 | Ga0395900_0741212 | Ga0395900_0741212_302_646 | 114 |
| 253 | 3300037418 | Ga0395900_0744258 | Ga0395900_0744258_15_359 | 114 |
| 254 | 3300037466 | Ga0395898_0117199 | Ga0395898_0117199_549_911 | 114 |
| 255 | 3300037466 | Ga0395898_0505671 | Ga0395898_0505671_627_971 | 114 |
| 256 | 3300037471 | Ga0395905_0009546 | Ga0395905_0009546_3966_4310 | 114 |
| 257 | 3300037471 | Ga0395905_0013901 | Ga0395905_0013901_2304_2666 | 114 |
| 258 | 3300037471 | Ga0395905_0132411 | Ga0395905_0132411_1629_1973 | 114 |
| 259 | 3300037471 | Ga0395905_0984333 | Ga0395905_0984333_293_652 | 114 |
| 260 | 3300037471 | Ga0395905_0995443 | Ga0395905_0995443_162_506 | 114 |
| 261 | 3300037471 | Ga0395905_1673055 | Ga0395905_1673055_100_444 | 114 |
| 262 | 3300037471 | Ga0395905_1816756 | Ga0395905_1816756_36_380 | 114 |
| 263 | 3300038443 | Ga0395901_0006769 | Ga0395901_0006769_9103_9447 | 114 |
| 264 | 3300038443 | Ga0395901_0028274 | Ga0395901_0028274_5041_5403 | 114 |
| 265 | 3300038443 | Ga0395901_0229819 | Ga0395901_0229819_524_868 | 114 |
| 266 | 3300038443 | Ga0395901_0736353 | Ga0395901_0736353_501_845 | 114 |
| 267 | 3300039437 | Ga0436365_0470515 | Ga0436365_0470515_30660_31004 | 114 |
| 268 | 3300041491 | Ga0451833_0917483 | Ga0451833_0917483_277_636 | 114 |
| 269 | 3300044694 | Ga0466963_0043015 | Ga0466963_0043015_2498_2842 | 114 |
| 270 | 3300044694 | Ga0466963_0133237 | Ga0466963_0133237_343_687 | 114 |
| 271 | 3300044706 | Ga0466964_0002180 | Ga0466964_0002180_1098_1442 | 114 |
| 272 | 3300044842 | Ga0466957_0277008 | Ga0466957_0277008_14_358 | 114 |
| 273 | 3300045836 | Ga0466958_0613679 | Ga0466958_0613679_295_639 | 114 |
| 274 | 3300045976 | Ga0466967_0006341 | Ga0466967_0006341_7830_8192 | 114 |
| 275 | 3300045976 | Ga0466967_0011909 | Ga0466967_0011909_3110_3454 | 114 |
| 276 | 3300045976 | Ga0466967_0775609 | Ga0466967_0775609_174_518 | 114 |
| 277 | 3300046457 | Ga0495590_0208226 | Ga0495590_0208226_67_417 | 114 |
| 278 | 3300046460 | Ga0495638_0299030 | Ga0495638_0299030_114_464 | 114 |
| 279 | 3300046506 | Ga0495583_0033180 | Ga0495583_0033180_760_1110 | 114 |
| 280 | 3300046660 | Ga0495625_0002466 | Ga0495625_0002466_2572_2922 | 114 |
| 281 | 3300046660 | Ga0495625_0040688 | Ga0495625_0040688_1170_1529 | 114 |
| 282 | 3300046684 | Ga0495669_0037397 | Ga0495669_0037397_1512_1856 | 114 |
| 283 | 3300047445 | Ga0495677_0079168 | Ga0495677_0079168_698_1048 | 114 |
| 284 | 3300048907 | Ga0496104_0158458 | Ga0496104_0158458_812_1156 | 114 |
| 285 | 3300048908 | Ga0496105_1129128 | Ga0496105_1129128_11_355 | 114 |
| 286 | 3300048910 | Ga0496107_0212602 | Ga0496107_0212602_799_1143 | 114 |
| 287 | 3300048910 | Ga0496107_0632890 | Ga0496107_0632890_208_552 | 114 |
| 288 | 3300048912 | Ga0496109_1439469 | Ga0496109_1439469_70_414 | 114 |
| 289 | 3300048914 | Ga0496111_0119419 | Ga0496111_0119419_812_1156 | 114 |
| 290 | 3300048916 | Ga0496113_0398085 | Ga0496113_0398085_491_835 | 114 |
| 291 | 3300049584 | Ga0501068_0232381 | Ga0501068_0232381_505_867 | 114 |
| 292 | 3300050508 | nmdc:mga09592_349957_c1 | nmdc:mga09592_349957_c1_468_833 | 114 |
| 293 | 3300050509 | nmdc:mga0qj67_981454_c1 | nmdc:mga0qj67_981454_c1_275_640 | 114 |
| 294 | 3300053090 | Ga0500646_0048056 | Ga0500646_0048056_806_1165 | 114 |
| 295 | 3300053730 | Ga0500645_000173 | Ga0500645_000173_31885_32247 | 114 |
| 296 | 3300053739 | Ga0500587_000103 | Ga0500587_000103_4114_4473 | 114 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2a1v-assembly1.cif.gz_A | crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 | 0.7912 | 2 | 105 |
| 2a1v-assembly1.cif.gz_A | crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 | 0.7251 | 2 | 105 |
| 2fki-assembly1.cif.gz_A | nmr structure of protein yjbr from escherichia coli; northeast structural genomics consortium target er226 | 0.6904 | 1 | 106 |
| 2fki-assembly1.cif.gz_A | nmr structure of protein yjbr from escherichia coli; northeast structural genomics consortium target er226 | 0.6465 | 1 | 106 |
| 2kfp-assembly1.cif.gz_A | solution nmr structure of pspto_3016 from pseudomonas syringae. northeast structural genomics consortium target psr293. | 0.6403 | 1 | 112 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AAT2_2_121_3.90.1150.30 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; | 0.8051 | 4 | 102 | 3.90.1150.30 |
| af_P9WL91_4_123_3.30.70.1230 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain | 0.8028 | 4 | 102 | 3.30.70.1230 |
| 2a1vA00 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; | 0.7912 | 2 | 105 | 3.90.1150.30 |
| af_P0AF50_1_117_3.90.1150.30 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; | 0.7673 | 1 | 106 | 3.90.1150.30 |
| 2a1vA00 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; | 0.7252 | 2 | 105 | 3.90.1150.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537MEV7-F1-model_v4 | MmcQ/YjbR family DNA-binding protein | 0.984 | 2 | 114 |
|
| AF-A0A2U1G1W0-F1-model_v4 | deleted | 0.9828 | 1 | 114 |
|
| AF-A0A1W9H641-F1-model_v4 | MmcQ/YjbR family DNA-binding protein | 0.9764 | 4 | 111 |
|
| AF-A0A2U1G1W0-F1-model_v4 | deleted | 0.9743 | 1 | 114 |
|
| AF-A0A1M3PK85-F1-model_v4 | MmcQ-like protein | 0.9671 | 1 | 112 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar