F393081

General Info

Members Datasets Scaffolds Average Seq Length
296 182 592 416

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100076077|Ga0070665_1000760773
Length 464
Sequence MLFVTVVAASEAAQSKRVKAIRIVKNFIGRFAGERVERAKCDMLSGMRSSEAVSLGRRAVIQSAFGAVGLGALSRGEARAEPRYADNGPIRAKDKLTITKLETILVKPRWLFLKIHTDAGIVGLGEPITEGRALTCAEAVKEIEPYLVGKDPRPVAKHWQAIYRHAFYRGGPILTSALSGIDQALWDIKGKALGVPVYELLGGPTRDRVRVYAHASTPEQMKTLQKQGFSAFKTGVAKNKTRRNRYIETQADIEYAAERFAALRQAMGKEVDIAIDFHGAISPATAKLLIKAYEPYQPMFIEEPCQAQNHDVMADIARGTFLPIATGERVFTKWGFREVLEKKAAVILQPDLCHAGGITEVRLIAGMAEAYYADVAPHNPLGPISLAAGVQLAASIPNFLCQEQVSLGEGYIKQPFQVRDGFLQLPTGPGLGIELDENAMADKIGHDWRNQESYDPEDNSVVDW

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
91 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
92 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
93 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
94 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
95 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
98 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
99 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
100 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
101 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
102 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
103 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
108 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
109 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
110 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
111 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
112 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
113 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
114 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
115 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
116 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
122 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
125 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
126 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
127 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
128 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
129 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
130 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
134 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
135 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
136 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
137 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
151 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
152 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
157 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
158 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
159 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
160 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
161 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
162 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
164 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
165 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
166 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
167 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
168 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
169 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
172 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
173 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
174 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
175 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
176 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
