F393120

General Info

Members Datasets Scaffolds Average Seq Length
296 152 296 114

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100988442|Ga0075430_1009884421
Length 121
Sequence MTFEEAVAFALTLPDTELSTSYGKPAVKVAANGRAFLFPSHEAETSFGVAIDLDTIELLKATEPETYWQTPHYEGWEGVLIRFDSQDEDRVREIIGRARDWVAAKPKARPRKKANPSLRGA

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
113 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
118 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
119 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
126 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
127 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
128 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
133 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
134 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
135 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
136 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
137 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
138 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
141 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
146 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
147 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
148 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
149 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
150 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
151 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
152 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.69
Nodule 0
Rhizoplane 2.7
Rhizosphere 93.92
Stem 0
Stem Tuber 0
Unclassified 1.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10050116 3300001979 Bacteria 1202
2 JGI24739J22299_10021013 3300001989 Bacteria 2328
3 JGI24737J22298_10000449 3300001990 Bacteria 14158
4 JGI24735J21928_10018127 3300002067 Bacteria 2172
5 JGI24738J21930_10015999 3300002075 Bacteria 1589
6 Ga0070658_10043537 3300005327 Bacteria 3626
7 Ga0070683_100002084 3300005329 Bacteria 15788
8 Ga0070683_100533715 3300005329 Bacteria 1121
9 Ga0070683_101351190 3300005329 Bacteria 685
10 Ga0070670_100054132 3300005331 Bacteria 3445
11 Ga0070670_101155148 3300005331 Bacteria 707
12 Ga0068869_100536538 3300005334 Bacteria 981
13 Ga0070680_100359913 3300005336 Bacteria 1238
14 Ga0070680_100564910 3300005336 Bacteria 975
15 Ga0070680_101202092 3300005336 Bacteria 656
16 Ga0068868_100000005 3300005338 Bacteria 132403
17 Ga0068868_100099367 3300005338 Bacteria 2354
18 Ga0068868_100279650 3300005338 Bacteria 1412
19 Ga0068868_100610676 3300005338 Bacteria 967
20 Ga0070660_100000655 3300005339 Bacteria 22906
21 Ga0070660_100260686 3300005339 Bacteria 1415
22 Ga0070661_100000050 3300005344 Bacteria 90752
23 Ga0070661_100028272 3300005344 Bacteria 4043
24 Ga0070661_100249422 3300005344 Bacteria 1369
25 Ga0070661_100629060 3300005344 Bacteria 870
26 Ga0070661_100871143 3300005344 Bacteria 742
27 Ga0070692_10340520 3300005345 Bacteria 929
28 Ga0070671_100046993 3300005355 Bacteria 3590
29 Ga0070671_100136153 3300005355 Bacteria 2071
30 Ga0070674_100332861 3300005356 Bacteria 1221
31 Ga0070673_100884669 3300005364 Bacteria 828
32 Ga0070659_100000081 3300005366 Bacteria 73150
33 Ga0070659_100012246 3300005366 Bacteria 6359
34 Ga0070659_100078701 3300005366 Bacteria 2630
35 Ga0070659_100128688 3300005366 Bacteria 2055
36 Ga0070659_100274058 3300005366 Bacteria 1402
37 Ga0070659_100708581 3300005366 Unclassified 871
38 Ga0070667_100006855 3300005367 Bacteria 9462
39 Ga0070667_100006864 3300005367 Bacteria 9458
40 Ga0070709_10029226 3300005434 Bacteria 3295
41 Ga0070714_100157121 3300005435 Bacteria 2054
42 Ga0070714_100249853 3300005435 Bacteria 1639
43 Ga0070713_100535718 3300005436 Bacteria 1108
44 Ga0070663_100000770 3300005455 Bacteria 17463
45 Ga0070663_100109771 3300005455 Bacteria 2071
46 Ga0070663_100144435 3300005455 Bacteria 1819
47 Ga0070662_100000025 3300005457 Bacteria 87144
48 Ga0070662_100457077 3300005457 Bacteria 1061
49 Ga0070662_100895458 3300005457 Bacteria 757
50 Ga0070681_10068412 3300005458 Bacteria 3518
51 Ga0070679_100372368 3300005530 Bacteria 1375
52 Ga0070679_101316344 3300005530 Unclassified 668
53 Ga0068853_100000061 3300005539 Bacteria 77461
54 Ga0068853_100072900 3300005539 Bacteria 2993
55 Ga0068853_100249297 3300005539 Bacteria 1629
56 Ga0068853_100311886 3300005539 Bacteria 1456
57 Ga0068853_101134654 3300005539 Bacteria 754
