F393095

General Info

Members Datasets Scaffolds Average Seq Length
296 159 592 379

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10000938|Ga0081455_1000093824
Length 426
Sequence MGDELLETDDTESLKKKRGMGPEDLQRRGGEPDSLKDNVIADSDLHVMEPPDLWQRYIDPAYAHAAPIGLTEIPRDMRVRVKNHAVLRLGRVRPVRQEGRRSGWRPEHDSVYAGAEARGWDPASQIEAMDAEGLDLAILFPSRGLFVLGLDSVDMVGPDGLEPEYASAIARAYNDWLADFCGHAPDRMYGAAMVAPHDVDGAVAEARRCVEELGFRAIFLAPGCVNRRPWHHPAYDPLWAEIERLDVPAAFHGGGQTYLRPDFSLEVLDRLMMWHTFNQPLAMQFVTVCMCAGGVLERFPNLRVALLEGNCSWAPWLLHRLDEHNEWTGWYEATDLSLKPSEYFRRNCYLSLEADEATAIHYVDWFGADNLVFSTDYPHGDSQYPHAVEELERLALPHDVKVRIVGENWARLYKVPLAKKAKEAPT

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
83 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
84 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
85 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
86 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
90 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
91 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
92 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
95 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
96 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
97 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
98 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
99 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
100 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
101 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
102 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
103 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
104 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
105 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
106 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
107 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
108 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
109 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
122 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
123 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
124 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
125 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
126 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
127 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
128 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
129 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
130 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
131 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
132 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
133 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
134 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
135 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
136 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
139 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
140 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
141 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
142 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
143 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
144 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
145 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
146 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
147 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
148 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
149 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
