F393064

General Info

Members Datasets Scaffolds Average Seq Length
296 227 240 296

Family's Representative Sequence

Representative Sequence 3300005459|Ga0068867_100000302|Ga0068867_10000030223
Length 320
Sequence MPDTTALERLDTLRIFTRVAELASFTQAADQLGLPKARVSTAVSQLEGQLGTRLLHRTTRRVQMTQDGQSFYERCKDLLGDVDELQAMFQQGEQSLRGRLRVDMSTGLARDLVIPKLPRFLDAHPLLELELSSTDRRVDLVREGFDCVIRVGALGDSGLIARPVGVFRQINCASPAYLRRHGTPKSLEQMAAHRMVHYVGTLGAKPVGFEVAEAGGVRNIATGGALTVNNAEAYQAACIAGLGIVQAPAIGMRRLVEQGLVREILPRHRAPDLPVNIVYANRRQLPQRVQVFMAWVARLLADEIARAGRRGPSSRGDTHA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
3 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
4 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
5 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
6 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
7 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
8 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
9 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
10 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
11 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
12 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
13 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
14 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
15 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
16 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
17 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
18 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
19 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
20 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
21 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
22 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
23 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
24 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
25 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
26 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
27 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
28 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
29 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
30 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
31 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
32 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
33 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
34 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
35 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
36 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
37 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
38 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
39 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
40 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
41 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
42 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
43 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
44 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
45 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
46 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
47 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
48 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
49 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
50 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
51 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
52 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
53 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
54 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
55 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
56 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
58 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
59 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
60 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
61 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
62 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
63 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
64 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
65 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
66 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
67 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
68 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
69 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
70 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
71 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
72 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
73 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
74 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
75 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
76 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
77 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
78 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
79 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
84 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
87 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
88 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
89 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
90 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
91 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
92 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
93 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
96 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
110 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
111 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
114 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
116 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
142 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
143 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
144 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
145 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
146 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
147 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
148 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
149 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
153 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
154 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
155 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
156 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
157 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
158 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
159 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
160 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
161 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
164 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
165 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
166 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
167 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
168 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
169 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