177 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
178 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
179 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
180 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
181 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
182 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.65
Metatranscriptomes 0
Isolates 1.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.72
Nodule 0
Rhizoplane 0.34
Rhizosphere 93.58
Stem 0
Stem Tuber 0
Unclassified 7.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100076077 3300005548 Unclassified 3364
2 rootH2_10170697 3300003320 Bacteria 1623
3 Ga0065165_1001561 3300005262 Bacteria 23761
4 Ga0070690_100025758 3300005330 Bacteria 3622
5 Ga0068869_100007414 3300005334 Bacteria 7009
6 Ga0070660_100106871 3300005339 Bacteria 2223
7 Ga0070689_100000667 3300005340 Bacteria 20751
8 Ga0070689_100018742 3300005340 Bacteria 5104
9 Ga0070689_100046804 3300005340 Bacteria 3334
10 Ga0070689_100063470 3300005340 Bacteria 2874
11 Ga0070661_100007591 3300005344 Bacteria 7481
12 Ga0070673_100127888 3300005364 Bacteria 2128
13 Ga0070688_100016141 3300005365 Bacteria 4263
14 Ga0070667_100037751 3300005367 Bacteria 4050
15 Ga0070667_100155050 3300005367 Bacteria 2014
16 Ga0070714_100200970 3300005435 Bacteria 1823
17 Ga0070701_10011599 3300005438 Bacteria 3948
18 Ga0070701_10015505 3300005438 Bacteria 3522
19 Ga0070705_100131540 3300005440 Bacteria 1633
20 Ga0070663_100045467 3300005455 Bacteria 3102
21 Ga0070678_100029444 3300005456 Unclassified 3759
22 Ga0070678_100096763 3300005456 Bacteria 2278
23 Ga0070681_10141883 3300005458 Bacteria 2332
24 Ga0068867_100006492 3300005459 Bacteria 8263
25 Ga0070706_100156578 3300005467 Bacteria 2127
26 Ga0070707_100000341 3300005468 Bacteria 45882
27 Ga0070679_100044927 3300005530 Bacteria 4402
28 Ga0070679_100057939 3300005530 Unclassified 3860
29 Ga0068853_100018174 3300005539 Bacteria 5816
30 Ga0070672_100073471 3300005543 Bacteria 2725
31 Ga0070686_100000482 3300005544 Bacteria 24142
32 Ga0070686_100042867 3300005544 Bacteria 2836
33 Ga0070696_100034364 3300005546 Bacteria 3487
34 Ga0070665_100016202 3300005548 Bacteria 7479
35 Ga0070665_100061494 3300005548 Unclassified 3765
36 Ga0068855_100009961 3300005563 Bacteria 11456
37 Ga0068857_100106336 3300005577 Bacteria 2520
38 Ga0068856_100014435 3300005614 Bacteria 7630
39 Ga0070702_100056763 3300005615 Bacteria 2263
40 Ga0068859_100016346 3300005617 Bacteria 7454
41 Ga0068863_100018468 3300005841 Bacteria 6674
42 Ga0068863_100064894 3300005841 Bacteria 3454
43 Ga0068858_100010886 3300005842 Bacteria 8597
44 Ga0068860_100018402 3300005843 Bacteria 6796
45 Ga0068860_100141698 3300005843 Unclassified 2311
46 Ga0081455_10003766 3300005937 Bacteria 17311
47 Ga0081455_10035299 3300005937 Unclassified 4471
48 Ga0081455_10039455 3300005937 Bacteria 4172
49 Ga0081539_10004474 3300005985 Bacteria 15394
50 Ga0070717_10051527 3300006028 Bacteria 3388
51 Ga0075365_10062426 3300006038 Bacteria 2492
52 Ga0075363_100085585 3300006048 Bacteria 1729
53 Ga0075366_10042868 3300006195 Bacteria 2679
54 Ga0097621_100158626 3300006237 Bacteria 1943
55 Ga0075428_100002877 3300006844 Bacteria 18764
56 Ga0075428_100005571 3300006844 Bacteria 13994
57 Ga0075428_100018551 3300006844 Bacteria 7690
58 Ga0075428_100185560 3300006844 Bacteria 2251
59 Ga0075428_100210802 3300006844 Bacteria 2099
60 Ga0075428_100254572 3300006844 Bacteria 1891
61 Ga0075430_100000708 3300006846 Bacteria 25454
62 Ga0075430_100028198 3300006846 Bacteria 4770
63 Ga0075430_100049597 3300006846 Bacteria 3543
64 Ga0075430_100061940 3300006846 Bacteria 3143