58 Ga0070672_100111837 3300005543 Bacteria 2227
59 Ga0070686_100343623 3300005544 Bacteria 1119
60 Ga0070686_100581358 3300005544 Bacteria 880
61 Ga0070695_100029893 3300005545 Bacteria 3388
62 Ga0070696_100560549 3300005546 Bacteria 916
63 Ga0070696_101608051 3300005546 Bacteria 558
64 Ga0070693_100000262 3300005547 Bacteria 24728
65 Ga0070693_100181610 3300005547 Bacteria 1355
66 Ga0070693_100290581 3300005547 Unclassified 1098
67 Ga0070693_101221615 3300005547 Bacteria 578
68 Ga0070665_100003772 3300005548 Bacteria 16039
69 Ga0070665_100016112 3300005548 Bacteria 7501
70 Ga0070665_100338274 3300005548 Bacteria 1510
71 Ga0070704_100927954 3300005549 Bacteria 784
72 Ga0068855_100000326 3300005563 Bacteria 59175
73 Ga0068855_100196832 3300005563 Bacteria 2270
74 Ga0068855_100364042 3300005563 Bacteria 1591
75 Ga0068855_100429941 3300005563 Bacteria 1443
76 Ga0068855_100776746 3300005563 Bacteria 1020
77 Ga0070664_100000012 3300005564 Bacteria 162011
78 Ga0070664_100011146 3300005564 Bacteria 7291
79 Ga0070664_100710987 3300005564 Bacteria 936
80 Ga0070664_100957569 3300005564 Bacteria 804
81 Ga0068857_100076334 3300005577 Bacteria 2988
82 Ga0068857_100763471 3300005577 Bacteria 921
83 Ga0068854_100017414 3300005578 Bacteria 4808
84 Ga0068854_100035698 3300005578 Bacteria 3481
85 Ga0068854_100088802 3300005578 Bacteria 2296
86 Ga0068854_101200530 3300005578 Bacteria 680
87 Ga0068856_100018219 3300005614 Bacteria 6807
88 Ga0068856_100103624 3300005614 Bacteria 2839
89 Ga0068852_100004772 3300005616 Bacteria 9629
90 Ga0068852_100018647 3300005616 Bacteria 5469
91 Ga0068852_100474936 3300005616 Bacteria 1242
92 Ga0068852_101028940 3300005616 Bacteria 843
93 Ga0068859_100177662 3300005617 Bacteria 2211
94 Ga0068859_100977435 3300005617 Bacteria 929
95 Ga0068864_100108986 3300005618 Bacteria 2465
96 Ga0068864_100328427 3300005618 Bacteria 1438
97 Ga0068851_10325041 3300005834 Bacteria 889
98 Ga0068858_101005764 3300005842 Bacteria 817
99 Ga0097621_100236355 3300006237 Bacteria 1596
100 Ga0075428_100566682 3300006844 Bacteria 1214
101 Ga0075430_100988442 3300006846 Bacteria 693
102 Ga0075429_100438106 3300006880 Bacteria 1145
103 Ga0097620_100177663 3300006931 Bacteria 2211
104 Ga0097620_100977329 3300006931 Bacteria 929
105 Ga0105240_10222233 3300009093 Bacteria 2200
106 Ga0111539_10019592 3300009094 Bacteria 8347
107 Ga0105241_10292296 3300009174 Bacteria 1395
108 Ga0105241_10659303 3300009174 Bacteria 951
109 Ga0105248_10000299 3300009177 Bacteria 58871
110 Ga0105248_10017257 3300009177 Bacteria 7954
111 Ga0105248_10189796 3300009177 Bacteria 2315
112 Ga0105237_10549400 3300009545 Bacteria 1162
113 Ga0105238_10015731 3300009551 Bacteria 7660
114 Ga0105238_10060292 3300009551 Bacteria 3799
115 Ga0105238_10110891 3300009551 Bacteria 2724
116 Ga0105238_13076491 3300009551 Unclassified 500
117 Ga0157373_10014133 3300013100 Bacteria 5853
118 Ga0157373_10283973 3300013100 Bacteria 1173
119 Ga0157373_10482280 3300013100 Bacteria 894
120 Ga0157373_10484993 3300013100 Bacteria 892
121 Ga0157371_10015665 3300013102 Bacteria 5678
122 Ga0157371_10264200 3300013102 Bacteria 1241
123 Ga0157370_10085435 3300013104 Bacteria 2964
124 Ga0157370_10549237 3300013104 Bacteria 1059
125 Ga0157369_10002992 3300013105 Bacteria 20229
126 Ga0157369_10127806 3300013105 Bacteria 2693
127 Ga0157369_10479276 3300013105 Bacteria 1288
128 Ga0157378_11593221 3300013297 Bacteria 699
129 Ga0163162_10037566 3300013306 Bacteria 4833
130 Ga0157372_10056913 3300013307 Bacteria 4370
131 Ga0163163_10000341 3300014325 Bacteria 45103
132 Ga0163161_11523236 3300017792 Bacteria 588
133 Ga0213876_10049816 3300021384 Bacteria 2213
134 Ga0209050_1043474 3300025298 Bacteria 1214
135 Ga0207697_10126410 3300025315 Bacteria 1103
136 Ga0207656_10078270 3300025321 Bacteria 1482
137 Ga0207682_10000924 3300025893 Bacteria 13606
138 Ga0207680_10000887 3300025903 Bacteria 14125
139 Ga0207680_10130522 3300025903 Bacteria 1656
140 Ga0207647_10004363 3300025904 Bacteria 10492
141 Ga0207647_10076073 3300025904 Bacteria 2020
142 Ga0207699_10263910 3300025906 Bacteria 1191
143 Ga0207705_10000095 3300025909 Bacteria 106506
144 Ga0207705_10050846 3300025909 Bacteria 2984
145 Ga0207707_10869506 3300025912 Bacteria 747
146 Ga0207671_10562035 3300025914 Bacteria 909
147 Ga0207693_10015864 3300025915 Bacteria 6034
148 Ga0207660_10006609 3300025917 Bacteria 7525
149 Ga0207660_11076701 3300025917 Bacteria 655