170 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
171 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
172 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
173 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
176 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
177 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
190 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
191 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
192 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
193 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
194 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
195 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
196 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
197 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
198 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
199 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
202 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
203 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
204 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
205 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
206 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
207 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
208 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
209 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
210 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
211 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
212 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
213 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
214 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
215 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
216 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
217 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
218 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
219 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
220 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
221 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
222 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
223 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
224 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
225 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
226 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
227 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.08
Metatranscriptomes 0
Isolates 18.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.84
Nodule 14.19
Rhizoplane 5.41
Rhizosphere 50
Stem 0
Stem Tuber 0
Unclassified 17.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_278021 2162886007 Bacteria 15984
2 JGI25153J46596_10002033 3300003215 Bacteria 11912
3 JGI25153J46596_10005494 3300003215 Bacteria 6637
4 JGI25153J46596_10009027 3300003215 Bacteria 4688
5 rootH1_10116790 3300003316 Bacteria 1233
6 rootH2_10042655 3300003320 Bacteria 2673
7 rootL2_10154009 3300003322 Bacteria 2075
8 rootH1_10006073 3300003323 Bacteria 6417
9 rootH1_10094221 3300003323 Bacteria 2113
10 JGI25404J52841_10000962 3300003659 Bacteria 4699
11 Ga0055531_10014048 3300003794 Bacteria 3638
12 Ga0065165_1006387 3300005262 Bacteria 6205
13 Ga0070683_100014030 3300005329 Bacteria 6998
14 Ga0070689_100054030 3300005340 Bacteria 3109
15 Ga0070675_100347909 3300005354 Bacteria 1314
16 Ga0070673_100166132 3300005364 Bacteria 1880
17 Ga0070709_10008859 3300005434 Bacteria 5538
18 Ga0070709_10009422 3300005434 Bacteria 5387
19 Ga0070714_100006531 3300005435 Bacteria 9016
20 Ga0070714_100016694 3300005435 Bacteria 5935
21 Ga0070714_100162044 3300005435 Bacteria 2024
22 Ga0070713_100070573 3300005436 Bacteria 2949
23 Ga0070713_100096957 3300005436 Bacteria 2547
24 Ga0070710_10002003 3300005437 Bacteria 9651
25 Ga0070710_10009243 3300005437 Bacteria 4817
26 Ga0070710_10021472 3300005437 Bacteria 3365
27 Ga0070711_100012764 3300005439 Bacteria 5259
28 Ga0070711_100026293 3300005439 Bacteria 3813
29 Ga0070708_100328590 3300005445 Bacteria 1441
30 Ga0070663_100075120 3300005455 Bacteria 2469
31 Ga0068867_100000302 3300005459 Bacteria 32474
32 Ga0068867_100298970 3300005459 Bacteria 1326
33 Ga0070685_10079116 3300005466 Bacteria 1967
34 Ga0070707_100014921 3300005468 Bacteria 7289
35 Ga0070698_100004761 3300005471 Bacteria 14895
36 Ga0070684_100004163 3300005535 Bacteria 10959
37 Ga0070672_100103907 3300005543 Bacteria 2308
38 Ga0070696_100074651 3300005546 Bacteria 2391
39 Ga0070665_100000117 3300005548 Bacteria 149831
40 Ga0070665_100406094 3300005548 Unclassified 1370
41 Ga0068857_100038617 3300005577 Bacteria 4228
42 Ga0068856_100000522 3300005614 Bacteria 42457
43 Ga0068852_100041778 3300005616 Bacteria 3878
44 Ga0068861_100183683 3300005719 Bacteria 1743
45 Ga0068863_100284792 3300005841 Bacteria 1602
46 Ga0081455_10035416 3300005937 Bacteria 4461
47 Ga0081455_10056763 3300005937 Bacteria 3322
48 Ga0081540_1002017 3300005983 Bacteria 16953
49 Ga0081540_1004009 3300005983 Bacteria 11404
50 Ga0081540_1013133 3300005983 Bacteria 5405
51 Ga0081540_1023908 3300005983 Bacteria 3559
52 Ga0081540_1039704 3300005983 Bacteria 2464
53 Ga0081540_1050625 3300005983 Bacteria 2061
54 Ga0070717_10013682 3300006028 Bacteria 6225
55 Ga0070717_10016569 3300006028 Bacteria 5716
56 Ga0075365_10079402 3300006038 Bacteria 2220
57 Ga0075364_10015381 3300006051 Bacteria 4745
58 Ga0075364_10061484 3300006051 Bacteria 2464
59 Ga0070715_10010011 3300006163 Bacteria 3364
60 Ga0070715_10051561 3300006163 Bacteria 1771
61 Ga0070712_100003366 3300006175 Bacteria 9827
62 Ga0070712_100004279 3300006175 Bacteria 8789
63 Ga0070712_100062098 3300006175 Bacteria 2641
64 Ga0075367_10187779 3300006178 Bacteria 1289
65 Ga0075369_10026563 3300006186 Bacteria 2414
66 Ga0075366_10007932 3300006195 Bacteria 5875
67 Ga0075370_10066964 3300006353 Bacteria 2049
68 Ga0075430_100113004 3300006846 Bacteria 2264
69 Ga0075429_100009614 3300006880 Bacteria 8387
70 Ga0105251_10049198 3300009011 Bacteria 2019
71 Ga0105240_10220696 3300009093 Bacteria 2209
72 Ga0111539_10973868 3300009094 Bacteria 986
73 Ga0105243_10000444 3300009148 Bacteria 43105
74 Ga0105248_10214958 3300009177 Bacteria 2166
75 Ga0105239_10233509 3300010375 Bacteria 2064
76 Ga0157373_10043443 3300013100 Bacteria 3210
77 Ga0157370_10043097 3300013104 Bacteria 4345
78 Ga0157378_10074375 3300013297 Bacteria 3057
79 Ga0157375_10320199 3300013308 Bacteria 1715
80 Ga0157375_10412537 3300013308 Bacteria 1517
81 Ga0163163_10178803 3300014325 Bacteria 2169
82 Ga0182008_10063534 3300014497 Bacteria 1818
83 Ga0157377_10000097 3300014745 Bacteria 62513
84 Ga0182006_1042161 3300015261 Bacteria 1789
85 Ga0213872_10000371 3300021361 Bacteria 37677
86 Ga0209677_100354 3300025253 Bacteria 28586
87 Ga0209564_1018669 3300025295 Bacteria 2631
88 Ga0209758_1000106 3300025297 Bacteria 218450
89 Ga0209758_1000400 3300025297 Bacteria 74944
90 Ga0209758_1001741 3300025297 Bacteria 24230
91 Ga0209256_1006734 3300025299 Bacteria 5953
92 Ga0207426_1000374 3300025302 Bacteria 78498
93 Ga0209257_1001596 3300025304 Bacteria 25962