65 Ga0075431_100003500 3300006847 Bacteria 15224
66 Ga0075431_100004496 3300006847 Bacteria 13682
67 Ga0075431_100011023 3300006847 Bacteria 9097
68 Ga0075431_100025581 3300006847 Bacteria 6051
69 Ga0075431_100144878 3300006847 Unclassified 2448
70 Ga0075431_100164091 3300006847 Bacteria 2284
71 Ga0075433_10046999 3300006852 Bacteria 3754
72 Ga0075433_10207356 3300006852 Bacteria 1742
73 Ga0075434_100002300 3300006871 Bacteria 16718
74 Ga0075434_100109784 3300006871 Bacteria 2769
75 Ga0075429_100015098 3300006880 Bacteria 6695
76 Ga0075429_100188751 3300006880 Bacteria 1806
77 Ga0075429_100279596 3300006880 Bacteria 1462
78 Ga0097620_100016346 3300006931 Bacteria 7454
79 Ga0105240_10056011 3300009093 Bacteria 4935
80 Ga0105240_10087296 3300009093 Bacteria 3820
81 Ga0111539_10000206 3300009094 Bacteria 69598
82 Ga0111539_10008490 3300009094 Bacteria 13055
83 Ga0111539_10018567 3300009094 Bacteria 8615
84 Ga0111539_10032688 3300009094 Bacteria 6317
85 Ga0111539_10035260 3300009094 Bacteria 6058
86 Ga0111539_10051014 3300009094 Bacteria 4928
87 Ga0111539_10161430 3300009094 Bacteria 2621
88 Ga0111539_10282604 3300009094 Bacteria 1931
89 Ga0114129_10000725 3300009147 Bacteria 41860
90 Ga0114129_10001068 3300009147 Bacteria 36016
91 Ga0105243_10009278 3300009148 Bacteria 7508
92 Ga0105242_10047286 3300009176 Bacteria 3493
93 Ga0105238_10102118 3300009551 Bacteria 2850
94 Ga0105249_10083438 3300009553 Bacteria 2975
95 Ga0105249_10086223 3300009553 Bacteria 2928
96 Ga0157370_10030701 3300013104 Bacteria 5264
97 Ga0157370_10051219 3300013104 Bacteria 3944
98 Ga0157369_10010085 3300013105 Bacteria 10788
99 Ga0157369_10051480 3300013105 Bacteria 4457
100 Ga0157369_10345497 3300013105 Bacteria 1546
101 Ga0157374_10053731 3300013296 Bacteria 3756
102 Ga0157374_10191112 3300013296 Bacteria 2003
103 Ga0157378_10182046 3300013297 Bacteria 1977
104 Ga0157372_10220549 3300013307 Bacteria 2198
105 Ga0157375_10036152 3300013308 Bacteria 4721
106 Ga0163163_10242254 3300014325 Bacteria 1853
107 Ga0157380_10008160 3300014326 Bacteria 7460
108 Ga0157380_10014284 3300014326 Bacteria 5809
109 Ga0157380_10148305 3300014326 Unclassified 2024
110 Ga0157380_10231373 3300014326 Bacteria 1660
111 Ga0157377_10006243 3300014745 Bacteria 5673
112 Ga0209676_1000658 3300025292 Bacteria 49529
113 Ga0207695_10029942 3300025913 Bacteria 6004
114 Ga0207663_10075068 3300025916 Bacteria 2193
115 Ga0207663_10188168 3300025916 Bacteria 1480
116 Ga0207649_10004592 3300025920 Bacteria 7482
117 Ga0207652_10067840 3300025921 Bacteria 3093
118 Ga0207652_10265841 3300025921 Unclassified 1547
119 Ga0207646_10000209 3300025922 Bacteria 80063
120 Ga0207659_10184204 3300025926 Bacteria 1657
121 Ga0207664_10134319 3300025929 Bacteria 2086
122 Ga0207670_10002009 3300025936 Bacteria 10675
123 Ga0207670_10004601 3300025936 Bacteria 7460
124 Ga0207670_10068897 3300025936 Bacteria 2439
125 Ga0207691_10058285 3300025940 Bacteria 3513
126 Ga0207711_10120446 3300025941 Bacteria 2342
127 Ga0207689_10012748 3300025942 Bacteria 7182
128 Ga0207712_10084677 3300025961 Bacteria 2317
129 Ga0207677_10006131 3300026023 Bacteria 6567
130 Ga0207639_10059771 3300026041 Bacteria 2938
131 Ga0207678_10025581 3300026067 Bacteria 5152
132 Ga0207708_10032397 3300026075 Bacteria 3969
133 Ga0207708_10109770 3300026075 Bacteria 2141
134 Ga0207702_10043901 3300026078 Bacteria 3755
135 Ga0207641_10036504 3300026088 Bacteria 4103
136 Ga0207641_10051465 3300026088 Bacteria 3488
137 Ga0207648_10003257 3300026089 Bacteria 17078
138 Ga0207674_10112465 3300026116 Bacteria 2696
139 Ga0207683_10008734 3300026121 Bacteria 8650