150 Ga0207662_10277833 3300025918 Bacteria 1107
151 Ga0207657_10000028 3300025919 Bacteria 141576
152 Ga0207657_10184162 3300025919 Bacteria 1687
153 Ga0207657_10516205 3300025919 Bacteria 935
154 Ga0207649_10000014 3300025920 Bacteria 255001
155 Ga0207649_10887294 3300025920 Bacteria 699
156 Ga0207652_10294378 3300025921 Bacteria 1465
157 Ga0207694_10018630 3300025924 Bacteria 5249
158 Ga0207694_10036590 3300025924 Bacteria 3768
159 Ga0207694_10095571 3300025924 Bacteria 2349
160 Ga0207694_10435372 3300025924 Bacteria 1093
161 Ga0207650_10940412 3300025925 Bacteria 734
162 Ga0207700_10122287 3300025928 Bacteria 2112
163 Ga0207700_10379499 3300025928 Bacteria 1236
164 Ga0207644_10006329 3300025931 Bacteria 7709
165 Ga0207644_10241991 3300025931 Bacteria 1437
166 Ga0207690_10000042 3300025932 Bacteria 120002
167 Ga0207690_10016774 3300025932 Bacteria 4464
168 Ga0207690_10030737 3300025932 Bacteria 3429
169 Ga0207690_10081138 3300025932 Bacteria 2265
170 Ga0207690_10086416 3300025932 Bacteria 2204
171 Ga0207706_10000029 3300025933 Bacteria 146113
172 Ga0207706_10120110 3300025933 Bacteria 2311
173 Ga0207706_10540305 3300025933 Bacteria 1004
174 Ga0207706_10890414 3300025933 Bacteria 752
175 Ga0207669_10269916 3300025937 Bacteria 1277
176 Ga0207665_10045403 3300025939 Bacteria 2942
177 Ga0207691_10123283 3300025940 Bacteria 2294
178 Ga0207711_10004966 3300025941 Bacteria 11290
179 Ga0207711_10018913 3300025941 Bacteria 5729
180 Ga0207711_10361332 3300025941 Bacteria 1345
181 Ga0207689_10292394 3300025942 Bacteria 1350
182 Ga0207661_10002316 3300025944 Bacteria 13122
183 Ga0207661_10505451 3300025944 Bacteria 1104
184 Ga0207679_10000092 3300025945 Bacteria 78331
185 Ga0207679_10006544 3300025945 Bacteria 7362
186 Ga0207679_11343459 3300025945 Bacteria 656
187 Ga0207667_10007919 3300025949 Bacteria 12689
188 Ga0207667_10231318 3300025949 Bacteria 1893
189 Ga0207667_11191731 3300025949 Bacteria 742
190 Ga0207651_10196950 3300025960 Bacteria 1611
191 Ga0207640_10008846 3300025981 Bacteria 5606
192 Ga0207640_10015676 3300025981 Bacteria 4391
193 Ga0207640_10203214 3300025981 Bacteria 1503
194 Ga0207658_10068079 3300025986 Bacteria 2684
195 Ga0207658_10161808 3300025986 Bacteria 1835
196 Ga0207658_10261275 3300025986 Bacteria 1476
197 Ga0207677_10300959 3300026023 Bacteria 1325
198 Ga0207677_10651410 3300026023 Bacteria 930
199 Ga0207677_11073069 3300026023 Bacteria 733
200 Ga0207703_10630192 3300026035 Bacteria 1016
201 Ga0207639_10001173 3300026041 Bacteria 17796
202 Ga0207639_10001913 3300026041 Bacteria 13980
203 Ga0207639_10156231 3300026041 Bacteria 1916
204 Ga0207639_11077343 3300026041 Bacteria 753
205 Ga0207678_10075506 3300026067 Bacteria 2887
206 Ga0207678_10197243 3300026067 Bacteria 1721
207 Ga0207678_10247224 3300026067 Bacteria 1527
208 Ga0207678_10644513 3300026067 Bacteria 930
209 Ga0207702_10001460 3300026078 Bacteria 23509
210 Ga0207702_10076517 3300026078 Bacteria 2893
211 Ga0207702_10092297 3300026078 Bacteria 2653
212 Ga0207702_10804581 3300026078 Unclassified 929
213 Ga0207702_11201002 3300026078 Bacteria 753
214 Ga0207641_11592277 3300026088 Unclassified 655
215 Ga0207676_10066212 3300026095 Bacteria 2880
216 Ga0207674_10015792 3300026116 Bacteria 8281
217 Ga0207674_10037552 3300026116 Bacteria 5036
218 Ga0207698_10028690 3300026142 Bacteria 3972
219 Ga0207698_10054136 3300026142 Bacteria 3085
220 Ga0207698_10144482 3300026142 Bacteria 2055
221 Ga0207698_11141923 3300026142 Bacteria 792
222 Ga0268266_10004995 3300028379 Bacteria 12536
223 Ga0268266_10008332 3300028379 Bacteria 9229
224 Ga0268264_10015006 3300028381 Bacteria 6355
225 Ga0307517_10033528 3300028786 Bacteria 5893
226 Ga0307405_10349728 3300031731 Bacteria 1140
227 Ga0307413_10217820 3300031824 Bacteria 1392
228 Ga0307406_11136868 3300031901 Bacteria 676
229 Ga0307412_10392129 3300031911 Bacteria 1128
230 Ga0307414_11358201 3300032004 Bacteria 660
231 Ga0307414_11823359 3300032004 Bacteria 568
232 Ga0307411_10362557 3300032005 Bacteria 1186
233 Ga0373951_0182564 3300035091 Bacteria 603
234 Ga0373931_0039805 3300035691 Bacteria 2463
235 Ga0395899_0024337 3300037312 Bacteria 4578
236 Ga0395899_0171750 3300037312 Bacteria 1526
237 Ga0395899_0671109 3300037312 Unclassified 653
238 Ga0395899_0924232 3300037312 Unclassified 531
239 Ga0395900_0098849 3300037418 Bacteria 2998
240 Ga0395900_0157993 3300037418 Bacteria 2315