94 Ga0207713_1005898 3300025735 Bacteria 7563
95 Ga0207692_10001373 3300025898 Bacteria 9100
96 Ga0207692_10004848 3300025898 Bacteria 5354
97 Ga0207692_10226520 3300025898 Bacteria 1110
98 Ga0207685_10019414 3300025905 Bacteria 2240
99 Ga0207685_10038172 3300025905 Bacteria 1774
100 Ga0207699_10004028 3300025906 Bacteria 7031
101 Ga0207699_10044944 3300025906 Bacteria 2574
102 Ga0207695_10179375 3300025913 Bacteria 2039
103 Ga0207693_10005283 3300025915 Bacteria 10796
104 Ga0207693_10016926 3300025915 Bacteria 5822
105 Ga0207693_10045234 3300025915 Bacteria 3459
106 Ga0207663_10005267 3300025916 Bacteria 6511
107 Ga0207663_10009740 3300025916 Bacteria 5087
108 Ga0207663_10053789 3300025916 Bacteria 2517
109 Ga0207646_10010610 3300025922 Bacteria 8972
110 Ga0207700_10008824 3300025928 Bacteria 6265
111 Ga0207700_10018648 3300025928 Bacteria 4669
112 Ga0207664_10007824 3300025929 Bacteria 7424
113 Ga0207664_10011744 3300025929 Bacteria 6242
114 Ga0207664_10230512 3300025929 Bacteria 1609
115 Ga0207709_10002441 3300025935 Bacteria 11672
116 Ga0207665_10009097 3300025939 Bacteria 6521
117 Ga0207665_10018945 3300025939 Bacteria 4523
118 Ga0207691_10173550 3300025940 Bacteria 1887
119 Ga0207661_10000109 3300025944 Bacteria 52179
120 Ga0207651_10116422 3300025960 Bacteria 2017
121 Ga0207668_10029851 3300025972 Bacteria 3578
122 Ga0207678_10018200 3300026067 Bacteria 6169
123 Ga0207702_10000014 3300026078 Bacteria 253304
124 Ga0207641_10098419 3300026088 Bacteria 2572
125 Ga0207648_10000471 3300026089 Bacteria 44936
126 Ga0207674_10022235 3300026116 Bacteria 6814
127 Ga0207675_100358057 3300026118 Bacteria 1431
128 Ga0207698_10030264 3300026142 Bacteria 3890
129 Ga0268266_10000079 3300028379 Bacteria 213545
130 Ga0268266_10342577 3300028379 Unclassified 1403
131 Ga0307515_10227816 3300028794 Bacteria 1664
132 Ga0265331_10002994 3300031250 Bacteria 11115
133 Ga0265327_10009570 3300031251 Bacteria 6966
134 Ga0265316_10091453 3300031344 Bacteria 2321
135 Ga0265313_10000149 3300031595 Bacteria 73203
136 Ga0265342_10013530 3300031712 Bacteria 5468
137 Ga0307516_10087956 3300031730 Bacteria 2940
138 Ga0307510_10057689 3300033180 Bacteria 4027
139 Ga0373932_0075526 3300035112 Bacteria 1054
140 Ga0373931_0126403 3300035691 Bacteria 1467
141 Ga0436365_0354289 3300039437 Bacteria 1067
142 Ga0436365_1864084 3300039437 Bacteria 3215
143 Ga0436361_0523055 3300039447 Bacteria 2574
144 Ga0436361_0547244 3300039447 Bacteria 3738
145 Ga0436361_0706587 3300039447 Bacteria 37451
146 Ga0436361_1160656 3300039447 Bacteria 2520
147 Ga0451853_2993189 3300041512 Bacteria 4620
148 Ga0439452_000039 3300042010 Bacteria 145243
149 Ga0439464_0000030 3300042439 Bacteria 18145
150 Ga0466972_0057380 3300044658 Bacteria 1870
151 Ga0495629_0010380 3300046459 Bacteria 6778
152 Ga0495651_0022333 3300046462 Bacteria 4918
153 Ga0495651_0338722 3300046462 Bacteria 997
154 Ga0495650_0000103 3300046471 Bacteria 210023
155 Ga0495631_0096458 3300046518 Bacteria 1273
156 Ga0495648_0103888 3300046524 Bacteria 1561
157 Ga0495652_0022351 3300046529 Bacteria 5611
158 Ga0495654_0001636 3300046530 Bacteria 15177
159 Ga0495640_0020090 3300046533 Bacteria 4922
160 Ga0495622_0022290 3300046557 Bacteria 2951
161 Ga0495622_0038237 3300046557 Bacteria 2234
162 Ga0495668_0019514 3300046616 Bacteria 3906
163 Ga0495611_0011295 3300046648 Bacteria 3786
164 Ga0495635_0021133 3300046663 Bacteria 4535
165 Ga0495657_0020310 3300046675 Bacteria 4777
166 Ga0495613_0012819 3300046689 Bacteria 6234
167 Ga0495624_0039497 3300046690 Bacteria 3025
168 Ga0495649_0109403 3300046694 Bacteria 1466
169 Ga0495581_0122491 3300047315 Bacteria 1513
170 Ga0495604_0043325 3300047317 Bacteria 3523
171 Ga0495676_0169366 3300047321 Bacteria 1538
172 Ga0495686_0152774 3300047472 Bacteria 1354
173 Ga0495602_0058473 3300048088 Bacteria 3374
174 Ga0496102_0103012 3300048905 Bacteria 2654
175 Ga0496102_0167819 3300048905 Bacteria 2066
176 Ga0496104_0325659 3300048907 Bacteria 1450
177 Ga0496105_0009018 3300048908 Bacteria 7783
178 Ga0496105_0045700 3300048908 Bacteria 3614
179 Ga0496106_0011980 3300048909 Bacteria 6400
180 Ga0496107_0202754 3300048910 Bacteria 1474
181 Ga0496108_0356762 3300048911 Bacteria 1276
182 Ga0496109_0516713 3300048912 Bacteria 1127
183 Ga0496110_0162465 3300048913 Bacteria 2025
184 Ga0496112_0011261 3300048915 Bacteria 8159
185 Ga0496112_0070642 3300048915 Bacteria 3451
186 Ga0496114_0256152 3300048917 Bacteria 1540
187 Ga0496115_0027387 3300048918 Bacteria 4457
188 Ga0496116_0000662 3300048919 Bacteria 44877
189 Ga0496116_0026872 3300048919 Bacteria 4199
190 Ga0496117_0125203 3300048920 Bacteria 1570
191 Ga0496118_0000861 3300048921 Bacteria 48186
192 Ga0496118_0050750 3300048921 Bacteria 3180
193 Ga0496119_0001375 3300048922 Bacteria 29636
194 Ga0496119_0004761 3300048922 Bacteria 13335
195 Ga0496119_0033341 3300048922 Bacteria 3416
196 Ga0496119_0073961 3300048922 Bacteria 1986
197 Ga0496119_0144971 3300048922 Bacteria 1278
198 Ga0496120_0005679 3300048923 Bacteria 9855
199 Ga0496120_0029062 3300048923 Bacteria 3378
200 Ga0496120_0033023 3300048923 Bacteria 3113
201 Ga0496121_0000254 3300048924 Bacteria 113314
202 Ga0496121_0003634 3300048924 Bacteria 21721
203 Ga0496121_0004959 3300048924 Bacteria 17458
204 Ga0496121_0011243 3300048924 Bacteria 9975
205 Ga0496121_0036928 3300048924 Bacteria 4346
206 Ga0496121_0067051 3300048924 Bacteria 2910
207 Ga0496121_0098199 3300048924 Bacteria 2267
208 Ga0496121_0268079 3300048924 Bacteria 1175
209 Ga0496122_0001141 3300048925 Bacteria 45561
210 Ga0496123_0000937 3300048926 Bacteria 45562
211 Ga0496123_0018025 3300048926 Bacteria 5648
212 Ga0496124_0035058 3300048927 Bacteria 4394
213 Ga0496124_0078991 3300048927 Bacteria 2710
214 Ga0496125_0002280 3300048928 Bacteria 25407
215 Ga0496126_0012982 3300048929 Bacteria 8503
216 Ga0496126_0091552 3300048929 Bacteria 2673
217 Ga0496126_0136335 3300048929 Bacteria 2117
218 Ga0496126_0154720 3300048929 Bacteria 1963
219 Ga0501036_0000949 3300049572 Bacteria 21806
220 Ga0501073_0006053 3300049589 Bacteria 9026
221 Ga0501077_0113316 3300049593 Bacteria 1719
222 nmdc:mga00v17_15609_c1 3300050491 Bacteria 4265
223 nmdc:mga0yw44_212148_c1 3300050492 Bacteria 1281
224 nmdc:mga0yw44_30587_c1 3300050492 Bacteria 3122
225 nmdc:mga0k408_8486_c1 3300050493 Bacteria 5517
226 nmdc:mga04h51_60921_c1 3300050495 Bacteria 1293
227 Ga0495619_0050699 3300053085 Bacteria 2741
228 Ga0500643_000052 3300053087 Bacteria 144656
229 Ga0500583_0024552 3300053092 Bacteria 2559
230 Ga0500651_0069346 3300053093 Bacteria 2195
231 Ga0500555_001083 3300053103 Bacteria 9107
232 Ga0500595_015400 3300053119 Bacteria 2871
233 Ga0500607_049796 3300053121 Bacteria 2235
234 Ga0500608_092199 3300053122 Bacteria 1414
235 Ga0500642_0016823 3300053130 Bacteria 2788
236 Ga0500564_010539 3300053138 Bacteria 4056
237 Ga0500568_0059139 3300053139 Bacteria 1487
238 Ga0500604_0016449 3300053151 Bacteria 2038
239 Ga0500636_0000136 3300053177 Bacteria 38111
240 Ga0500661_013166 3300055283 Bacteria 1491