150 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
151 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
152 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
153 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
154 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
155 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
156 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
157 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
158 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
159 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.38
Nodule 0
Rhizoplane 3.04
Rhizosphere 93.24
Stem 0
Stem Tuber 0
Unclassified 18.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10000938 3300005937 Bacteria 37262
2 JGI25407J50210_10015958 3300003373 Bacteria 1943
3 Ga0065712_10003294 3300005290 Bacteria 9001
4 Ga0065715_10014053 3300005293 Bacteria 2981
5 Ga0065715_10100357 3300005293 Bacteria 3312
6 Ga0065707_10000893 3300005295 Bacteria 9828
7 Ga0065707_10128103 3300005295 Bacteria 1971
8 Ga0070658_10028188 3300005327 Bacteria 4507
9 Ga0070691_10055451 3300005341 Bacteria 1898
10 Ga0070661_100021393 3300005344 Bacteria 4618
11 Ga0070671_100203666 3300005355 Bacteria 1678
12 Ga0070659_100161119 3300005366 Bacteria 1834
13 Ga0070714_100110203 3300005435 Bacteria 2436
14 Ga0070713_100138824 3300005436 Bacteria 2151
15 Ga0070713_100141220 3300005436 Bacteria 2134
16 Ga0070710_10190959 3300005437 Bacteria 1288
17 Ga0070694_100058900 3300005444 Unclassified 2614
18 Ga0070708_100267689 3300005445 Unclassified 1607
19 Ga0070678_100091613 3300005456 Unclassified 2333
20 Ga0070681_10007990 3300005458 Bacteria 10355
21 Ga0070681_10102186 3300005458 Bacteria 2812
22 Ga0070707_100165807 3300005468 Bacteria 2153
23 Ga0070698_100034436 3300005471 Bacteria 5241
24 Ga0070699_100077820 3300005518 Bacteria 2888
25 Ga0070679_100016107 3300005530 Bacteria 7202
26 Ga0070679_100050104 3300005530 Bacteria 4160
27 Ga0070672_100111722 3300005543 Bacteria 2228
28 Ga0070686_100071837 3300005544 Unclassified 2267
29 Ga0070696_100045637 3300005546 Bacteria 3036
30 Ga0070665_100441512 3300005548 Unclassified 1311
31 Ga0070704_100228489 3300005549 Bacteria 1517
32 Ga0070664_100007282 3300005564 Bacteria 8919
33 Ga0068862_100138115 3300005844 Bacteria 2162
34 Ga0068862_100321433 3300005844 Bacteria 1428
35 Ga0081455_10004681 3300005937 Bacteria 15231
36 Ga0081455_10005776 3300005937 Bacteria 13488
37 Ga0081455_10031636 3300005937 Bacteria 4781
38 Ga0081455_10055788 3300005937 Bacteria 3359
39 Ga0081455_10119127 3300005937 Bacteria 2082
40 Ga0081455_10185609 3300005937 Bacteria 1571
41 Ga0081538_10000591 3300005981 Bacteria 40239
42 Ga0081538_10008456 3300005981 Bacteria 8730
43 Ga0081538_10033463 3300005981 Bacteria 3420
44 Ga0081539_10005278 3300005985 Bacteria 13319
45 Ga0075365_10067748 3300006038 Bacteria 2397
46 Ga0075363_100006224 3300006048 Bacteria 5399
47 Ga0075364_10001382 3300006051 Bacteria 13096
48 Ga0075364_10017294 3300006051 Bacteria 4502
49 Ga0075432_10027978 3300006058 Unclassified 1944
50 Ga0070712_100183505 3300006175 Bacteria 1632
51 Ga0075428_100064135 3300006844 Bacteria 4022
52 Ga0075428_100168756 3300006844 Bacteria 2373
53 Ga0075428_100365157 3300006844 Unclassified 1548
54 Ga0075428_100389805 3300006844 Bacteria 1493
55 Ga0075428_100512831 3300006844 Bacteria 1283
56 Ga0075430_100002433 3300006846 Bacteria 15497