241 Ga0395900_0172587 3300037418 Bacteria 2200
242 Ga0395900_0264978 3300037418 Bacteria 1714
243 Ga0395900_0692205 3300037418 Bacteria 953
244 Ga0395900_0741212 3300037418 Bacteria 913
245 Ga0395900_0744258 3300037418 Bacteria 911
246 Ga0395898_0056222 3300037466 Bacteria 3836
247 Ga0395898_0117199 3300037466 Bacteria 2551
248 Ga0395898_0505671 3300037466 Bacteria 1149
249 Ga0395905_0009546 3300037471 Bacteria 9477
250 Ga0395905_0013901 3300037471 Bacteria 7700
251 Ga0395905_0067031 3300037471 Bacteria 3361
252 Ga0395905_0070527 3300037471 Bacteria 3275
253 Ga0395905_0132411 3300037471 Bacteria 2345
254 Ga0395905_0984333 3300037471 Bacteria 746
255 Ga0395905_0995443 3300037471 Bacteria 741
256 Ga0395905_1673055 3300037471 Unclassified 541
257 Ga0395905_1816756 3300037471 Unclassified 515
258 Ga0395901_0006769 3300038443 Bacteria 11577
259 Ga0395901_0028274 3300038443 Bacteria 5766
260 Ga0395901_0186451 3300038443 Bacteria 2176
261 Ga0395901_0229819 3300038443 Bacteria 1937
262 Ga0395901_0736353 3300038443 Bacteria 980
263 Ga0436365_0470515 3300039437 Bacteria 34514
264 Ga0436363_1359564 3300039450 Bacteria 813
265 Ga0451833_0917483 3300041491 Bacteria 697
266 Ga0466963_0043015 3300044694 Bacteria 2968
267 Ga0466963_0133237 3300044694 Bacteria 1718
268 Ga0466964_0002180 3300044706 Bacteria 6925
269 Ga0466957_0277008 3300044842 Bacteria 1122
270 Ga0466958_0613679 3300045836 Bacteria 708
271 Ga0466967_0006341 3300045976 Bacteria 8356
272 Ga0466967_0011909 3300045976 Bacteria 6622
273 Ga0466967_0775609 3300045976 Bacteria 951
274 Ga0495590_0208226 3300046457 Bacteria 720
275 Ga0495638_0299030 3300046460 Bacteria 868
276 Ga0495583_0033180 3300046506 Bacteria 2484
277 Ga0495606_0070162 3300046507 Bacteria 2211
278 Ga0495625_0002466 3300046660 Bacteria 19994
279 Ga0495625_0040688 3300046660 Bacteria 3387
280 Ga0495669_0037397 3300046684 Bacteria 2148
281 Ga0495677_0079168 3300047445 Bacteria 1230
282 Ga0496104_0158458 3300048907 Bacteria 2172
283 Ga0496105_1129128 3300048908 Bacteria 580
284 Ga0496107_0212602 3300048910 Bacteria 1438
285 Ga0496107_0632890 3300048910 Bacteria 789
286 Ga0496109_1439469 3300048912 Bacteria 624
287 Ga0496111_0119419 3300048914 Bacteria 1947
288 Ga0496113_0398085 3300048916 Bacteria 1106
289 Ga0496114_0000006 3300048917 Bacteria 472921
290 Ga0501068_0232381 3300049584 Bacteria 1173
291 nmdc:mga09592_349957_c1 3300050508 Bacteria 1279
292 nmdc:mga0qj67_981454_c1 3300050509 Bacteria 663
293 Ga0500643_000648 3300053087 Bacteria 23388
294 Ga0500646_0048056 3300053090 Bacteria 1222
295 Ga0500645_000173 3300053730 Bacteria 50903
296 Ga0500587_000103 3300053739 Bacteria 7534

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005366 Ga0070659_100128688 Ga0070659_1001286882 105
2 3300005434 Ga0070709_10029226 Ga0070709_100292262 105
3 3300025893 Ga0207682_10000924 Ga0207682_100009244 105
4 3300025906 Ga0207699_10263910 Ga0207699_102639102 105
5 3300025915 Ga0207693_10015864 Ga0207693_100158646 105
6 3300025928 Ga0207700_10122287 Ga0207700_101222872 105
7 3300025932 Ga0207690_10030737 Ga0207690_100307373 105
8 3300025939 Ga0207665_10045403 Ga0207665_100454033 105
9 3300037312 Ga0395899_0171750 Ga0395899_0171750_23_367 105
10 3300048917 Ga0496114_0000006 Ga0496114_0000006_213189_213533 106
11 3300005345 Ga0070692_10340520 Ga0070692_103405202 107
12 3300037471 Ga0395905_0070527 Ga0395905_0070527_2857_3201 107
13 3300037418 Ga0395900_0172587 Ga0395900_0172587_958_1302 109
14 3300037466 Ga0395898_0056222 Ga0395898_0056222_2499_2843 109
15 3300037471 Ga0395905_0067031 Ga0395905_0067031_2472_2816 109
16 3300038443 Ga0395901_0186451 Ga0395901_0186451_1547_1891 109
17 3300005338 Ga0068868_100000005 Ga0068868_10000000540 112
18 3300031731 Ga0307405_10349728 Ga0307405_103497282 112
19 3300031824 Ga0307413_10217820 Ga0307413_102178202 112
20 3300031901 Ga0307406_11136868 Ga0307406_111368682 112
21 3300031911 Ga0307412_10392129 Ga0307412_103921292 112
22 3300032004 Ga0307414_11358201 Ga0307414_113582012 112
23 3300032004 Ga0307414_11823359 Ga0307414_118233592 112
24 3300032005 Ga0307411_10362557 Ga0307411_103625572 112
25 3300039450 Ga0436363_1359564 Ga0436363_1359564_410_763 112
26 3300046507 Ga0495606_0070162 Ga0495606_0070162_521_862 112
27 3300013100 Ga0157373_10484993 Ga0157373_104849931 113
28 3300025917 Ga0207660_10006609 Ga0207660_100066098 113
29 3300026078 Ga0207702_10092297 Ga0207702_100922972 113