140 Ga0207683_10023209 3300026121 Bacteria 5332
141 Ga0209971_1006935 3300027682 Bacteria 2687
142 Ga0207428_10000309 3300027907 Bacteria 64761
143 Ga0207428_10001430 3300027907 Bacteria 25088
144 Ga0207428_10002754 3300027907 Bacteria 17470
145 Ga0207428_10028713 3300027907 Bacteria 4619
146 Ga0268266_10043964 3300028379 Unclassified 3818
147 Ga0268266_10056835 3300028379 Unclassified 3366
148 Ga0268266_10122646 3300028379 Bacteria 2314
149 Ga0268264_10039518 3300028381 Bacteria 3898
150 Ga0307515_10000091 3300028794 Bacteria 214014
151 Ga0265338_10006629 3300028800 Bacteria 14665
152 Ga0265325_10001327 3300031241 Bacteria 17518
153 Ga0265339_10000169 3300031249 Bacteria 55142
154 Ga0265331_10000111 3300031250 Bacteria 108277
155 Ga0265316_10001387 3300031344 Bacteria 26108
156 Ga0265316_10174347 3300031344 Bacteria 1603
157 Ga0307408_100020912 3300031548 Bacteria 4422
158 Ga0265313_10002640 3300031595 Bacteria 15256
159 Ga0265314_10000082 3300031711 Bacteria 143717
160 Ga0265342_10001282 3300031712 Bacteria 23639
161 Ga0316576_10003942 3300031727 Bacteria 8811
162 Ga0307405_10051729 3300031731 Bacteria 2550
163 Ga0307405_10117997 3300031731 Bacteria 1810
164 Ga0316577_10013870 3300031733 Bacteria 4418
165 Ga0316577_10032352 3300031733 Bacteria 2922
166 Ga0307413_10148839 3300031824 Unclassified 1629
167 Ga0307412_10045539 3300031911 Bacteria 2868
168 Ga0307409_100121630 3300031995 Bacteria 2212
169 Ga0307409_100213484 3300031995 Unclassified 1736
170 Ga0307416_100029434 3300032002 Unclassified 4103
171 Ga0307416_100034913 3300032002 Bacteria 3833
172 Ga0307414_10124868 3300032004 Bacteria 1986
173 Ga0307415_100002157 3300032126 Bacteria 9756
174 Ga0373926_0012108 3300035083 Bacteria 2913
175 Ga0373954_0040115 3300035118 Bacteria 2181
176 Ga0373956_0072560 3300035119 Bacteria 1572
177 Ga0373943_0156449 3300035170 Bacteria 1238
178 Ga0373955_0046596 3300035172 Bacteria 2344
179 Ga0316574_0080945 3300035398 Bacteria 2062
180 Ga0373927_0017570 3300035695 Bacteria 4707
181 Ga0373947_0001299 3300035725 Bacteria 15363
182 Ga0373937_0137514 3300036401 Bacteria 2284
183 Ga0316582_0008872 3300036647 Bacteria 5424
184 Ga0316582_0108686 3300036647 Bacteria 1844
185 Ga0373925_0000265 3300037068 Bacteria 54652
186 Ga0395900_0050910 3300037418 Bacteria 4266
187 Ga0395900_0359038 3300037418 Bacteria 1429
188 Ga0316581_0000988 3300037588 Bacteria 6072
189 Ga0436364_0847035 3300037853 Bacteria 11541
190 Ga0436365_0289542 3300039437 Bacteria 5100
191 Ga0436365_1804362 3300039437 Bacteria 1310
192 Ga0436363_0064400 3300039450 Bacteria 2964
193 Ga0450923_003162 3300042125 Bacteria 2453
194 Ga0439435_0019491 3300042436 Bacteria 1740
195 Ga0439435_0038381 3300042436 Bacteria 1331
196 Ga0439464_0044562 3300042439 Bacteria 1271
197 Ga0451577_0015601 3300042876 Bacteria 7060
198 Ga0453683_0026329 3300044673 Unclassified 3693
199 Ga0453684_0000372 3300044712 Bacteria 183969
200 Ga0453684_0010039 3300044712 Bacteria 16293
201 Ga0453684_0017322 3300044712 Bacteria 11171
202 Ga0453684_0056996 3300044712 Bacteria 5063
203 Ga0453684_0073198 3300044712 Bacteria 4321
204 Ga0453684_0196223 3300044712 Unclassified 2357
205 Ga0451576_0026888 3300045051 Bacteria 6183
206 Ga0451576_0052073 3300045051 Bacteria 4290
207 Ga0451576_0092758 3300045051 Bacteria 3141
208 Ga0451576_0160801 3300045051 Bacteria 2344
209 Ga0451576_0285313 3300045051 Bacteria 1726
210 Ga0495580_0141774 3300046472 Bacteria 1666
211 Ga0495580_0210088 3300046472 Bacteria 1339
212 Ga0495628_0186969 3300046516 Bacteria 1565
213 Ga0495613_0144747 3300046689 Bacteria 1697
214 Ga0496115_0039965 3300048918 Bacteria 3727