57 Ga0075430_100024855 3300006846 Bacteria 5096
58 Ga0075430_100040761 3300006846 Bacteria 3930
59 Ga0075430_100082712 3300006846 Bacteria 2690
60 Ga0075430_100111628 3300006846 Bacteria 2280
61 Ga0075430_100311933 3300006846 Unclassified 1301
62 Ga0075431_100001156 3300006847 Bacteria 23742
63 Ga0075431_100006140 3300006847 Bacteria 11918
64 Ga0075431_100008891 3300006847 Bacteria 10062
65 Ga0075431_100035556 3300006847 Bacteria 5129
66 Ga0075431_100044341 3300006847 Bacteria 4587
67 Ga0075433_10011799 3300006852 Bacteria 7037
68 Ga0075433_10074429 3300006852 Bacteria 2989
69 Ga0075433_10163919 3300006852 Unclassified 1978
70 Ga0075433_10198813 3300006852 Unclassified 1782
71 Ga0075434_100004634 3300006871 Bacteria 12423
72 Ga0075434_100075215 3300006871 Bacteria 3371
73 Ga0075434_100165028 3300006871 Bacteria 2234
74 Ga0075434_100220712 3300006871 Unclassified 1915
75 Ga0075429_100013408 3300006880 Bacteria 7108
76 Ga0075429_100025166 3300006880 Bacteria 5167
77 Ga0075429_100123108 3300006880 Bacteria 2267
78 Ga0075435_100007562 3300007076 Bacteria 7758
79 Ga0075435_100016094 3300007076 Bacteria 5634
80 Ga0105251_10073409 3300009011 Bacteria 1590
81 Ga0111539_10010295 3300009094 Bacteria 11774
82 Ga0111539_10069568 3300009094 Bacteria 4156
83 Ga0111539_10169997 3300009094 Bacteria 2547
84 Ga0114129_10028087 3300009147 Bacteria 7970
85 Ga0114129_10040170 3300009147 Bacteria 6596
86 Ga0114129_10044251 3300009147 Bacteria 6263
87 Ga0114129_10059264 3300009147 Bacteria 5353
88 Ga0114129_10073409 3300009147 Bacteria 4766
89 Ga0114129_10149206 3300009147 Bacteria 3200
90 Ga0114129_10207285 3300009147 Bacteria 2652
91 Ga0114129_10415678 3300009147 Bacteria 1770
92 Ga0114129_10475333 3300009147 Bacteria 1636
93 Ga0114129_10837504 3300009147 Bacteria 1171
94 Ga0105249_10102549 3300009553 Bacteria 2693
95 Ga0105239_10221200 3300010375 Bacteria 2123
96 Ga0157378_10075598 3300013297 Bacteria 3033
97 Ga0163163_10083639 3300014325 Bacteria 3197
98 Ga0163163_10097398 3300014325 Bacteria 2962
99 Ga0163163_10226382 3300014325 Bacteria 1919
100 Ga0207697_10009393 3300025315 Bacteria 4227
101 Ga0207697_10024795 3300025315 Unclassified 2454
102 Ga0207688_10034474 3300025901 Unclassified 2803
103 Ga0207699_10099002 3300025906 Bacteria 1846
104 Ga0207645_10003251 3300025907 Bacteria 12412
105 Ga0207684_10082914 3300025910 Unclassified 2730
106 Ga0207707_10000695 3300025912 Bacteria 33344
107 Ga0207707_10010848 3300025912 Bacteria 7919
108 Ga0207660_10075459 3300025917 Unclassified 2463
109 Ga0207652_10061899 3300025921 Bacteria 3233
110 Ga0207652_10319610 3300025921 Unclassified 1401
111 Ga0207646_10048442 3300025922 Bacteria 3809
112 Ga0207646_10284451 3300025922 Bacteria 1494
113 Ga0207650_10045489 3300025925 Unclassified 3229
114 Ga0207700_10154399 3300025928 Bacteria 1900
115 Ga0207644_10167764 3300025931 Bacteria 1711
116 Ga0207690_10039620 3300025932 Bacteria 3075
117 Ga0207706_10012990 3300025933 Bacteria 7579
118 Ga0207686_10265292 3300025934 Unclassified 1261
119 Ga0207669_10210863 3300025937 Unclassified 1418
120 Ga0207691_10009692 3300025940 Bacteria 9241
121 Ga0207711_10290254 3300025941 Bacteria 1507
122 Ga0207679_10004114 3300025945 Bacteria 9031
123 Ga0207651_10065530 3300025960 Unclassified 2548
124 Ga0207678_10007973 3300026067 Bacteria 9337
125 Ga0207702_10111568 3300026078 Bacteria 2432
126 Ga0207648_10288107 3300026089 Bacteria 1470
127 Ga0207674_10089394 3300026116 Bacteria 3072
