F393058
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 296 | 194 | 296 | 156 |
Family's Representative Sequence
| Representative Sequence | 3300005445|Ga0070708_100000373|Ga0070708_1000003735 |
| Length | 182 |
| Sequence | MATPDSKIGPTTRTSRIAAPGRSIHVRLPPFQTLVDAHAQELHRFLIASIGPDGADDALQETFLSALRAYPRLRDATHLRAWLYTIAQHKATDAVRRSIRHRASDIDEVDSRRIAVTPPPSPDDELWSAVRVLPPRQRSAVVHRFVFDLAYREVAERMGVSEEAARQNVSAALRRLRKDVNR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 34 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 35 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 36 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 37 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 38 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 39 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 42 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 43 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 44 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 45 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 46 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 57 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 65 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 68 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 69 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 70 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 95 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 97 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 98 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 99 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 100 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 101 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 102 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 103 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 104 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 105 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 106 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 107 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 108 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 109 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 110 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 111 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 112 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 113 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 114 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 115 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 116 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 117 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 118 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 119 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 120 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 121 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 122 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 123 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 124 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 125 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 126 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 127 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 128 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 129 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 130 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 147 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 148 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 149 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 150 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 151 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 152 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 153 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 154 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 155 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 156 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 157 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 158 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 159 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 160 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 161 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 162 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 194 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 14.53 |
| Rhizosphere | 81.76 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.72 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10154025 | 3300003203 | Bacteria | 671 |
| 2 | JGI25404J52841_10004601 | 3300003659 | Bacteria | 2808 |
| 3 | Ga0070676_10634531 | 3300005328 | Bacteria | 774 |
| 4 | Ga0070683_100002392 | 3300005329 | Bacteria | 14892 |
| 5 | Ga0070690_100301445 | 3300005330 | Bacteria | 1149 |
| 6 | Ga0070682_100265126 | 3300005337 | Bacteria | 1245 |
| 7 | Ga0068868_100918430 | 3300005338 | Bacteria | 796 |
| 8 | Ga0070689_100491287 | 3300005340 | Bacteria | 1050 |
| 9 | Ga0070689_101476947 | 3300005340 | Bacteria | 615 |
| 10 | Ga0070661_100314989 | 3300005344 | Bacteria | 1221 |
| 11 | Ga0070668_100431209 | 3300005347 | Bacteria | 1130 |
| 12 | Ga0070668_100501087 | 3300005347 | Bacteria | 1051 |
| 13 | Ga0070669_100800315 | 3300005353 | Bacteria | 801 |
| 14 | Ga0070675_100000053 | 3300005354 | Bacteria | 70601 |
| 15 | Ga0070714_100005960 | 3300005435 | Bacteria | 9361 |
| 16 | Ga0070713_100593344 | 3300005436 | Bacteria | 1052 |
| 17 | Ga0070710_10190505 | 3300005437 | Unclassified | 1289 |
| 18 | Ga0070710_10837702 | 3300005437 | Unclassified | 660 |
| 19 | Ga0070711_100014846 | 3300005439 | Bacteria | 4918 |
| 20 | Ga0070705_100963927 | 3300005440 | Unclassified | 690 |
| 21 | Ga0070700_101285580 | 3300005441 | Bacteria | 614 |
| 22 | Ga0070708_100000373 | 3300005445 | Bacteria | 33889 |
| 23 | Ga0070708_100000572 | 3300005445 | Bacteria | 27610 |
| 24 | Ga0070708_100000666 | 3300005445 | Bacteria | 26039 |
| 25 | Ga0070663_100246262 | 3300005455 | Bacteria | 1413 |
| 26 | Ga0070662_100954800 | 3300005457 | Bacteria | 733 |
| 27 | Ga0070706_100044216 | 3300005467 | Bacteria | 4114 |
| 28 | Ga0070707_100063285 | 3300005468 | Bacteria | 3551 |
| 29 | Ga0070707_100087935 | 3300005468 | Bacteria | 3006 |
| 30 | Ga0070697_100316348 | 3300005536 | Bacteria | 1344 |
| 31 | Ga0068853_101315344 | 3300005539 | Bacteria | 699 |
| 32 | Ga0070686_100706288 | 3300005544 | Bacteria | 805 |
| 33 | Ga0070695_100446349 | 3300005545 | Bacteria | 990 |
| 34 | Ga0070665_100303043 | 3300005548 | Bacteria | 1601 |
| 35 | Ga0068855_101479343 | 3300005563 | Bacteria | 698 |
| 36 | Ga0070664_100280986 | 3300005564 | Bacteria | 1501 |
| 37 | Ga0070664_100552078 | 3300005564 | Bacteria | 1065 |
| 38 | Ga0070664_101250359 | 3300005564 | Bacteria | 701 |
| 39 | Ga0068854_100460292 | 3300005578 | Bacteria | 1064 |