215 Ga0496126_0074286 3300048929 Bacteria 3020
216 Ga0501031_0014773 3300049568 Bacteria 5075
217 Ga0501032_0001778 3300049569 Bacteria 17010
218 Ga0501033_0006961 3300049570 Bacteria 8829
219 Ga0501034_0006263 3300049571 Bacteria 12801
220 Ga0501034_0022252 3300049571 Bacteria 6460
221 Ga0501034_0284230 3300049571 Bacteria 1593
222 Ga0501036_0001304 3300049572 Bacteria 19109
223 Ga0501037_0000852 3300049573 Bacteria 22742
224 Ga0501038_0003040 3300049574 Bacteria 15641
225 Ga0501039_0031657 3300049575 Bacteria 4078
226 Ga0501042_0028538 3300049578 Bacteria 3933
227 Ga0501043_0002568 3300049579 Bacteria 15354
228 Ga0501043_0009525 3300049579 Bacteria 7613
229 Ga0501046_0002656 3300049580 Bacteria 16682
230 Ga0501047_0007261 3300049581 Bacteria 10415
231 Ga0501047_0070914 3300049581 Unclassified 3354
232 Ga0501047_0170876 3300049581 Bacteria 2043
233 Ga0501048_0004121 3300049582 Bacteria 11077
234 Ga0501067_0001824 3300049583 Bacteria 11700
235 Ga0501068_0000234 3300049584 Bacteria 26949
236 Ga0501068_0183873 3300049584 Bacteria 1322
237 Ga0501070_0005792 3300049586 Bacteria 10543
238 Ga0501070_0015993 3300049586 Bacteria 6306
239 Ga0501070_0095201 3300049586 Bacteria 2464
240 Ga0501072_0002523 3300049588 Bacteria 13706
241 Ga0501073_0089292 3300049589 Bacteria 2142
242 Ga0501074_0011232 3300049590 Bacteria 6508
243 Ga0501076_0020802 3300049592 Bacteria 5025
244 Ga0501216_006318 3300049660 Bacteria 1814
245 Ga0501257_013041 3300049686 Bacteria 1904
246 Ga0501079_0002938 3300049741 Bacteria 12452
247 Ga0501080_0001468 3300049742 Bacteria 19844
248 Ga0501083_0005761 3300049744 Bacteria 8767
249 Ga0501083_0010679 3300049744 Bacteria 6460
250 Ga0501083_0062737 3300049744 Bacteria 2479
251 Ga0501035_0012134 3300049822 Bacteria 7969
252 Ga0501035_0029424 3300049822 Bacteria 5008
253 Ga0501044_0001135 3300049823 Bacteria 31628
254 Ga0501044_0002603 3300049823 Bacteria 20509
255 Ga0501044_0084966 3300049823 Bacteria 3198
256 Ga0501044_0153692 3300049823 Bacteria 2282
257 nmdc:mga00v17_40991_c1 3300050491 Bacteria 2779
258 nmdc:mga0k408_50589_c1 3300050493 Bacteria 2406
259 nmdc:mga0k408_79261_c1 3300050493 Bacteria 1922
260 nmdc:mga05p37_10397_c1 3300050507 Bacteria 11046
261 nmdc:mga05p37_6421_c1 3300050507 Bacteria 13863
262 nmdc:mga09592_25318_c1 3300050508 Bacteria 4911
263 nmdc:mga09592_74587_c1 3300050508 Bacteria 2883
264 nmdc:mga0qj67_11779_c1 3300050509 Bacteria 6564
265 nmdc:mga0qj67_52088_c1 3300050509 Bacteria 3238
266 nmdc:mga0qj67_52881_c1 3300050509 Bacteria 3215
267 nmdc:mga0qj67_97729_c1 3300050509 Bacteria 2365
268 nmdc:mga06r32_10849_c1 3300050510 Bacteria 8205
269 nmdc:mga06r32_146671_c1 3300050510 Unclassified 2337
270 nmdc:mga06r32_158407_c1 3300050510 Unclassified 2246
271 nmdc:mga06r32_16840_c1 3300050510 Bacteria 6666
272 nmdc:mga06r32_221520_c1 3300050510 Unclassified 1880
273 nmdc:mga06r32_297285_c1 3300050510 Bacteria 1601
274 nmdc:mga06r32_42482_c1 3300050510 Bacteria 4322
275 nmdc:mga06r32_9545_c1 3300050510 Bacteria 8762
276 nmdc:mga08y16_29250_c1 3300050511 Bacteria 5805
277 nmdc:mga08y16_325442_c1 3300050511 Unclassified 1582
278 nmdc:mga08y16_339133_c1 3300050511 Bacteria 1545
279 nmdc:mga08y16_4562_c1 3300050511 Bacteria 14438
280 nmdc:mga08y16_5953_c1 3300050511 Bacteria 12786
281 nmdc:mga0rr50_376714_c1 3300050513 Bacteria 1196
282 nmdc:mga08x19_3162_c1 3300050514 Bacteria 9885
283 nmdc:mga0a205_22327_c1 3300050515 Bacteria 5992
284 nmdc:mga0a205_4808_c1 3300050515 Bacteria 12140
285 Ga0500643_000026 3300053087 Bacteria 259231
286 Ga0500555_004319 3300053103 Bacteria 4040
287 Ga0500573_0000012 3300053140 Bacteria 208486
288 Ga0501084_0008170 3300054114 Bacteria 8630