128 Ga0207683_10002029 3300026121 Bacteria 17906
129 Ga0209999_1011357 3300027543 Bacteria 1611
130 Ga0209982_1006403 3300027552 Bacteria 1712
131 Ga0209970_1008737 3300027614 Bacteria 1660
132 Ga0209998_10002991 3300027717 Bacteria 3763
133 Ga0209974_10027188 3300027876 Unclassified 1892
134 Ga0207428_10024893 3300027907 Bacteria 5020
135 Ga0207428_10034055 3300027907 Bacteria 4177
136 Ga0207428_10048151 3300027907 Bacteria 3421
137 Ga0268266_10319549 3300028379 Bacteria 1453
138 Ga0265327_10000014 3300031251 Bacteria 506288
139 Ga0265327_10011943 3300031251 Bacteria 5919
140 Ga0265327_10019819 3300031251 Bacteria 4120
141 Ga0307405_10024357 3300031731 Unclassified 3456
142 Ga0307413_10024975 3300031824 Bacteria 3267
143 Ga0307410_10004271 3300031852 Bacteria 7357
144 Ga0307410_10078569 3300031852 Bacteria 2310
145 Ga0307407_10022257 3300031903 Bacteria 3285
146 Ga0307407_10043781 3300031903 Bacteria 2519
147 Ga0307412_10062345 3300031911 Unclassified 2510
148 Ga0307412_10069948 3300031911 Unclassified 2391
149 Ga0307409_100028054 3300031995 Bacteria 4003
150 Ga0307409_100045199 3300031995 Bacteria 3323
151 Ga0307409_100091129 3300031995 Bacteria 2498
152 Ga0307411_10055782 3300032005 Bacteria 2601
153 Ga0307411_10055891 3300032005 Bacteria 2599
154 Ga0307415_100027046 3300032126 Bacteria 3629
155 Ga0307415_100131611 3300032126 Bacteria 1895
156 Ga0373931_0015276 3300035691 Unclassified 3765
157 Ga0373937_0046979 3300036401 Unclassified 3949
158 Ga0373937_0413622 3300036401 Bacteria 1280
159 Ga0373925_0073689 3300037068 Bacteria 2585
160 Ga0436364_0818082 3300037853 Bacteria 2921
161 Ga0439450_000372 3300042008 Bacteria 5668
162 Ga0439463_014422 3300042016 Bacteria 1947
163 Ga0439464_0003439 3300042439 Bacteria 3992
164 Ga0439460_0001930 3300042461 Bacteria 4957
165 Ga0453683_0000749 3300044673 Bacteria 32781
166 Ga0453683_0001108 3300044673 Bacteria 24627
167 Ga0451576_0155432 3300045051 Bacteria 2386
168 Ga0451576_0182092 3300045051 Bacteria 2193
169 Ga0496100_0040548 3300048903 Bacteria 2963
170 Ga0496101_0013887 3300048904 Bacteria 5406
171 Ga0496102_0020744 3300048905 Bacteria 5807
172 Ga0496104_0026145 3300048907 Bacteria 5385
173 Ga0496104_0083912 3300048907 Bacteria 3039
174 Ga0496105_0028236 3300048908 Bacteria 4589
175 Ga0496112_0087263 3300048915 Unclassified 3087
176 Ga0496114_0020167 3300048917 Bacteria 5409
177 Ga0496115_0027976 3300048918 Bacteria 4414
178 Ga0501031_0075115 3300049568 Bacteria 2200
179 Ga0501034_0000146 3300049571 Bacteria 132818
180 Ga0501034_0289878 3300049571 Unclassified 1575
181 Ga0501036_0020892 3300049572 Bacteria 5498
182 Ga0501037_0018792 3300049573 Bacteria 5092
183 Ga0501038_0033136 3300049574 Bacteria 4551
184 Ga0501038_0033206 3300049574 Unclassified 4546
185 Ga0501039_0027860 3300049575 Bacteria 4344
186 Ga0501039_0129895 3300049575 Unclassified 1977
187 Ga0501040_0025913 3300049576 Unclassified 3944
188 Ga0501040_0188988 3300049576 Bacteria 1461
189 Ga0501041_0009436 3300049577 Bacteria 5752
190 Ga0501042_0010940 3300049578 Bacteria 6110
191 Ga0501042_0042366 3300049578 Bacteria 3240
192 Ga0501043_0024153 3300049579 Bacteria 4769
193 Ga0501043_0087163 3300049579 Bacteria 2453
194 Ga0501043_0107112 3300049579 Bacteria 2195
195 Ga0501043_0303125 3300049579 Unclassified 1220
196 Ga0501046_0031382 3300049580 Bacteria 4306
197 Ga0501046_0038793 3300049580 Bacteria 3820
198 Ga0501046_0153493 3300049580 Bacteria 1736