30 3300028786 Ga0307517_10033528 Ga0307517_100335281 113
31 3300053087 Ga0500643_000648 Ga0500643_000648_2762_3109 113
32 3300001979 JGI24740J21852_10050116 JGI24740J21852_100501162 114
33 3300001989 JGI24739J22299_10021013 JGI24739J22299_100210132 114
34 3300001990 JGI24737J22298_10000449 JGI24737J22298_100004499 114
35 3300002067 JGI24735J21928_10018127 JGI24735J21928_100181272 114
36 3300002075 JGI24738J21930_10015999 JGI24738J21930_100159992 114
37 3300005327 Ga0070658_10043537 Ga0070658_100435373 114
38 3300005329 Ga0070683_100002084 Ga0070683_10000208410 114
39 3300005329 Ga0070683_100533715 Ga0070683_1005337151 114
40 3300005329 Ga0070683_101351190 Ga0070683_1013511901 114
41 3300005331 Ga0070670_100054132 Ga0070670_1000541323 114
42 3300005331 Ga0070670_101155148 Ga0070670_1011551482 114
43 3300005334 Ga0068869_100536538 Ga0068869_1005365382 114
44 3300005336 Ga0070680_100359913 Ga0070680_1003599132 114
45 3300005336 Ga0070680_100564910 Ga0070680_1005649101 114
46 3300005336 Ga0070680_101202092 Ga0070680_1012020921 114
47 3300005338 Ga0068868_100099367 Ga0068868_1000993673 114
48 3300005338 Ga0068868_100279650 Ga0068868_1002796502 114
49 3300005338 Ga0068868_100610676 Ga0068868_1006106762 114
50 3300005339 Ga0070660_100000655 Ga0070660_10000065520 114
51 3300005339 Ga0070660_100260686 Ga0070660_1002606862 114
52 3300005344 Ga0070661_100000050 Ga0070661_1000000503 114
53 3300005344 Ga0070661_100028272 Ga0070661_1000282724 114
54 3300005344 Ga0070661_100249422 Ga0070661_1002494222 114
55 3300005344 Ga0070661_100629060 Ga0070661_1006290602 114
56 3300005344 Ga0070661_100871143 Ga0070661_1008711432 114
57 3300005355 Ga0070671_100046993 Ga0070671_1000469933 114
58 3300005355 Ga0070671_100136153 Ga0070671_1001361533 114
59 3300005356 Ga0070674_100332861 Ga0070674_1003328612 114
60 3300005364 Ga0070673_100884669 Ga0070673_1008846692 114
61 3300005366 Ga0070659_100000081 Ga0070659_10000008122 114
62 3300005366 Ga0070659_100012246 Ga0070659_1000122463 114
63 3300005366 Ga0070659_100078701 Ga0070659_1000787014 114
64 3300005366 Ga0070659_100274058 Ga0070659_1002740582 114
65 3300005366 Ga0070659_100708581 Ga0070659_1007085811 114
66 3300005367 Ga0070667_100006855 Ga0070667_1000068557 114
67 3300005367 Ga0070667_100006864 Ga0070667_1000068644 114
68 3300005435 Ga0070714_100157121 Ga0070714_1001571212 114
69 3300005435 Ga0070714_100249853 Ga0070714_1002498532 114
70 3300005436 Ga0070713_100535718 Ga0070713_1005357182 114
71 3300005455 Ga0070663_100000770 Ga0070663_1000007702 114
72 3300005455 Ga0070663_100109771 Ga0070663_1001097712 114
73 3300005455 Ga0070663_100144435 Ga0070663_1001444352 114
74 3300005457 Ga0070662_100000025 Ga0070662_10000002521 114
75 3300005457 Ga0070662_100457077 Ga0070662_1004570772 114
76 3300005457 Ga0070662_100895458 Ga0070662_1008954581 114
77 3300005458 Ga0070681_10068412 Ga0070681_100684126 114
78 3300005530 Ga0070679_100372368 Ga0070679_1003723682 114
79 3300005530 Ga0070679_101316344 Ga0070679_1013163441 114
80 3300005539 Ga0068853_100000061 Ga0068853_10000006114 114
81 3300005539 Ga0068853_100072900 Ga0068853_1000729002 114
82 3300005539 Ga0068853_100249297 Ga0068853_1002492972 114
83 3300005539 Ga0068853_100311886 Ga0068853_1003118862 114
84 3300005539 Ga0068853_101134654 Ga0068853_1011346542 114
85 3300005543 Ga0070672_100111837 Ga0070672_1001118372 114
86 3300005544 Ga0070686_100343623 Ga0070686_1003436232 114
87 3300005544 Ga0070686_100581358 Ga0070686_1005813582 114
88 3300005545 Ga0070695_100029893 Ga0070695_1000298932 114
89 3300005546 Ga0070696_100560549 Ga0070696_1005605492 114
90 3300005546 Ga0070696_101608051 Ga0070696_1016080512 114
91 3300005547 Ga0070693_100000262 Ga0070693_10000026214 114
92 3300005547 Ga0070693_100181610 Ga0070693_1001816102 114
93 3300005547 Ga0070693_100290581 Ga0070693_1002905811 114
94 3300005547 Ga0070693_101221615 Ga0070693_1012216152 114
95 3300005548 Ga0070665_100003772 Ga0070665_1000037725 114
96 3300005548 Ga0070665_100016112 Ga0070665_1000161129 114
97 3300005548 Ga0070665_100338274 Ga0070665_1003382742 114
98 3300005549 Ga0070704_100927954 Ga0070704_1009279542 114
99 3300005563 Ga0068855_100000326 Ga0068855_1000003263 114
100 3300005563 Ga0068855_100196832 Ga0068855_1001968325 114
101 3300005563 Ga0068855_100364042 Ga0068855_1003640422 114
102 3300005563 Ga0068855_100429941 Ga0068855_1004299412 114
103 3300005563 Ga0068855_100776746 Ga0068855_1007767462 114