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053130 Ga0500642_0016823 Ga0500642_0016823_14_796 259
2 3300003322 rootL2_10154009 rootL2_101540092 261
3 3300053151 Ga0500604_0016449 Ga0500604_0016449_251_1054 265
4 3300039447 Ga0436361_1160656 Ga0436361_1160656_1301_2200 273
5 3300035112 Ga0373932_0075526 Ga0373932_0075526_54_938 275
6 3300049589 Ga0501073_0006053 Ga0501073_0006053_5381_6274 278
7 3300005471 Ga0070698_100004761 Ga0070698_10000476113 279
8 3300048929 Ga0496126_0154720 Ga0496126_0154720_241_1149 280
9 iso_pu_bacteria 2842038055 2842041812 281
10 iso_pu_bacteria 2842045827 2842049854 281
11 3300005577 Ga0068857_100038617 Ga0068857_1000386173 285
12 3300026116 Ga0207674_10022235 Ga0207674_100222355 285
13 3300039447 Ga0436361_0706587 Ga0436361_0706587_19725_20681 285
14 3300048924 Ga0496121_0011243 Ga0496121_0011243_7976_8866 285
15 3300048929 Ga0496126_0012982 Ga0496126_0012982_2235_3125 285
16 3300003659 JGI25404J52841_10000962 JGI25404J52841_100009623 286
17 3300005983 Ga0081540_1002017 Ga0081540_100201712 286
18 iso_pu_bacteria 2824661429 2824665190 287
19 3300003323 rootH1_10094221 rootH1_100942213 288
20 iso_pu_bacteria 2824704595 2824707929 288
21 iso_pu_bacteria 2824753945 2824759335 288
22 iso_pu_bacteria 2824763712 2824768599 288
23 iso_pu_bacteria 2904711408 2904713516 288
24 iso_pu_bacteria 2932784394 2932789643 288
25 iso_pu_bacteria 2932828146 2932833980 288
26 iso_pu_bacteria 2935616580 2935623630 288
27 iso_pu_bacteria 2935638405 2935645017 288
28 iso_pu_bacteria 2935665750 2935672066 288
29 iso_pu_bacteria 2935675223 2935684129 288
30 iso_pu_bacteria 2935694250 2935697563 288
31 iso_pu_bacteria 2935703347 2935711141 288
32 iso_pu_bacteria 2935801545 2935808730 288
33 iso_pu_bacteria 2935827899 2935834137 288
34 iso_pu_bacteria 2935837841 2935844739 288
35 iso_pu_bacteria 2935855204 2935861763 288
36 iso_pu_bacteria 2935864058 2935868601 288
37 iso_pu_bacteria 2935873716 2935879375 288
38 iso_pu_bacteria 2935959822 2935965920 288
39 iso_pu_bacteria 2935992306 2935998457 288
40 iso_pu_bacteria 2936002035 2936009082 288
41 iso_pu_bacteria 2941538514 2941545366 288
42 iso_pu_bacteria 8016511872 8016519257 288
43 iso_pu_bacteria 8017057580 8017066255 288
44 iso_pu_bacteria 8019576017 8019578369 288
45 iso_pu_bacteria 8019586578 8019596405 288
46 iso_pu_bacteria 8019597564 8019605295 288
47 3300005983 Ga0081540_1004009 Ga0081540_10040094 290
48 3300039437 Ga0436365_0354289 Ga0436365_0354289_36_932 290
49 3300003215 JGI25153J46596_10002033 JGI25153J46596_1000203312 291
50 3300003215 JGI25153J46596_10005494 JGI25153J46596_100054942 291
51 3300003320 rootH2_10042655 rootH2_100426552 291
52 3300003794 Ga0055531_10014048 Ga0055531_100140484 291
53 3300005262 Ga0065165_1006387 Ga0065165_10063872 291
54 3300005437 Ga0070710_10009243 Ga0070710_100092436 291
55 3300005614 Ga0068856_100000522 Ga0068856_10000052211 291
56 3300005937 Ga0081455_10056763 Ga0081455_100567634 291
57 3300005983 Ga0081540_1013133 Ga0081540_10131332 291
58 3300005983 Ga0081540_1023908 Ga0081540_10239082 291
59 3300005983 Ga0081540_1050625 Ga0081540_10506253 291
60 3300006163 Ga0070715_10051561 Ga0070715_100515612 291
61 3300006175 Ga0070712_100003366 Ga0070712_1000033663 291
62 3300015261 Ga0182006_1042161 Ga0182006_10421611 291
63 3300025295 Ga0209564_1018669 Ga0209564_10186692 291
64 3300025297 Ga0209758_1000106 Ga0209758_1000106100 291
65 3300025297 Ga0209758_1001741 Ga0209758_100174114 291
66 3300025299 Ga0209256_1006734 Ga0209256_10067344 291
67 3300025304 Ga0209257_1001596 Ga0209257_100159615 291
68 3300025905 Ga0207685_10038172 Ga0207685_100381722 291
69 3300025916 Ga0207663_10053789 Ga0207663_100537893 291
70 3300026078 Ga0207702_10000014 Ga0207702_10000014209 291
71 3300033180 Ga0307510_10057689 Ga0307510_100576892 291
72 3300046459 Ga0495629_0010380 Ga0495629_0010380_3372_4253 291
73 3300046462 Ga0495651_0022333 Ga0495651_0022333_3211_4092 291
74 3300046529 Ga0495652_0022351 Ga0495652_0022351_2363_3244 291
75 3300046533 Ga0495640_0020090 Ga0495640_0020090_3701_4582 291
76 3300046557 Ga0495622_0038237 Ga0495622_0038237_64_945 291
77 3300046663 Ga0495635_0021133 Ga0495635_0021133_2058_2939 291
78 3300046675 Ga0495657_0020310 Ga0495657_0020310_2092_2973 291
79 3300046689 Ga0495613_0012819 Ga0495613_0012819_1563_2444 291