199 Ga0501047_0005229 3300049581 Bacteria 12183
200 Ga0501067_0005106 3300049583 Bacteria 7292
201 Ga0501068_0008906 3300049584 Bacteria 5601
202 Ga0501068_0012323 3300049584 Bacteria 4842
203 Ga0501070_0001641 3300049586 Bacteria 19817
204 Ga0501070_0008902 3300049586 Bacteria 8485
205 Ga0501070_0026615 3300049586 Bacteria 4852
206 Ga0501071_0001015 3300049587 Bacteria 15449
207 Ga0501071_0215946 3300049587 Unclassified 1443
208 Ga0501072_0001860 3300049588 Bacteria 15714
209 Ga0501072_0024597 3300049588 Unclassified 4687
210 Ga0501073_0000960 3300049589 Bacteria 20748
211 Ga0501073_0003074 3300049589 Bacteria 12512
212 Ga0501073_0023236 3300049589 Unclassified 4454
213 Ga0501074_0002036 3300049590 Bacteria 13955
214 Ga0501074_0020346 3300049590 Unclassified 4823
215 Ga0501074_0075202 3300049590 Bacteria 2425
216 Ga0501075_0009046 3300049591 Bacteria 6952
217 Ga0501075_0014437 3300049591 Bacteria 5660
218 Ga0501076_0013357 3300049592 Bacteria 6158
219 Ga0501077_0011938 3300049593 Bacteria 5434
220 Ga0501077_0117734 3300049593 Unclassified 1684
221 Ga0501077_0144864 3300049593 Unclassified 1507
222 Ga0501209_015173 3300049656 Unclassified 1711
223 Ga0501079_0143747 3300049741 Bacteria 1858
224 Ga0501079_0241760 3300049741 Unclassified 1410
225 Ga0501079_0256851 3300049741 Bacteria 1366
226 Ga0501080_0006198 3300049742 Bacteria 10734
227 Ga0501080_0063872 3300049742 Bacteria 3425
228 Ga0501080_0093624 3300049742 Unclassified 2790
229 Ga0501080_0327138 3300049742 Bacteria 1387
230 Ga0501080_0479163 3300049742 Bacteria 1113
231 Ga0501081_0014895 3300049743 Bacteria 5129
232 Ga0501081_0022738 3300049743 Unclassified 4196
233 Ga0501081_0128283 3300049743 Bacteria 1810
234 Ga0501083_0000207 3300049744 Bacteria 38121
235 Ga0501083_0008387 3300049744 Bacteria 7306
236 Ga0501083_0020445 3300049744 Bacteria 4605
237 Ga0501035_0008542 3300049822 Bacteria 9534
238 Ga0501044_0038668 3300049823 Bacteria 4982
239 Ga0501045_0003663 3300049824 Bacteria 10564
240 Ga0501045_0025252 3300049824 Unclassified 4270
241 nmdc:mga03n38_23500_c1 3300050490 Bacteria 2509
242 nmdc:mga00v17_216508_c1 3300050491 Unclassified 1240
243 nmdc:mga00v17_9788_c1 3300050491 Bacteria 5207
244 nmdc:mga0yw44_83155_c1 3300050492 Bacteria 2010
245 nmdc:mga07m45_10006_c1 3300050496 Bacteria 4937
246 nmdc:mga05p37_13025_c1 3300050507 Bacteria 9952
247 nmdc:mga05p37_138099_c1 3300050507 Unclassified 2988
248 nmdc:mga05p37_15132_c1 3300050507 Bacteria 9265
249 nmdc:mga05p37_16956_c1 3300050507 Bacteria 8785
250 nmdc:mga05p37_17110_c1 3300050507 Bacteria 8747
251 nmdc:mga05p37_186057_c1 3300050507 Bacteria 2525
252 nmdc:mga05p37_240984_c1 3300050507 Bacteria 2174
253 nmdc:mga05p37_331475_c1 3300050507 Bacteria 1798
254 nmdc:mga05p37_484290_c1 3300050507 Unclassified 1424
255 nmdc:mga05p37_61431_c1 3300050507 Bacteria 4625
256 nmdc:mga05p37_63788_c1 3300050507 Bacteria 4534
257 nmdc:mga09592_165135_c1 3300050508 Bacteria 1913
258 nmdc:mga09592_19602_c1 3300050508 Bacteria 5554
259 nmdc:mga09592_2764_c1 3300050508 Bacteria 14193
260 nmdc:mga09592_328033_c1 3300050508 Bacteria 1326
261 nmdc:mga09592_39964_c1 3300050508 Bacteria 3941
262 nmdc:mga0qj67_161429_c1 3300050509 Unclassified 1819
263 nmdc:mga0qj67_203664_c1 3300050509 Bacteria 1608
264 nmdc:mga0qj67_205284_c1 3300050509 Bacteria 1601
265 nmdc:mga0qj67_257093_c1 3300050509 Bacteria 1417
266 nmdc:mga0qj67_36881_c1 3300050509 Unclassified 3827