104 3300005564 Ga0070664_100000012 Ga0070664_10000001283 114
105 3300005564 Ga0070664_100011146 Ga0070664_1000111467 114
106 3300005564 Ga0070664_100710987 Ga0070664_1007109872 114
107 3300005564 Ga0070664_100957569 Ga0070664_1009575692 114
108 3300005577 Ga0068857_100076334 Ga0068857_1000763343 114
109 3300005577 Ga0068857_100763471 Ga0068857_1007634712 114
110 3300005578 Ga0068854_100017414 Ga0068854_1000174145 114
111 3300005578 Ga0068854_100035698 Ga0068854_1000356984 114
112 3300005578 Ga0068854_100088802 Ga0068854_1000888023 114
113 3300005578 Ga0068854_101200530 Ga0068854_1012005302 114
114 3300005614 Ga0068856_100018219 Ga0068856_1000182196 114
115 3300005614 Ga0068856_100103624 Ga0068856_1001036242 114
116 3300005616 Ga0068852_100004772 Ga0068852_1000047728 114
117 3300005616 Ga0068852_100018647 Ga0068852_1000186477 114
118 3300005616 Ga0068852_100474936 Ga0068852_1004749362 114
119 3300005616 Ga0068852_101028940 Ga0068852_1010289401 114
120 3300005617 Ga0068859_100177662 Ga0068859_1001776623 114
121 3300005617 Ga0068859_100977435 Ga0068859_1009774352 114
122 3300005618 Ga0068864_100108986 Ga0068864_1001089862 114
123 3300005618 Ga0068864_100328427 Ga0068864_1003284272 114
124 3300005834 Ga0068851_10325041 Ga0068851_103250412 114
125 3300005842 Ga0068858_101005764 Ga0068858_1010057642 114
126 3300006237 Ga0097621_100236355 Ga0097621_1002363552 114
127 3300006844 Ga0075428_100566682 Ga0075428_1005666822 114
128 3300006846 Ga0075430_100988442 Ga0075430_1009884421 114
129 3300006880 Ga0075429_100438106 Ga0075429_1004381062 114
130 3300006931 Ga0097620_100177663 Ga0097620_1001776633 114
131 3300006931 Ga0097620_100977329 Ga0097620_1009773292 114
132 3300009093 Ga0105240_10222233 Ga0105240_102222333 114
133 3300009094 Ga0111539_10019592 Ga0111539_100195925 114
134 3300009174 Ga0105241_10292296 Ga0105241_102922962 114
135 3300009174 Ga0105241_10659303 Ga0105241_106593032 114
136 3300009177 Ga0105248_10000299 Ga0105248_1000029947 114
137 3300009177 Ga0105248_10017257 Ga0105248_100172576 114
138 3300009177 Ga0105248_10189796 Ga0105248_101897962 114
139 3300009545 Ga0105237_10549400 Ga0105237_105494002 114
140 3300009551 Ga0105238_10015731 Ga0105238_100157312 114
141 3300009551 Ga0105238_10060292 Ga0105238_100602927 114
142 3300009551 Ga0105238_10110891 Ga0105238_101108913 114
143 3300009551 Ga0105238_13076491 Ga0105238_130764911 114
144 3300013100 Ga0157373_10014133 Ga0157373_100141337 114
145 3300013100 Ga0157373_10283973 Ga0157373_102839731 114
146 3300013100 Ga0157373_10482280 Ga0157373_104822802 114
147 3300013102 Ga0157371_10015665 Ga0157371_100156652 114
148 3300013102 Ga0157371_10264200 Ga0157371_102642002 114
149 3300013104 Ga0157370_10085435 Ga0157370_100854353 114
150 3300013104 Ga0157370_10549237 Ga0157370_105492371 114
151 3300013105 Ga0157369_10002992 Ga0157369_1000299212 114
152 3300013105 Ga0157369_10127806 Ga0157369_101278063 114
153 3300013105 Ga0157369_10479276 Ga0157369_104792762 114
154 3300013297 Ga0157378_11593221 Ga0157378_115932212 114
155 3300013306 Ga0163162_10037566 Ga0163162_100375662 114
156 3300013307 Ga0157372_10056913 Ga0157372_100569136 114
157 3300014325 Ga0163163_10000341 Ga0163163_1000034121 114
158 3300017792 Ga0163161_11523236 Ga0163161_115232361 114
159 3300021384 Ga0213876_10049816 Ga0213876_100498162 114
160 3300025298 Ga0209050_1043474 Ga0209050_10434742 114
161 3300025315 Ga0207697_10126410 Ga0207697_101264102 114
162 3300025321 Ga0207656_10078270 Ga0207656_100782702 114
163 3300025903 Ga0207680_10000887 Ga0207680_100008879 114
164 3300025903 Ga0207680_10130522 Ga0207680_101305221 114
165 3300025904 Ga0207647_10004363 Ga0207647_100043637 114
166 3300025904 Ga0207647_10076073 Ga0207647_100760732 114
167 3300025909 Ga0207705_10000095 Ga0207705_1000009513 114
168 3300025909 Ga0207705_10050846 Ga0207705_100508462 114
169 3300025912 Ga0207707_10869506 Ga0207707_108695062 114
170 3300025914 Ga0207671_10562035 Ga0207671_105620351 114
171 3300025917 Ga0207660_11076701 Ga0207660_110767012 114
172 3300025918 Ga0207662_10277833 Ga0207662_102778332 114
173 3300025919 Ga0207657_10000028 Ga0207657_1000002842 114
174 3300025919 Ga0207657_10184162 Ga0207657_101841622 114
175 3300025919 Ga0207657_10516205 Ga0207657_105162052 114
176 3300025920 Ga0207649_10000014 Ga0207649_10000014228 114
177 3300025920 Ga0207649_10887294 Ga0207649_108872942 114
178 3300025921 Ga0207652_10294378 Ga0207652_102943782 114