80 3300046690 Ga0495624_0039497 Ga0495624_0039497_175_1056 291
81 3300047315 Ga0495581_0122491 Ga0495581_0122491_549_1430 291
82 3300047317 Ga0495604_0043325 Ga0495604_0043325_1245_2126 291
83 3300047321 Ga0495676_0169366 Ga0495676_0169366_526_1407 291
84 3300047472 Ga0495686_0152774 Ga0495686_0152774_102_983 291
85 3300048088 Ga0495602_0058473 Ga0495602_0058473_1031_1912 291
86 3300048908 Ga0496105_0009018 Ga0496105_0009018_4137_5018 291
87 3300048922 Ga0496119_0004761 Ga0496119_0004761_8304_9185 291
88 3300048922 Ga0496119_0033341 Ga0496119_0033341_2488_3369 291
89 3300048923 Ga0496120_0029062 Ga0496120_0029062_991_1872 291
90 3300048923 Ga0496120_0033023 Ga0496120_0033023_429_1310 291
91 3300048924 Ga0496121_0000254 Ga0496121_0000254_85121_86002 291
92 3300048924 Ga0496121_0067051 Ga0496121_0067051_478_1359 291
93 3300048924 Ga0496121_0268079 Ga0496121_0268079_29_910 291
94 3300048927 Ga0496124_0035058 Ga0496124_0035058_2478_3359 291
95 3300053085 Ga0495619_0050699 Ga0495619_0050699_657_1538 291
96 3300053087 Ga0500643_000052 Ga0500643_000052_26778_27659 291
97 3300053092 Ga0500583_0024552 Ga0500583_0024552_1328_2209 291
98 3300053103 Ga0500555_001083 Ga0500555_001083_324_1205 291
99 3300053119 Ga0500595_015400 Ga0500595_015400_1138_2019 291
100 3300053121 Ga0500607_049796 Ga0500607_049796_904_1785 291
101 3300053122 Ga0500608_092199 Ga0500608_092199_493_1374 291
102 3300053138 Ga0500564_010539 Ga0500564_010539_428_1309 291
103 3300053139 Ga0500568_0059139 Ga0500568_0059139_80_961 291
104 3300053177 Ga0500636_0000136 Ga0500636_0000136_14989_15870 291
105 3300055283 Ga0500661_013166 Ga0500661_013166_193_1074 291
106 iso_pu_bacteria 2879099564 2879106496 291
107 iso_pu_bacteria 2929615660 2929619918 291
108 iso_pu_bacteria 2929624759 2929629230 291
109 iso_pu_bacteria 2932809354 2932814851 291
110 iso_pu_bacteria 2932818245 2932824292 291
111 iso_pu_bacteria 2933577622 2933581836 291
112 iso_pu_bacteria 2935684952 2935689177 291
113 iso_pu_bacteria 2935713505 2935720123 291
114 iso_pu_bacteria 2935722832 2935728260 291
115 iso_pu_bacteria 2935732158 2935737143 291
116 iso_pu_bacteria 2935741537 2935746796 291
117 iso_pu_bacteria 2935750917 2935757763 291
118 iso_pu_bacteria 2935760218 2935764142 291
119 iso_pu_bacteria 2935810662 2935817526 291
120 iso_pu_bacteria 2936037263 2936044323 291
121 iso_pu_bacteria 2940556831 2940563415 291
122 iso_pu_bacteria 8055742211 8055750330 291
123 3300005937 Ga0081455_10035416 Ga0081455_100354163 292
124 3300005983 Ga0081540_1039704 Ga0081540_10397042 292
125 iso_pu_bacteria 3005710791 3005717382 292
126 3300025898 Ga0207692_10226520 Ga0207692_102265201 293
127 3300025915 Ga0207693_10005283 Ga0207693_1000528313 293
128 3300044658 Ga0466972_0057380 Ga0466972_0057380_801_1703 293
129 3300046530 Ga0495654_0001636 Ga0495654_0001636_12633_13595 293
130 3300003323 rootH1_10006073 rootH1_100060736 294
131 3300005434 Ga0070709_10008859 Ga0070709_100088592 294
132 3300005435 Ga0070714_100162044 Ga0070714_1001620443 294
133 3300005436 Ga0070713_100070573 Ga0070713_1000705733 294
134 3300005436 Ga0070713_100096957 Ga0070713_1000969572 294
135 3300005437 Ga0070710_10021472 Ga0070710_100214723 294
136 3300005439 Ga0070711_100012764 Ga0070711_1000127643 294
137 3300005445 Ga0070708_100328590 Ga0070708_1003285902 294
138 3300005455 Ga0070663_100075120 Ga0070663_1000751202 294
139 3300005459 Ga0068867_100298970 Ga0068867_1002989701 294
140 3300005468 Ga0070707_100014921 Ga0070707_1000149213 294
141 3300005719 Ga0068861_100183683 Ga0068861_1001836832 294
142 3300006028 Ga0070717_10016569 Ga0070717_100165695 294
143 3300006163 Ga0070715_10010011 Ga0070715_100100113 294
144 3300006175 Ga0070712_100062098 Ga0070712_1000620982 294
145 3300009177 Ga0105248_10214958 Ga0105248_102149582 294
146 3300013308 Ga0157375_10320199 Ga0157375_103201992 294
147 3300014325 Ga0163163_10178803 Ga0163163_101788032 294
148 3300014497 Ga0182008_10063534 Ga0182008_100635342 294
149 3300025253 Ga0209677_100354 Ga0209677_1003547 294
150 3300025898 Ga0207692_10004848 Ga0207692_100048483 294
151 3300025905 Ga0207685_10019414 Ga0207685_100194141 294
152 3300025906 Ga0207699_10044944 Ga0207699_100449442 294
153 3300025915 Ga0207693_10016926 Ga0207693_100169265 294
154 3300025916 Ga0207663_10005267 Ga0207663_100052675 294