267 nmdc:mga06r32_143845_c1 3300050510 Bacteria 2362
268 nmdc:mga06r32_1772_c1 3300050510 Bacteria 19385
269 nmdc:mga06r32_353709_c1 3300050510 Bacteria 1453
270 nmdc:mga06r32_50688_c1 3300050510 Unclassified 3970
271 nmdc:mga06r32_96403_c1 3300050510 Bacteria 2897
272 nmdc:mga08y16_225854_c1 3300050511 Unclassified 1937
273 nmdc:mga08y16_42170_c1 3300050511 Bacteria 4780
274 nmdc:mga0n895_345245_c1 3300050512 Unclassified 1508
275 nmdc:mga0n895_39343_c1 3300050512 Bacteria 4588
276 nmdc:mga0n895_5809_c1 3300050512 Bacteria 10364
277 nmdc:mga0n895_73010_c1 3300050512 Bacteria 3405
278 nmdc:mga0rr50_60770_c1 3300050513 Bacteria 2844
279 nmdc:mga0rr50_80535_c1 3300050513 Unclassified 2511
280 nmdc:mga0rr50_88802_c1 3300050513 Bacteria 2402
281 nmdc:mga08x19_63429_c1 3300050514 Bacteria 2397
282 nmdc:mga08x19_97970_c1 3300050514 Bacteria 1942
283 nmdc:mga0a205_11899_c1 3300050515 Bacteria 8031
284 nmdc:mga0a205_184055_c1 3300050515 Bacteria 1983
285 nmdc:mga0a205_40705_c1 3300050515 Unclassified 4474
286 nmdc:mga0a205_68939_c1 3300050515 Bacteria 3416
287 Ga0495601_0066160 3300053077 Bacteria 2301
288 Ga0495595_0051543 3300053084 Bacteria 1908
289 Ga0500616_0003752 3300053153 Bacteria 11321
290 Ga0501084_0000208 3300054114 Bacteria 45672
291 Ga0590075_007191 3300059424 Unclassified 2643
292 Ga0590077_005640 3300059426 Bacteria 2559
293 Ga0501082_0118500 3300060353 Unclassified 2293
294 Ga0501082_0148882 3300060353 Bacteria 2033
295 Ga0530510_0020468 3300061734 Bacteria 4703
296 Ga0530510_0111446 3300061734 Bacteria 2004
297 Ga0081455_10000938
298 JGI25407J50210_10015958
299 Ga0065712_10003294
300 Ga0065715_10014053
301 Ga0065715_10100357
302 Ga0065707_10000893
303 Ga0065707_10128103
304 Ga0070658_10028188
305 Ga0070691_10055451
306 Ga0070661_100021393
307 Ga0070671_100203666
308 Ga0070659_100161119
309 Ga0070714_100110203
310 Ga0070713_100138824
311 Ga0070713_100141220
312 Ga0070710_10190959
313 Ga0070694_100058900
314 Ga0070708_100267689
315 Ga0070678_100091613
316 Ga0070681_10007990
317 Ga0070681_10102186
318 Ga0070707_100165807
319 Ga0070698_100034436
320 Ga0070699_100077820
321 Ga0070679_100016107
322 Ga0070679_100050104
323 Ga0070672_100111722
324 Ga0070686_100071837
325 Ga0070696_100045637
326 Ga0070665_100441512
327 Ga0070704_100228489
328 Ga0070664_100007282
329 Ga0068862_100138115
330 Ga0068862_100321433
331 Ga0081455_10004681
332 Ga0081455_10005776
333 Ga0081455_10031636
334 Ga0081455_10055788
335 Ga0081455_10119127
336 Ga0081455_10185609
337 Ga0081538_10000591
338 Ga0081538_10008456
339 Ga0081538_10033463
340 Ga0081539_10005278
341 Ga0075365_10067748
342 Ga0075363_100006224
343 Ga0075364_10001382
344 Ga0075364_10017294
345 Ga0075432_10027978
346 Ga0070712_100183505
347 Ga0075428_100064135
348 Ga0075428_100168756
349 Ga0075428_100365157
350 Ga0075428_100389805
351 Ga0075428_100512831
352 Ga0075430_100002433
353 Ga0075430_100024855
354 Ga0075430_100040761
355 Ga0075430_100082712
356 Ga0075430_100111628
357 Ga0075430_100311933
358 Ga0075431_100001156
359 Ga0075431_100006140
360 Ga0075431_100008891
361 Ga0075431_100035556
362 Ga0075431_100044341
363 Ga0075433_10011799
364 Ga0075433_10074429
365 Ga0075433_10163919
366 Ga0075433_10198813
367 Ga0075434_100004634
368 Ga0075434_100075215
369 Ga0075434_100165028
370 Ga0075434_100220712
371 Ga0075429_100013408
372 Ga0075429_100025166
373 Ga0075429_100123108
374 Ga0075435_100007562
375 Ga0075435_100016094
376 Ga0105251_10073409