179 3300025924 Ga0207694_10018630 Ga0207694_100186303 114
180 3300025924 Ga0207694_10036590 Ga0207694_100365903 114
181 3300025924 Ga0207694_10095571 Ga0207694_100955712 114
182 3300025924 Ga0207694_10435372 Ga0207694_104353722 114
183 3300025925 Ga0207650_10940412 Ga0207650_109404122 114
184 3300025928 Ga0207700_10379499 Ga0207700_103794992 114
185 3300025931 Ga0207644_10006329 Ga0207644_100063297 114
186 3300025931 Ga0207644_10241991 Ga0207644_102419912 114
187 3300025932 Ga0207690_10000042 Ga0207690_1000004251 114
188 3300025932 Ga0207690_10016774 Ga0207690_100167745 114
189 3300025932 Ga0207690_10081138 Ga0207690_100811382 114
190 3300025932 Ga0207690_10086416 Ga0207690_100864163 114
191 3300025933 Ga0207706_10000029 Ga0207706_1000002947 114
192 3300025933 Ga0207706_10120110 Ga0207706_101201105 114
193 3300025933 Ga0207706_10540305 Ga0207706_105403051 114
194 3300025933 Ga0207706_10890414 Ga0207706_108904141 114
195 3300025937 Ga0207669_10269916 Ga0207669_102699162 114
196 3300025940 Ga0207691_10123283 Ga0207691_101232832 114
197 3300025941 Ga0207711_10004966 Ga0207711_100049662 114
198 3300025941 Ga0207711_10018913 Ga0207711_100189135 114
199 3300025941 Ga0207711_10361332 Ga0207711_103613322 114
200 3300025942 Ga0207689_10292394 Ga0207689_102923942 114
201 3300025944 Ga0207661_10002316 Ga0207661_1000231612 114
202 3300025944 Ga0207661_10505451 Ga0207661_105054512 114
203 3300025945 Ga0207679_10000092 Ga0207679_1000009212 114
204 3300025945 Ga0207679_10006544 Ga0207679_100065443 114
205 3300025945 Ga0207679_11343459 Ga0207679_113434592 114
206 3300025949 Ga0207667_10007919 Ga0207667_100079196 114
207 3300025949 Ga0207667_10231318 Ga0207667_102313182 114
208 3300025949 Ga0207667_11191731 Ga0207667_111917312 114
209 3300025960 Ga0207651_10196950 Ga0207651_101969502 114
210 3300025981 Ga0207640_10008846 Ga0207640_100088463 114
211 3300025981 Ga0207640_10015676 Ga0207640_100156764 114
212 3300025981 Ga0207640_10203214 Ga0207640_102032142 114
213 3300025986 Ga0207658_10068079 Ga0207658_100680795 114
214 3300025986 Ga0207658_10161808 Ga0207658_101618084 114
215 3300025986 Ga0207658_10261275 Ga0207658_102612752 114
216 3300026023 Ga0207677_10300959 Ga0207677_103009592 114
217 3300026023 Ga0207677_10651410 Ga0207677_106514102 114
218 3300026023 Ga0207677_11073069 Ga0207677_110730691 114
219 3300026035 Ga0207703_10630192 Ga0207703_106301922 114
220 3300026041 Ga0207639_10001173 Ga0207639_100011732 114
221 3300026041 Ga0207639_10001913 Ga0207639_100019133 114
222 3300026041 Ga0207639_10156231 Ga0207639_101562312 114
223 3300026041 Ga0207639_11077343 Ga0207639_110773432 114
224 3300026067 Ga0207678_10075506 Ga0207678_100755063 114
225 3300026067 Ga0207678_10197243 Ga0207678_101972432 114
226 3300026067 Ga0207678_10247224 Ga0207678_102472242 114
227 3300026067 Ga0207678_10644513 Ga0207678_106445132 114
228 3300026078 Ga0207702_10001460 Ga0207702_1000146020 114
229 3300026078 Ga0207702_10076517 Ga0207702_100765173 114
230 3300026078 Ga0207702_10804581 Ga0207702_108045812 114
231 3300026078 Ga0207702_11201002 Ga0207702_112010022 114
232 3300026088 Ga0207641_11592277 Ga0207641_115922772 114
233 3300026095 Ga0207676_10066212 Ga0207676_100662124 114
234 3300026116 Ga0207674_10015792 Ga0207674_1001579212 114
235 3300026116 Ga0207674_10037552 Ga0207674_100375525 114
236 3300026142 Ga0207698_10028690 Ga0207698_100286904 114
237 3300026142 Ga0207698_10054136 Ga0207698_100541362 114
238 3300026142 Ga0207698_10144482 Ga0207698_101444822 114
239 3300026142 Ga0207698_11141923 Ga0207698_111419232 114
240 3300028379 Ga0268266_10004995 Ga0268266_100049956 114
241 3300028379 Ga0268266_10008332 Ga0268266_100083325 114
242 3300028381 Ga0268264_10015006 Ga0268264_100150062 114
243 3300035091 Ga0373951_0182564 Ga0373951_0182564_11_355 114
244 3300035691 Ga0373931_0039805 Ga0373931_0039805_324_668 114
245 3300037312 Ga0395899_0024337 Ga0395899_0024337_3447_3809 114
246 3300037312 Ga0395899_0671109 Ga0395899_0671109_280_624 114
247 3300037312 Ga0395899_0924232 Ga0395899_0924232_139_483 114
248 3300037418 Ga0395900_0098849 Ga0395900_0098849_752_1096 114
249 3300037418 Ga0395900_0157993 Ga0395900_0157993_1222_1566 114
250 3300037418 Ga0395900_0264978 Ga0395900_0264978_770_1132 114
251 3300037418 Ga0395900_0692205 Ga0395900_0692205_214_558 114
252 3300037418 Ga0395900_0741212 Ga0395900_0741212_302_646 114
253 3300037418 Ga0395900_0744258 Ga0395900_0744258_15_359 114