| 40 | Ga0068856_102092982 | 3300005614 | Bacteria | 576 |
| 41 | Ga0068864_100652701 | 3300005618 | Bacteria | 1025 |
| 42 | Ga0068858_100000267 | 3300005842 | Bacteria | 55818 |
| 43 | Ga0068862_101401596 | 3300005844 | Bacteria | 702 |
| 44 | Ga0081455_10018302 | 3300005937 | Bacteria | 6678 |
| 45 | Ga0081455_10312079 | 3300005937 | Bacteria | 1123 |
| 46 | Ga0081455_10463286 | 3300005937 | Bacteria | 862 |
| 47 | Ga0081540_1000006 | 3300005983 | Bacteria | 208724 |
| 48 | Ga0081540_1000221 | 3300005983 | Bacteria | 59958 |
| 49 | Ga0081539_10014219 | 3300005985 | Bacteria | 5908 |
| 50 | Ga0081539_10126443 | 3300005985 | Bacteria | 1262 |
| 51 | Ga0070717_10051839 | 3300006028 | Bacteria | 3379 |
| 52 | Ga0070712_100006788 | 3300006175 | Bacteria | 7123 |
| 53 | Ga0075431_100171091 | 3300006847 | Bacteria | 2232 |
| 54 | Ga0075431_100278304 | 3300006847 | Bacteria | 1694 |
| 55 | Ga0075433_10713248 | 3300006852 | Bacteria | 878 |
| 56 | Ga0075433_11029893 | 3300006852 | Bacteria | 717 |
| 57 | Ga0075434_100285819 | 3300006871 | Bacteria | 1669 |
| 58 | Ga0075434_101015452 | 3300006871 | Unclassified | 843 |
| 59 | Ga0068865_101789646 | 3300006881 | Bacteria | 555 |
| 60 | Ga0075435_100389795 | 3300007076 | Unclassified | 1197 |
| 61 | Ga0075435_100503637 | 3300007076 | Bacteria | 1047 |
| 62 | Ga0111539_10079040 | 3300009094 | Bacteria | 3869 |
| 63 | Ga0105245_10225213 | 3300009098 | Bacteria | 1811 |
| 64 | Ga0105245_10571677 | 3300009098 | Bacteria | 1154 |
| 65 | Ga0114129_10280686 | 3300009147 | Bacteria | 2225 |
| 66 | Ga0114129_11692493 | 3300009147 | Unclassified | 772 |
| 67 | Ga0105243_10960304 | 3300009148 | Bacteria | 854 |
| 68 | Ga0105241_11042266 | 3300009174 | Bacteria | 767 |
| 69 | Ga0105242_12042334 | 3300009176 | Bacteria | 616 |
| 70 | Ga0105248_11018970 | 3300009177 | Bacteria | 935 |
| 71 | Ga0105237_11214764 | 3300009545 | Unclassified | 760 |
| 72 | Ga0105249_10494578 | 3300009553 | Bacteria | 1267 |
| 73 | Ga0105239_10292759 | 3300010375 | Bacteria | 1833 |
| 74 | Ga0105239_11413394 | 3300010375 | Bacteria | 803 |
| 75 | Ga0157338_1009432 | 3300012515 | Bacteria | 966 |
| 76 | Ga0157369_11651760 | 3300013105 | Bacteria | 651 |
| 77 | Ga0157374_10001108 | 3300013296 | Bacteria | 23187 |
| 78 | Ga0157378_10016158 | 3300013297 | Bacteria | 6536 |
| 79 | Ga0163162_10882460 | 3300013306 | Bacteria | 1008 |
| 80 | Ga0157372_10589717 | 3300013307 | Bacteria | 1295 |
| 81 | Ga0157375_10021049 | 3300013308 | Bacteria | 5972 |
| 82 | Ga0157380_10295390 | 3300014326 | Bacteria | 1490 |
| 83 | Ga0157380_11048176 | 3300014326 | Bacteria | 852 |
| 84 | Ga0157380_11367812 | 3300014326 | Bacteria | 757 |
| 85 | Ga0182008_10085412 | 3300014497 | Bacteria | 1554 |
| 86 | Ga0157377_10750897 | 3300014745 | Bacteria | 714 |
| 87 | Ga0157379_10000487 | 3300014968 | Bacteria | 32201 |
| 88 | Ga0213874_10029891 | 3300021377 | Bacteria | 1567 |
| 89 | Ga0213876_10144179 | 3300021384 | Bacteria | 1266 |
| 90 | Ga0213875_10098974 | 3300021388 | Bacteria | 1361 |
| 91 | Ga0207692_10049838 | 3300025898 | Unclassified | 2115 |
| 92 | Ga0207684_10106438 | 3300025910 | Bacteria | 2399 |
| 93 | Ga0207693_10002593 | 3300025915 | Bacteria | 15710 |
| 94 | Ga0207663_10193824 | 3300025916 | Unclassified | 1461 |
| 95 | Ga0207652_10862325 | 3300025921 | Bacteria | 801 |
| 96 | Ga0207646_10087677 | 3300025922 | Bacteria | 2785 |
| 97 | Ga0207646_10274251 | 3300025922 | Bacteria | 1524 |