155 3300025922 Ga0207646_10010610 Ga0207646_100106106 294
156 3300025928 Ga0207700_10018648 Ga0207700_100186483 294
157 3300025929 Ga0207664_10230512 Ga0207664_102305121 294
158 3300025939 Ga0207665_10009097 Ga0207665_100090972 294
159 3300025972 Ga0207668_10029851 Ga0207668_100298513 294
160 3300026067 Ga0207678_10018200 Ga0207678_100182003 294
161 3300026118 Ga0207675_100358057 Ga0207675_1003580571 294
162 3300035691 Ga0373931_0126403 Ga0373931_0126403_400_1290 294
163 3300046462 Ga0495651_0338722 Ga0495651_0338722_89_979 294
164 3300046518 Ga0495631_0096458 Ga0495631_0096458_198_1088 294
165 3300046524 Ga0495648_0103888 Ga0495648_0103888_84_974 294
166 3300046557 Ga0495622_0022290 Ga0495622_0022290_1709_2599 294
167 3300046616 Ga0495668_0019514 Ga0495668_0019514_377_1267 294
168 3300046694 Ga0495649_0109403 Ga0495649_0109403_432_1322 294
169 3300048905 Ga0496102_0103012 Ga0496102_0103012_1442_2332 294
170 3300048905 Ga0496102_0167819 Ga0496102_0167819_164_1054 294
171 3300048907 Ga0496104_0325659 Ga0496104_0325659_328_1218 294
172 3300048908 Ga0496105_0045700 Ga0496105_0045700_1405_2295 294
173 3300048909 Ga0496106_0011980 Ga0496106_0011980_4245_5135 294
174 3300048910 Ga0496107_0202754 Ga0496107_0202754_352_1242 294
175 3300048911 Ga0496108_0356762 Ga0496108_0356762_264_1154 294
176 3300048912 Ga0496109_0516713 Ga0496109_0516713_205_1095 294
177 3300048913 Ga0496110_0162465 Ga0496110_0162465_1115_2005 294
178 3300048915 Ga0496112_0011261 Ga0496112_0011261_3835_4725 294
179 3300048917 Ga0496114_0256152 Ga0496114_0256152_555_1445 294
180 3300048918 Ga0496115_0027387 Ga0496115_0027387_3491_4381 294
181 3300048919 Ga0496116_0026872 Ga0496116_0026872_3022_3912 294
182 3300048920 Ga0496117_0125203 Ga0496117_0125203_320_1210 294
183 3300048921 Ga0496118_0050750 Ga0496118_0050750_410_1300 294
184 3300048922 Ga0496119_0073961 Ga0496119_0073961_429_1319 294
185 3300048922 Ga0496119_0144971 Ga0496119_0144971_339_1229 294
186 3300048924 Ga0496121_0004959 Ga0496121_0004959_703_1593 294
187 3300048924 Ga0496121_0036928 Ga0496121_0036928_668_1558 294
188 3300048924 Ga0496121_0098199 Ga0496121_0098199_529_1419 294
189 3300050492 nmdc:mga0yw44_30587_c1 nmdc:mga0yw44_30587_c1_1733_2623 294
190 3300050495 nmdc:mga04h51_60921_c1 nmdc:mga04h51_60921_c1_364_1254 294
191 3300003215 JGI25153J46596_10009027 JGI25153J46596_100090273 295
192 3300005329 Ga0070683_100014030 Ga0070683_1000140308 295
193 3300005434 Ga0070709_10009422 Ga0070709_100094221 295
194 3300005435 Ga0070714_100006531 Ga0070714_1000065319 295
195 3300005435 Ga0070714_100016694 Ga0070714_1000166942 295
196 3300005437 Ga0070710_10002003 Ga0070710_100020037 295
197 3300005439 Ga0070711_100026293 Ga0070711_1000262936 295
198 3300005535 Ga0070684_100004163 Ga0070684_1000041635 295
199 3300005546 Ga0070696_100074651 Ga0070696_1000746512 295
200 3300006028 Ga0070717_10013682 Ga0070717_100136825 295
201 3300006038 Ga0075365_10079402 Ga0075365_100794022 295
202 3300006051 Ga0075364_10061484 Ga0075364_100614843 295
203 3300006175 Ga0070712_100004279 Ga0070712_1000042795 295
204 3300006178 Ga0075367_10187779 Ga0075367_101877792 295
205 3300006186 Ga0075369_10026563 Ga0075369_100265633 295
206 3300006353 Ga0075370_10066964 Ga0075370_100669642 295
207 3300009093 Ga0105240_10220696 Ga0105240_102206962 295
208 3300010375 Ga0105239_10233509 Ga0105239_102335092 295
209 3300025297 Ga0209758_1000400 Ga0209758_100040024 295
210 3300025302 Ga0207426_1000374 Ga0207426_100037435 295
211 3300025898 Ga0207692_10001373 Ga0207692_100013739 295
212 3300025906 Ga0207699_10004028 Ga0207699_100040282 295
213 3300025913 Ga0207695_10179375 Ga0207695_101793752 295
214 3300025915 Ga0207693_10045234 Ga0207693_100452342 295
215 3300025916 Ga0207663_10009740 Ga0207663_100097403 295
216 3300025928 Ga0207700_10008824 Ga0207700_100088242 295
217 3300025929 Ga0207664_10007824 Ga0207664_100078246 295
218 3300025929 Ga0207664_10011744 Ga0207664_100117446 295
219 3300025939 Ga0207665_10018945 Ga0207665_100189452 295
220 3300025944 Ga0207661_10000109 Ga0207661_1000010948 295
221 3300031250 Ga0265331_10002994 Ga0265331_100029944 295
222 3300031251 Ga0265327_10009570 Ga0265327_100095706 295
223 3300031344 Ga0265316_10091453 Ga0265316_100914532 295
224 3300031595 Ga0265313_10000149 Ga0265313_1000014948 295
225 3300031712 Ga0265342_10013530 Ga0265342_100135305 295