254 3300037466 Ga0395898_0117199 Ga0395898_0117199_549_911 114
255 3300037466 Ga0395898_0505671 Ga0395898_0505671_627_971 114
256 3300037471 Ga0395905_0009546 Ga0395905_0009546_3966_4310 114
257 3300037471 Ga0395905_0013901 Ga0395905_0013901_2304_2666 114
258 3300037471 Ga0395905_0132411 Ga0395905_0132411_1629_1973 114
259 3300037471 Ga0395905_0984333 Ga0395905_0984333_293_652 114
260 3300037471 Ga0395905_0995443 Ga0395905_0995443_162_506 114
261 3300037471 Ga0395905_1673055 Ga0395905_1673055_100_444 114
262 3300037471 Ga0395905_1816756 Ga0395905_1816756_36_380 114
263 3300038443 Ga0395901_0006769 Ga0395901_0006769_9103_9447 114
264 3300038443 Ga0395901_0028274 Ga0395901_0028274_5041_5403 114
265 3300038443 Ga0395901_0229819 Ga0395901_0229819_524_868 114
266 3300038443 Ga0395901_0736353 Ga0395901_0736353_501_845 114
267 3300039437 Ga0436365_0470515 Ga0436365_0470515_30660_31004 114
268 3300041491 Ga0451833_0917483 Ga0451833_0917483_277_636 114
269 3300044694 Ga0466963_0043015 Ga0466963_0043015_2498_2842 114
270 3300044694 Ga0466963_0133237 Ga0466963_0133237_343_687 114
271 3300044706 Ga0466964_0002180 Ga0466964_0002180_1098_1442 114
272 3300044842 Ga0466957_0277008 Ga0466957_0277008_14_358 114
273 3300045836 Ga0466958_0613679 Ga0466958_0613679_295_639 114
274 3300045976 Ga0466967_0006341 Ga0466967_0006341_7830_8192 114
275 3300045976 Ga0466967_0011909 Ga0466967_0011909_3110_3454 114
276 3300045976 Ga0466967_0775609 Ga0466967_0775609_174_518 114
277 3300046457 Ga0495590_0208226 Ga0495590_0208226_67_417 114
278 3300046460 Ga0495638_0299030 Ga0495638_0299030_114_464 114
279 3300046506 Ga0495583_0033180 Ga0495583_0033180_760_1110 114
280 3300046660 Ga0495625_0002466 Ga0495625_0002466_2572_2922 114
281 3300046660 Ga0495625_0040688 Ga0495625_0040688_1170_1529 114
282 3300046684 Ga0495669_0037397 Ga0495669_0037397_1512_1856 114
283 3300047445 Ga0495677_0079168 Ga0495677_0079168_698_1048 114
284 3300048907 Ga0496104_0158458 Ga0496104_0158458_812_1156 114
285 3300048908 Ga0496105_1129128 Ga0496105_1129128_11_355 114
286 3300048910 Ga0496107_0212602 Ga0496107_0212602_799_1143 114
287 3300048910 Ga0496107_0632890 Ga0496107_0632890_208_552 114
288 3300048912 Ga0496109_1439469 Ga0496109_1439469_70_414 114
289 3300048914 Ga0496111_0119419 Ga0496111_0119419_812_1156 114
290 3300048916 Ga0496113_0398085 Ga0496113_0398085_491_835 114
291 3300049584 Ga0501068_0232381 Ga0501068_0232381_505_867 114
292 3300050508 nmdc:mga09592_349957_c1 nmdc:mga09592_349957_c1_468_833 114
293 3300050509 nmdc:mga0qj67_981454_c1 nmdc:mga0qj67_981454_c1_275_640 114
294 3300053090 Ga0500646_0048056 Ga0500646_0048056_806_1165 114
295 3300053730 Ga0500645_000173 Ga0500645_000173_31885_32247 114
296 3300053739 Ga0500587_000103 Ga0500587_000103_4114_4473 114

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a1v-assembly1.cif.gz_A crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 0.7912 2 105
2a1v-assembly1.cif.gz_A crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 0.7251 2 105
2fki-assembly1.cif.gz_A nmr structure of protein yjbr from escherichia coli; northeast structural genomics consortium target er226 0.6904 1 106
2fki-assembly1.cif.gz_A nmr structure of protein yjbr from escherichia coli; northeast structural genomics consortium target er226 0.6465 1 106
2kfp-assembly1.cif.gz_A solution nmr structure of pspto_3016 from pseudomonas syringae. northeast structural genomics consortium target psr293. 0.6403 1 112
ID Description Score Start End Superfamily
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.8051 4 102 3.90.1150.30
af_P9WL91_4_123_3.30.70.1230 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.8028 4 102 3.30.70.1230
2a1vA00 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7912 2 105 3.90.1150.30
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7673 1 106 3.90.1150.30
2a1vA00 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7252 2 105 3.90.1150.30
ID Description Score Start End GO Terms
AF-A0A537MEV7-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.984 2 114
AF-A0A2U1G1W0-F1-model_v4 deleted 0.9828 1 114
AF-A0A1W9H641-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9764 4 111
AF-A0A2U1G1W0-F1-model_v4 deleted 0.9743 1 114
AF-A0A1M3PK85-F1-model_v4 MmcQ-like protein 0.9671 1 112

Feature Viewer

pLDDT pTM Quality
93.22 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map