| 98 | Ga0207659_10000010 | 3300025926 | Bacteria | 286639 |
| 99 | Ga0207664_10007850 | 3300025929 | Bacteria | 7414 |
| 100 | Ga0207644_10179866 | 3300025931 | Bacteria | 1657 |
| 101 | Ga0207690_10926750 | 3300025932 | Bacteria | 723 |
| 102 | Ga0207686_11596430 | 3300025934 | Bacteria | 539 |
| 103 | Ga0207669_10418635 | 3300025937 | Bacteria | 1054 |
| 104 | Ga0207704_11550533 | 3300025938 | Bacteria | 569 |
| 105 | Ga0207661_10001740 | 3300025944 | Bacteria | 14901 |
| 106 | Ga0207661_10391804 | 3300025944 | Bacteria | 1259 |
| 107 | Ga0207679_10022838 | 3300025945 | Bacteria | 4266 |
| 108 | Ga0207712_10336560 | 3300025961 | Bacteria | 1250 |
| 109 | Ga0207640_10621608 | 3300025981 | Bacteria | 917 |
| 110 | Ga0207677_10080636 | 3300026023 | Bacteria | 2332 |
| 111 | Ga0207677_10774076 | 3300026023 | Bacteria | 857 |
| 112 | Ga0207639_10301754 | 3300026041 | Bacteria | 1416 |
| 113 | Ga0207708_10813908 | 3300026075 | Bacteria | 805 |
| 114 | Ga0207641_10580434 | 3300026088 | Bacteria | 1096 |
| 115 | Ga0207676_10404302 | 3300026095 | Bacteria | 1277 |
| 116 | Ga0207674_11139934 | 3300026116 | Bacteria | 749 |
| 117 | Ga0207675_100412250 | 3300026118 | Bacteria | 1333 |
| 118 | Ga0207675_100618309 | 3300026118 | Bacteria | 1087 |
| 119 | Ga0207428_10372827 | 3300027907 | Bacteria | 1048 |
| 120 | Ga0268265_10268856 | 3300028380 | Bacteria | 1520 |
| 121 | Ga0268265_10959064 | 3300028380 | Bacteria | 843 |
| 122 | Ga0268265_11501587 | 3300028380 | Bacteria | 677 |
| 123 | Ga0265319_1042800 | 3300028563 | Bacteria | 1523 |
| 124 | Ga0265320_10019761 | 3300031240 | Bacteria | 3672 |
| 125 | Ga0265313_10114605 | 3300031595 | Bacteria | 1182 |
| 126 | Ga0265314_10201323 | 3300031711 | Bacteria | 1177 |
| 127 | Ga0307413_10617220 | 3300031824 | Bacteria | 890 |
| 128 | Ga0307406_10370405 | 3300031901 | Bacteria | 1126 |
| 129 | Ga0307406_11621943 | 3300031901 | Bacteria | 572 |
| 130 | Ga0307409_100226416 | 3300031995 | Bacteria | 1692 |
| 131 | Ga0307416_100493951 | 3300032002 | Bacteria | 1287 |
| 132 | Ga0307411_10414104 | 3300032005 | Bacteria | 1118 |
| 133 | Ga0373931_1023108 | 3300035691 | Bacteria | 560 |
| 134 | Ga0373947_0221744 | 3300035725 | Bacteria | 1243 |
| 135 | Ga0373925_0054160 | 3300037068 | Bacteria | 3000 |
| 136 | Ga0395899_0051174 | 3300037312 | Bacteria | 3066 |
| 137 | Ga0395899_0348606 | 3300037312 | Unclassified | 991 |
| 138 | Ga0395899_0974949 | 3300037312 | Bacteria | 513 |
| 139 | Ga0395900_0024695 | 3300037418 | Bacteria | 6151 |
| 140 | Ga0395900_1353471 | 3300037418 | Unclassified | 625 |
| 141 | Ga0395898_0297151 | 3300037466 | Bacteria | 1541 |
| 142 | Ga0436364_0734093 | 3300037853 | Bacteria | 1153 |
| 143 | Ga0436364_0911128 | 3300037853 | Bacteria | 1763 |
| 144 | Ga0395901_0404534 | 3300038443 | Bacteria | 1402 |
| 145 | Ga0395901_0777694 | 3300038443 | Bacteria | 948 |
| 146 | Ga0395901_0814013 | 3300038443 | Bacteria | 922 |
| 147 | Ga0436365_0595486 | 3300039437 | Bacteria | 572 |
| 148 | Ga0436365_0672482 | 3300039437 | Bacteria | 1798 |
| 149 | Ga0436365_1276258 | 3300039437 | Bacteria | 1128 |
| 150 | Ga0436360_0792183 | 3300039438 | Bacteria | 1350 |
| 151 | Ga0436363_0515453 | 3300039450 | Bacteria | 5029 |
| 152 | Ga0436363_1357328 | 3300039450 | Bacteria | 2210 |
| 153 | Ga0439466_0172853 | 3300041411 | Bacteria | 659 |
| 154 | Ga0439465_0090410 | 3300041413 | Unclassified | 1047 |