289 Ga0501084_0035009 3300054114 Bacteria 4199
290 Ga0501084_0039659 3300054114 Bacteria 3939
291 Ga0501082_0004844 3300060353 Bacteria 11736
292 Ga0501082_0137769 3300060353 Bacteria 2118
293 2522551194 2522125168 Bacteria 7376607
294 2910247469 2910245624 Bacteria 6935613
295 2911142144 2911138879 Bacteria 5811561
296 8055590782 8055588893 Bacteria 3619545
297 Ga0070665_100076077
298 rootH2_10170697
299 Ga0065165_1001561
300 Ga0070690_100025758
301 Ga0068869_100007414
302 Ga0070660_100106871
303 Ga0070689_100000667
304 Ga0070689_100018742
305 Ga0070689_100046804
306 Ga0070689_100063470
307 Ga0070661_100007591
308 Ga0070673_100127888
309 Ga0070688_100016141
310 Ga0070667_100037751
311 Ga0070667_100155050
312 Ga0070714_100200970
313 Ga0070701_10011599
314 Ga0070701_10015505
315 Ga0070705_100131540
316 Ga0070663_100045467
317 Ga0070678_100029444
318 Ga0070678_100096763
319 Ga0070681_10141883
320 Ga0068867_100006492
321 Ga0070706_100156578
322 Ga0070707_100000341
323 Ga0070679_100044927
324 Ga0070679_100057939
325 Ga0068853_100018174
326 Ga0070672_100073471
327 Ga0070686_100000482
328 Ga0070686_100042867
329 Ga0070696_100034364
330 Ga0070665_100016202
331 Ga0070665_100061494
332 Ga0068855_100009961
333 Ga0068857_100106336
334 Ga0068856_100014435
335 Ga0070702_100056763
336 Ga0068859_100016346
337 Ga0068863_100018468
338 Ga0068863_100064894
339 Ga0068858_100010886
340 Ga0068860_100018402
341 Ga0068860_100141698
342 Ga0081455_10003766
343 Ga0081455_10035299
344 Ga0081455_10039455
345 Ga0081539_10004474
346 Ga0070717_10051527
347 Ga0075365_10062426
348 Ga0075363_100085585
349 Ga0075366_10042868
350 Ga0097621_100158626
351 Ga0075428_100002877
352 Ga0075428_100005571
353 Ga0075428_100018551
354 Ga0075428_100185560
355 Ga0075428_100210802
356 Ga0075428_100254572
357 Ga0075430_100000708
358 Ga0075430_100028198
359 Ga0075430_100049597
360 Ga0075430_100061940
361 Ga0075431_100003500
362 Ga0075431_100004496
363 Ga0075431_100011023
364 Ga0075431_100025581
365 Ga0075431_100144878
366 Ga0075431_100164091
367 Ga0075433_10046999
368 Ga0075433_10207356
369 Ga0075434_100002300
370 Ga0075434_100109784
371 Ga0075429_100015098
372 Ga0075429_100188751
373 Ga0075429_100279596
374 Ga0097620_100016346
375 Ga0105240_10056011
376 Ga0105240_10087296
377 Ga0111539_10000206
378 Ga0111539_10008490
379 Ga0111539_10018567
380 Ga0111539_10032688
381 Ga0111539_10035260
382 Ga0111539_10051014
383 Ga0111539_10161430
384 Ga0111539_10282604
385 Ga0114129_10000725
386 Ga0114129_10001068
387 Ga0105243_10009278
388 Ga0105242_10047286
389 Ga0105238_10102118
390 Ga0105249_10083438
391 Ga0105249_10086223
392 Ga0157370_10030701
393 Ga0157370_10051219
394 Ga0157369_10010085
395 Ga0157369_10051480
396 Ga0157369_10345497
397 Ga0157374_10053731
398 Ga0157374_10191112
399 Ga0157378_10182046
400 Ga0157372_10220549
401 Ga0157375_10036152
402 Ga0163163_10242254
403 Ga0157380_10008160
404 Ga0157380_10014284
405 Ga0157380_10148305
406 Ga0157380_10231373
407 Ga0157377_10006243
408 Ga0209676_1000658
409 Ga0207695_10029942
410 Ga0207663_10075068
411 Ga0207663_10188168
412 Ga0207649_10004592
413 Ga0207652_10067840
414 Ga0207652_10265841
415 Ga0207646_10000209
416 Ga0207659_10184204
417 Ga0207664_10134319
418 Ga0207670_10002009
419 Ga0207670_10004601
420 Ga0207670_10068897
421 Ga0207691_10058285
422 Ga0207711_10120446
423 Ga0207689_10012748
424 Ga0207712_10084677
425 Ga0207677_10006131
426 Ga0207639_10059771
427 Ga0207678_10025581
428 Ga0207708_10032397
429 Ga0207708_10109770
430 Ga0207702_10043901
431 Ga0207641_10036504
432 Ga0207641_10051465
433 Ga0207648_10003257
434 Ga0207674_10112465