226 3300039437 Ga0436365_1864084 Ga0436365_1864084_1509_2402 295
227 3300048915 Ga0496112_0070642 Ga0496112_0070642_451_1383 295
228 3300048929 Ga0496126_0136335 Ga0496126_0136335_1072_1971 295
229 3300050492 nmdc:mga0yw44_212148_c1 nmdc:mga0yw44_212148_c1_300_1205 295
230 3300053093 Ga0500651_0069346 Ga0500651_0069346_1247_2140 295
231 iso_pu_bacteria 2667528172 2671105373 295
232 iso_pu_bacteria 2681812869 2682009750 295
233 iso_pu_bacteria 2765235842 2765591164 295
234 iso_pu_bacteria 2823373977 2823378072 295
235 iso_pu_bacteria 2842718218 2842720556 295
236 iso_pu_bacteria 2974310843 2974314603 295
237 iso_pu_bacteria 2974320154 2974321675 295
238 iso_pu_bacteria 8018405270 8018408821 295
239 3300026088 Ga0207641_10098419 Ga0207641_100984192 296
240 3300049572 Ga0501036_0000949 Ga0501036_0000949_922_1863 296
241 3300005340 Ga0070689_100054030 Ga0070689_1000540303 297
242 3300005354 Ga0070675_100347909 Ga0070675_1003479092 297
243 3300005364 Ga0070673_100166132 Ga0070673_1001661322 297
244 3300005466 Ga0070685_10079116 Ga0070685_100791163 297
245 3300005543 Ga0070672_100103907 Ga0070672_1001039072 297
246 3300005548 Ga0070665_100406094 Ga0070665_1004060942 297
247 3300005841 Ga0068863_100284792 Ga0068863_1002847922 297
248 3300006846 Ga0075430_100113004 Ga0075430_1001130043 297
249 3300006880 Ga0075429_100009614 Ga0075429_1000096142 297
250 3300009094 Ga0111539_10973868 Ga0111539_109738681 297
251 3300013308 Ga0157375_10412537 Ga0157375_104125371 297
252 3300025940 Ga0207691_10173550 Ga0207691_101735501 297
253 3300025960 Ga0207651_10116422 Ga0207651_101164223 297
254 3300028379 Ga0268266_10342577 Ga0268266_103425772 297
255 3300049593 Ga0501077_0113316 Ga0501077_0113316_721_1614 297
256 3300031730 Ga0307516_10087956 Ga0307516_100879561 298
257 2162886007 SwRhRL2b_contig_278021 SwRhRL2b_0545.00003820 299
258 3300003316 rootH1_10116790 rootH1_101167901 299
259 3300005459 Ga0068867_100000302 Ga0068867_10000030223 299
260 3300005548 Ga0070665_100000117 Ga0070665_10000011722 299
261 3300005616 Ga0068852_100041778 Ga0068852_1000417783 299
262 3300006051 Ga0075364_10015381 Ga0075364_100153815 299
263 3300006195 Ga0075366_10007932 Ga0075366_100079325 299
264 3300009011 Ga0105251_10049198 Ga0105251_100491982 299
265 3300009148 Ga0105243_10000444 Ga0105243_1000044421 299
266 3300013100 Ga0157373_10043443 Ga0157373_100434434 299
267 3300013104 Ga0157370_10043097 Ga0157370_100430974 299
268 3300013297 Ga0157378_10074375 Ga0157378_100743753 299
269 3300014745 Ga0157377_10000097 Ga0157377_1000009738 299
270 3300021361 Ga0213872_10000371 Ga0213872_1000037119 299
271 3300025735 Ga0207713_1005898 Ga0207713_10058982 299
272 3300025935 Ga0207709_10002441 Ga0207709_100024415 299
273 3300026089 Ga0207648_10000471 Ga0207648_1000047117 299
274 3300026142 Ga0207698_10030264 Ga0207698_100302642 299
275 3300028379 Ga0268266_10000079 Ga0268266_10000079182 299
276 3300028794 Ga0307515_10227816 Ga0307515_102278162 299
277 3300039447 Ga0436361_0523055 Ga0436361_0523055_28_939 299
278 3300039447 Ga0436361_0547244 Ga0436361_0547244_108_1019 299
279 3300041512 Ga0451853_2993189 Ga0451853_2993189_3211_4110 299
280 3300042010 Ga0439452_000039 Ga0439452_000039_29557_30456 299
281 3300042439 Ga0439464_0000030 Ga0439464_0000030_3463_4362 299
282 3300046471 Ga0495650_0000103 Ga0495650_0000103_29557_30456 299
283 3300046648 Ga0495611_0011295 Ga0495611_0011295_986_1885 299
284 3300048919 Ga0496116_0000662 Ga0496116_0000662_29540_30439 299
285 3300048921 Ga0496118_0000861 Ga0496118_0000861_29691_30590 299
286 3300048922 Ga0496119_0001375 Ga0496119_0001375_17158_18057 299
287 3300048923 Ga0496120_0005679 Ga0496120_0005679_8023_8922 299
288 3300048924 Ga0496121_0003634 Ga0496121_0003634_6797_7696 299
289 3300048925 Ga0496122_0001141 Ga0496122_0001141_29371_30270 299
290 3300048926 Ga0496123_0000937 Ga0496123_0000937_15292_16191 299
291 3300048926 Ga0496123_0018025 Ga0496123_0018025_4502_5584 299
292 3300048927 Ga0496124_0078991 Ga0496124_0078991_1714_2613 299
293 3300048928 Ga0496125_0002280 Ga0496125_0002280_16144_17226 299
294 3300048929 Ga0496126_0091552 Ga0496126_0091552_1449_2348 299
295 3300050491 nmdc:mga00v17_15609_c1 nmdc:mga00v17_15609_c1_2503_3402 299
296 3300050493 nmdc:mga0k408_8486_c1 nmdc:mga0k408_8486_c1_288_1211 299