377 Ga0111539_10010295
378 Ga0111539_10069568
379 Ga0111539_10169997
380 Ga0114129_10028087
381 Ga0114129_10040170
382 Ga0114129_10044251
383 Ga0114129_10059264
384 Ga0114129_10073409
385 Ga0114129_10149206
386 Ga0114129_10207285
387 Ga0114129_10415678
388 Ga0114129_10475333
389 Ga0114129_10837504
390 Ga0105249_10102549
391 Ga0105239_10221200
392 Ga0157378_10075598
393 Ga0163163_10083639
394 Ga0163163_10097398
395 Ga0163163_10226382
396 Ga0207697_10009393
397 Ga0207697_10024795
398 Ga0207688_10034474
399 Ga0207699_10099002
400 Ga0207645_10003251
401 Ga0207684_10082914
402 Ga0207707_10000695
403 Ga0207707_10010848
404 Ga0207660_10075459
405 Ga0207652_10061899
406 Ga0207652_10319610
407 Ga0207646_10048442
408 Ga0207646_10284451
409 Ga0207650_10045489
410 Ga0207700_10154399
411 Ga0207644_10167764
412 Ga0207690_10039620
413 Ga0207706_10012990
414 Ga0207686_10265292
415 Ga0207669_10210863
416 Ga0207691_10009692
417 Ga0207711_10290254
418 Ga0207679_10004114
419 Ga0207651_10065530
420 Ga0207678_10007973
421 Ga0207702_10111568
422 Ga0207648_10288107
423 Ga0207674_10089394
424 Ga0207683_10002029
425 Ga0209999_1011357
426 Ga0209982_1006403
427 Ga0209970_1008737
428 Ga0209998_10002991
429 Ga0209974_10027188
430 Ga0207428_10024893
431 Ga0207428_10034055
432 Ga0207428_10048151
433 Ga0268266_10319549
434 Ga0265327_10000014
435 Ga0265327_10011943
436 Ga0265327_10019819
437 Ga0307405_10024357
438 Ga0307413_10024975
439 Ga0307410_10004271
440 Ga0307410_10078569
441 Ga0307407_10022257
442 Ga0307407_10043781
443 Ga0307412_10062345
444 Ga0307412_10069948
445 Ga0307409_100028054
446 Ga0307409_100045199
447 Ga0307409_100091129
448 Ga0307411_10055782
449 Ga0307411_10055891
450 Ga0307415_100027046
451 Ga0307415_100131611
452 Ga0373931_0015276
453 Ga0373937_0046979
454 Ga0373937_0413622
455 Ga0373925_0073689
456 Ga0436364_0818082
457 Ga0439450_000372
458 Ga0439463_014422
459 Ga0439464_0003439
460 Ga0439460_0001930
461 Ga0453683_0000749
462 Ga0453683_0001108
463 Ga0451576_0155432
464 Ga0451576_0182092
465 Ga0496100_0040548
466 Ga0496101_0013887
467 Ga0496102_0020744
468 Ga0496104_0026145
469 Ga0496104_0083912
470 Ga0496105_0028236
471 Ga0496112_0087263
472 Ga0496114_0020167
473 Ga0496115_0027976
474 Ga0501031_0075115
475 Ga0501034_0000146
476 Ga0501034_0289878
477 Ga0501036_0020892
478 Ga0501037_0018792
479 Ga0501038_0033136
480 Ga0501038_0033206
481 Ga0501039_0027860
482 Ga0501039_0129895
483 Ga0501040_0025913
484 Ga0501040_0188988
485 Ga0501041_0009436
486 Ga0501042_0010940
487 Ga0501042_0042366
488 Ga0501043_0024153
489 Ga0501043_0087163
490 Ga0501043_0107112
491 Ga0501043_0303125
492 Ga0501046_0031382
493 Ga0501046_0038793
494 Ga0501046_0153493
495 Ga0501047_0005229
496 Ga0501067_0005106
497 Ga0501068_0008906
498 Ga0501068_0012323
499 Ga0501070_0001641
500 Ga0501070_0008902
501 Ga0501070_0026615
502 Ga0501071_0001015
503 Ga0501071_0215946
504 Ga0501072_0001860
505 Ga0501072_0024597
506 Ga0501073_0000960
507 Ga0501073_0003074
508 Ga0501073_0023236
509 Ga0501074_0002036
510 Ga0501074_0020346
511 Ga0501074_0075202
512 Ga0501075_0009046
513 Ga0501075_0014437
514 Ga0501076_0013357
515 Ga0501077_0011938
516 Ga0501077_0117734
517 Ga0501077_0144864
518 Ga0501209_015173
519 Ga0501079_0143747
520 Ga0501079_0241760
521 Ga0501079_0256851
522 Ga0501080_0006198
523 Ga0501080_0063872
524 Ga0501080_0093624
525 Ga0501080_0327138
526 Ga0501080_0479163
527 Ga0501081_0014895
528 Ga0501081_0022738
529 Ga0501081_0128283