| 155 | Ga0439454_010748 | 3300042011 | Bacteria | 1212 |
| 156 | Ga0450907_040040 | 3300042146 | Bacteria | 802 |
| 157 | Ga0450907_054169 | 3300042146 | Unclassified | 690 |
| 158 | Ga0466966_0078214 | 3300044684 | Bacteria | 2063 |
| 159 | Ga0466961_0326956 | 3300044693 | Unclassified | 935 |
| 160 | Ga0466963_0960407 | 3300044694 | Unclassified | 602 |
| 161 | Ga0466971_0032878 | 3300044719 | Bacteria | 2324 |
| 162 | Ga0466968_0302998 | 3300044735 | Unclassified | 769 |
| 163 | Ga0466957_0500708 | 3300044842 | Bacteria | 842 |
| 164 | Ga0466960_0597449 | 3300044901 | Bacteria | 655 |
| 165 | Ga0466959_0250969 | 3300045049 | Bacteria | 1220 |
| 166 | Ga0466959_0602693 | 3300045049 | Bacteria | 739 |
| 167 | Ga0466958_0034989 | 3300045836 | Bacteria | 3000 |
| 168 | Ga0466958_0456058 | 3300045836 | Bacteria | 828 |
| 169 | Ga0466967_1158254 | 3300045976 | Bacteria | 770 |
| 170 | Ga0495603_0142079 | 3300046455 | Bacteria | 1396 |
| 171 | Ga0495590_0065320 | 3300046457 | Bacteria | 1274 |
| 172 | Ga0495641_0081376 | 3300046461 | Bacteria | 1451 |
| 173 | Ga0495662_0520257 | 3300046476 | Bacteria | 583 |
| 174 | Ga0495584_0185638 | 3300046491 | Bacteria | 1057 |
| 175 | Ga0495594_0372417 | 3300046499 | Bacteria | 813 |
| 176 | Ga0495628_0049243 | 3300046516 | Bacteria | 3337 |
| 177 | Ga0495628_0077274 | 3300046516 | Bacteria | 2590 |
| 178 | Ga0495630_0000018 | 3300046517 | Bacteria | 186064 |
| 179 | Ga0495586_0007791 | 3300046535 | Bacteria | 5710 |
| 180 | Ga0495656_0105133 | 3300046615 | Bacteria | 1312 |
| 181 | Ga0495588_0080408 | 3300046674 | Bacteria | 1701 |
| 182 | Ga0495588_0207339 | 3300046674 | Bacteria | 1035 |
| 183 | Ga0495647_0002735 | 3300046681 | Bacteria | 5594 |
| 184 | Ga0495613_0071758 | 3300046689 | Bacteria | 2524 |
| 185 | Ga0495624_0002494 | 3300046690 | Bacteria | 13951 |
| 186 | Ga0495676_0048565 | 3300047321 | Bacteria | 3421 |
| 187 | Ga0495676_0206513 | 3300047321 | Bacteria | 1362 |
| 188 | Ga0495593_0213910 | 3300047673 | Unclassified | 968 |
| 189 | Ga0496100_0002460 | 3300048903 | Bacteria | 9406 |
| 190 | Ga0496100_0004552 | 3300048903 | Bacteria | 7367 |
| 191 | Ga0496101_0180989 | 3300048904 | Bacteria | 1623 |
| 192 | Ga0496102_0384725 | 3300048905 | Bacteria | 1320 |
| 193 | Ga0496102_0947711 | 3300048905 | Bacteria | 782 |
| 194 | Ga0496103_0043439 | 3300048906 | Bacteria | 2767 |
| 195 | Ga0496104_0193467 | 3300048907 | Bacteria | 1946 |
| 196 | Ga0496105_0010020 | 3300048908 | Bacteria | 7436 |
| 197 | Ga0496105_0224861 | 3300048908 | Bacteria | 1527 |
| 198 | Ga0496105_0243422 | 3300048908 | Bacteria | 1459 |
| 199 | Ga0496107_0198693 | 3300048910 | Bacteria | 1490 |
| 200 | Ga0496108_0000630 | 3300048911 | Bacteria | 27529 |
| 201 | Ga0496108_0000712 | 3300048911 | Bacteria | 25838 |
| 202 | Ga0496108_0037723 | 3300048911 | Bacteria | 4026 |
| 203 | Ga0496108_0192042 | 3300048911 | Bacteria | 1770 |
| 204 | Ga0496108_0226360 | 3300048911 | Bacteria | 1625 |
| 205 | Ga0496108_1121737 | 3300048911 | Bacteria | 668 |
| 206 | Ga0496109_0000028 | 3300048912 | Bacteria | 168138 |
| 207 | Ga0496109_0000168 | 3300048912 | Bacteria | 64462 |
| 208 | Ga0496109_0001732 | 3300048912 | Bacteria | 18212 |
| 209 | Ga0496109_0036482 | 3300048912 | Bacteria | 4437 |
| 210 | Ga0496109_0484445 | 3300048912 | Bacteria | 1168 |
| 211 | Ga0496109_0897198 | 3300048912 | Bacteria | 824 |
| 212 | Ga0496109_0914622 | 3300048912 | Bacteria | 815 |