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

10

69

0.98

PF03466

LysR_substrate

LysR substrate binding domain

93

301

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ihs-assembly1.cif.gz_B crystal structure of benm_dbd/catb site 1 dna complex 0.9635 3 84
4iht-assembly2.cif.gz_C crystal structure of benm_dbd/bena site 1 dna complex 0.9571 3 84
5z4z-assembly2.cif.gz_C-2 crystal structure of pacysb ntd domain with space group c2 0.9267 1 84
5z4z-assembly1.cif.gz_A crystal structure of pacysb ntd domain with space group c2 0.9253 1 84
7trv-assembly1.cif.gz_B crystal structure of the dna-binding domain of the lysr family transcriptional regulator yfba from yersinia pestis 0.9243 1 84
ID Description Score Start End Superfamily
af_P30864_1_87_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9919 3 84 1.10.10.10
af_P77700_7_92_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9857 5 85 1.10.10.10
af_Q47005_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9784 3 84 1.10.10.10
af_P37641_88_293_3.40.190.290 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9769 89 292 3.40.190.290
af_P37682_6_92_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9766 3 84 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A553ZST6-F1-model_v4 LysR family transcriptional regulator 0.9986 1 81 GO:0003700
GO:0006351
GO:0043565
AF-A0A3D0GPD6-F1-model_v4 LysR family transcriptional regulator 0.9921 1 70 GO:0003700
AF-A0A553ZST6-F1-model_v4 LysR family transcriptional regulator 0.9865 1 81 GO:0003700
GO:0006351
GO:0043565
AF-A0A258CPL3-F1-model_v4 LysR family transcriptional regulator 0.9808 1 83 GO:0003700
GO:0006351
GO:0043565
AF-A0A3D0GPD6-F1-model_v4 LysR family transcriptional regulator 0.9517 1 70 GO:0003700

Feature Viewer

pLDDT pTM Quality
88.8 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map