530 Ga0501083_0000207
531 Ga0501083_0008387
532 Ga0501083_0020445
533 Ga0501035_0008542
534 Ga0501044_0038668
535 Ga0501045_0003663
536 Ga0501045_0025252
537 nmdc:mga03n38_23500_c1
538 nmdc:mga00v17_216508_c1
539 nmdc:mga00v17_9788_c1
540 nmdc:mga0yw44_83155_c1
541 nmdc:mga07m45_10006_c1
542 nmdc:mga05p37_13025_c1
543 nmdc:mga05p37_138099_c1
544 nmdc:mga05p37_15132_c1
545 nmdc:mga05p37_16956_c1
546 nmdc:mga05p37_17110_c1
547 nmdc:mga05p37_186057_c1
548 nmdc:mga05p37_240984_c1
549 nmdc:mga05p37_331475_c1
550 nmdc:mga05p37_484290_c1
551 nmdc:mga05p37_61431_c1
552 nmdc:mga05p37_63788_c1
553 nmdc:mga09592_165135_c1
554 nmdc:mga09592_19602_c1
555 nmdc:mga09592_2764_c1
556 nmdc:mga09592_328033_c1
557 nmdc:mga09592_39964_c1
558 nmdc:mga0qj67_161429_c1
559 nmdc:mga0qj67_203664_c1
560 nmdc:mga0qj67_205284_c1
561 nmdc:mga0qj67_257093_c1
562 nmdc:mga0qj67_36881_c1
563 nmdc:mga06r32_143845_c1
564 nmdc:mga06r32_1772_c1
565 nmdc:mga06r32_353709_c1
566 nmdc:mga06r32_50688_c1
567 nmdc:mga06r32_96403_c1
568 nmdc:mga08y16_225854_c1
569 nmdc:mga08y16_42170_c1
570 nmdc:mga0n895_345245_c1
571 nmdc:mga0n895_39343_c1
572 nmdc:mga0n895_5809_c1
573 nmdc:mga0n895_73010_c1
574 nmdc:mga0rr50_60770_c1
575 nmdc:mga0rr50_80535_c1
576 nmdc:mga0rr50_88802_c1
577 nmdc:mga08x19_63429_c1
578 nmdc:mga08x19_97970_c1
579 nmdc:mga0a205_11899_c1
580 nmdc:mga0a205_184055_c1
581 nmdc:mga0a205_40705_c1
582 nmdc:mga0a205_68939_c1
583 Ga0495601_0066160
584 Ga0495595_0051543
585 Ga0500616_0003752
586 Ga0501084_0000208
587 Ga0590075_007191
588 Ga0590077_005640
589 Ga0501082_0118500
590 Ga0501082_0148882
591 Ga0530510_0020468
592 Ga0530510_0111446

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04909

Amidohydro_2

Amidohydrolase

41

415

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6omr-assembly1.cif.gz_B crystal structure of ptmu3 complexed with ptn substrate 0.8527 20 404
6omr-assembly1.cif.gz_B crystal structure of ptmu3 complexed with ptn substrate 0.8414 20 404
7pwy-assembly2.cif.gz_D structure of human dimeric acmsd in complex with the inhibitor tes-1025 0.8273 19 399
7wkl-assembly1.cif.gz_B crystal structure of dihydroxybenzoate decarboxylase mutant f296y from aspergillus oryzae in complex with catechol 0.8264 106 404
7pwy-assembly2.cif.gz_D structure of human dimeric acmsd in complex with the inhibitor tes-1025 0.8249 19 399
ID Description Score Start End Superfamily
4eraA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.795 19 395 3.20.20.140
4ofcD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7946 19 401 3.20.20.140
4eraA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7861 19 395 3.20.20.140
4ofcD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7859 19 401 3.20.20.140
3s4tH00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7849 86 396 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A2V6T3M8-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9801 277 397 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A382QZ67-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9775 88 397 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A2V6TVM0-F1-model_v4 BarH protein 0.9775 142 397 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A2S6UAS7-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9769 168 397 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A3D2AVT5-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9734 271 396 GO:0016787
GO:0016829

Map