435 Ga0207683_10008734
436 Ga0207683_10023209
437 Ga0209971_1006935
438 Ga0207428_10000309
439 Ga0207428_10001430
440 Ga0207428_10002754
441 Ga0207428_10028713
442 Ga0268266_10043964
443 Ga0268266_10056835
444 Ga0268266_10122646
445 Ga0268264_10039518
446 Ga0307515_10000091
447 Ga0265338_10006629
448 Ga0265325_10001327
449 Ga0265339_10000169
450 Ga0265331_10000111
451 Ga0265316_10001387
452 Ga0265316_10174347
453 Ga0307408_100020912
454 Ga0265313_10002640
455 Ga0265314_10000082
456 Ga0265342_10001282
457 Ga0316576_10003942
458 Ga0307405_10051729
459 Ga0307405_10117997
460 Ga0316577_10013870
461 Ga0316577_10032352
462 Ga0307413_10148839
463 Ga0307412_10045539
464 Ga0307409_100121630
465 Ga0307409_100213484
466 Ga0307416_100029434
467 Ga0307416_100034913
468 Ga0307414_10124868
469 Ga0307415_100002157
470 Ga0373926_0012108
471 Ga0373954_0040115
472 Ga0373956_0072560
473 Ga0373943_0156449
474 Ga0373955_0046596
475 Ga0316574_0080945
476 Ga0373927_0017570
477 Ga0373947_0001299
478 Ga0373937_0137514
479 Ga0316582_0008872
480 Ga0316582_0108686
481 Ga0373925_0000265
482 Ga0395900_0050910
483 Ga0395900_0359038
484 Ga0316581_0000988
485 Ga0436364_0847035
486 Ga0436365_0289542
487 Ga0436365_1804362
488 Ga0436363_0064400
489 Ga0450923_003162
490 Ga0439435_0019491
491 Ga0439435_0038381
492 Ga0439464_0044562
493 Ga0451577_0015601
494 Ga0453683_0026329
495 Ga0453684_0000372
496 Ga0453684_0010039
497 Ga0453684_0017322
498 Ga0453684_0056996
499 Ga0453684_0073198
500 Ga0453684_0196223
501 Ga0451576_0026888
502 Ga0451576_0052073
503 Ga0451576_0092758
504 Ga0451576_0160801
505 Ga0451576_0285313
506 Ga0495580_0141774
507 Ga0495580_0210088
508 Ga0495628_0186969
509 Ga0495613_0144747
510 Ga0496115_0039965
511 Ga0496126_0074286
512 Ga0501031_0014773
513 Ga0501032_0001778
514 Ga0501033_0006961
515 Ga0501034_0006263
516 Ga0501034_0022252
517 Ga0501034_0284230
518 Ga0501036_0001304
519 Ga0501037_0000852
520 Ga0501038_0003040
521 Ga0501039_0031657
522 Ga0501042_0028538
523 Ga0501043_0002568
524 Ga0501043_0009525
525 Ga0501046_0002656
526 Ga0501047_0007261
527 Ga0501047_0070914
528 Ga0501047_0170876
529 Ga0501048_0004121
530 Ga0501067_0001824
531 Ga0501068_0000234
532 Ga0501068_0183873
533 Ga0501070_0005792
534 Ga0501070_0015993
535 Ga0501070_0095201
536 Ga0501072_0002523
537 Ga0501073_0089292
538 Ga0501074_0011232
539 Ga0501076_0020802
540 Ga0501216_006318
541 Ga0501257_013041
542 Ga0501079_0002938
543 Ga0501080_0001468
544 Ga0501083_0005761
545 Ga0501083_0010679
546 Ga0501083_0062737
547 Ga0501035_0012134
548 Ga0501035_0029424
549 Ga0501044_0001135
550 Ga0501044_0002603
551 Ga0501044_0084966
552 Ga0501044_0153692
553 nmdc:mga00v17_40991_c1
554 nmdc:mga0k408_50589_c1
555 nmdc:mga0k408_79261_c1
556 nmdc:mga05p37_10397_c1
557 nmdc:mga05p37_6421_c1
558 nmdc:mga09592_25318_c1
559 nmdc:mga09592_74587_c1
560 nmdc:mga0qj67_11779_c1
561 nmdc:mga0qj67_52088_c1
562 nmdc:mga0qj67_52881_c1
563 nmdc:mga0qj67_97729_c1
564 nmdc:mga06r32_10849_c1
565 nmdc:mga06r32_146671_c1
566 nmdc:mga06r32_158407_c1
567 nmdc:mga06r32_16840_c1
568 nmdc:mga06r32_221520_c1
569 nmdc:mga06r32_297285_c1
570 nmdc:mga06r32_42482_c1
571 nmdc:mga06r32_9545_c1
572 nmdc:mga08y16_29250_c1
573 nmdc:mga08y16_325442_c1
574 nmdc:mga08y16_339133_c1
575 nmdc:mga08y16_4562_c1
576 nmdc:mga08y16_5953_c1
577 nmdc:mga0rr50_376714_c1
578 nmdc:mga08x19_3162_c1
579 nmdc:mga0a205_22327_c1
580 nmdc:mga0a205_4808_c1
581 Ga0500643_000026
582 Ga0500555_004319
583 Ga0500573_0000012
584 Ga0501084_0008170
585 Ga0501084_0035009
586 Ga0501084_0039659
587 Ga0501082_0004844
588 Ga0501082_0137769
589 2522551194
590 2910247469
591 2911142144
592 8055590782

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02746

MR_MLE_N

Mandelate racemase / muconate lactonizing enzyme, N-terminal domain

95

202

0.96

PF13378

MR_MLE_C

Enolase C-terminal domain-like

216

439

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ox4-assembly1.cif.gz_H crystal structure of putative dehydratase from zymomonas mobilis zm4 0.9318 48 394
2o56-assembly1.cif.gz_G crystal structure of a member of the enolase superfamily from salmonella typhimurium 0.929 48 394
2o56-assembly1.cif.gz_F crystal structure of a member of the enolase superfamily from salmonella typhimurium 0.929 48 394
3rra-assembly1.cif.gz_A crystal structure of enolase prk14017 (target efi-500653) from ralstonia pickettii 12j with magnesium bound 0.9284 49 415
4e6m-assembly1.cif.gz_A crystal structure of putative dehydratase protein from salmonella enterica subsp. enterica serovar typhimurium (salmonella typhimurium) 0.9258 48 397
ID Description Score Start End Superfamily
af_Q6BF17_1_106_3.30.390.10 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9757 49 152 3.30.390.10
3rraA01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9643 49 145 3.30.390.10
4jn8A01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9543 49 143 3.30.390.10
af_Q6BF17_1_106_3.30.390.10 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9488 49 152 3.30.390.10
3s47B01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9426 47 144 3.30.390.10
ID Description Score Start End GO Terms
AF-A0A2N6RC30-F1-model_v4 deleted 0.9678 174 415
AF-A0A559K315-F1-model_v4 Galactonate dehydratase (EC 4.2.1.6) 0.9644 49 415 GO:0008869
GO:0009063
GO:0034194
GO:0046872
AF-A0A2W1HXQ5-F1-model_v4 deleted 0.9628 49 165
AF-A0A382BTX8-F1-model_v4 Mandelate racemase/muconate lactonizing enzyme N-terminal domain-containing protein 0.962 49 154 GO:0016829
AF-A0A497P195-F1-model_v4 Galactonate dehydratase (EC 4.2.1.6) 0.961 49 415 GO:0008869
GO:0009063
GO:0034194

Map