| 213 | Ga0496109_0931808 | 3300048912 | Bacteria | 806 |
| 214 | Ga0496110_0002009 | 3300048913 | Bacteria | 15145 |
| 215 | Ga0496110_0054701 | 3300048913 | Bacteria | 3511 |
| 216 | Ga0496110_0120801 | 3300048913 | Bacteria | 2360 |
| 217 | Ga0496110_0170843 | 3300048913 | Bacteria | 1972 |
| 218 | Ga0496111_0004528 | 3300048914 | Bacteria | 8794 |
| 219 | Ga0496111_0041014 | 3300048914 | Bacteria | 3321 |
| 220 | Ga0496111_0171406 | 3300048914 | Bacteria | 1612 |
| 221 | Ga0496112_0012587 | 3300048915 | Bacteria | 7774 |
| 222 | Ga0496112_0272637 | 3300048915 | Bacteria | 1640 |
| 223 | Ga0496112_0410333 | 3300048915 | Bacteria | 1294 |
| 224 | Ga0496113_0040585 | 3300048916 | Bacteria | 3430 |
| 225 | Ga0496113_0361724 | 3300048916 | Bacteria | 1164 |
| 226 | Ga0496114_0077717 | 3300048917 | Bacteria | 2799 |
| 227 | Ga0496114_0078193 | 3300048917 | Bacteria | 2791 |
| 228 | Ga0496114_0928805 | 3300048917 | Bacteria | 752 |
| 229 | Ga0496115_0000006 | 3300048918 | Bacteria | 252944 |
| 230 | Ga0496115_0000015 | 3300048918 | Bacteria | 200845 |
| 231 | Ga0496115_0004548 | 3300048918 | Bacteria | 10037 |
| 232 | Ga0496122_0135518 | 3300048925 | Bacteria | 1553 |
| 233 | Ga0501031_0056650 | 3300049568 | Bacteria | 2554 |
| 234 | Ga0501036_0183274 | 3300049572 | Bacteria | 1762 |
| 235 | Ga0501036_0710017 | 3300049572 | Bacteria | 831 |
| 236 | Ga0501037_0414371 | 3300049573 | Bacteria | 923 |
| 237 | Ga0501039_0279845 | 3300049575 | Bacteria | 1311 |
| 238 | Ga0501039_0526363 | 3300049575 | Unclassified | 928 |
| 239 | Ga0501040_0017372 | 3300049576 | Bacteria | 4774 |
| 240 | Ga0501040_0020214 | 3300049576 | Bacteria | 4436 |
| 241 | Ga0501040_0171585 | 3300049576 | Bacteria | 1536 |
| 242 | Ga0501040_0271193 | 3300049576 | Bacteria | 1212 |
| 243 | Ga0501040_0768439 | 3300049576 | Unclassified | 697 |
| 244 | Ga0501041_0050745 | 3300049577 | Bacteria | 2528 |
| 245 | Ga0501041_0168417 | 3300049577 | Bacteria | 1370 |
| 246 | Ga0501042_0002137 | 3300049578 | Bacteria | 12004 |
| 247 | Ga0501042_0022940 | 3300049578 | Bacteria | 4361 |
| 248 | Ga0501042_0381690 | 3300049578 | Bacteria | 1020 |
| 249 | Ga0501046_0478629 | 3300049580 | Unclassified | 893 |
| 250 | Ga0501048_0101100 | 3300049582 | Bacteria | 2034 |
| 251 | Ga0501048_0191226 | 3300049582 | Bacteria | 1450 |
| 252 | Ga0501048_0482425 | 3300049582 | Bacteria | 889 |
| 253 | Ga0501067_0003672 | 3300049583 | Bacteria | 8458 |
| 254 | Ga0501068_0157576 | 3300049584 | Bacteria | 1430 |
| 255 | Ga0501068_0374186 | 3300049584 | Bacteria | 917 |
| 256 | Ga0501069_0023959 | 3300049585 | Bacteria | 3328 |
| 257 | Ga0501070_1046396 | 3300049586 | Bacteria | 631 |
| 258 | Ga0501071_0023283 | 3300049587 | Bacteria | 4326 |
| 259 | Ga0501071_0073120 | 3300049587 | Bacteria | 2500 |
| 260 | Ga0501071_1011594 | 3300049587 | Bacteria | 642 |
| 261 | Ga0501071_1014392 | 3300049587 | Bacteria | 641 |
| 262 | Ga0501072_0114476 | 3300049588 | Bacteria | 2147 |
| 263 | Ga0501074_0063013 | 3300049590 | Bacteria | 2671 |
| 264 | Ga0501074_0066631 | 3300049590 | Bacteria | 2590 |
| 265 | Ga0501075_0018912 | 3300049591 | Bacteria | 4993 |
| 266 | Ga0501075_0397767 | 3300049591 | Bacteria | 1050 |
| 267 | Ga0501076_0016447 | 3300049592 | Bacteria | 5609 |
| 268 | Ga0501076_0191550 | 3300049592 | Bacteria | 1669 |
| 269 | Ga0501079_0051116 | 3300049741 | Bacteria | 3190 |
| 270 | Ga0501079_0095027 | 3300049741 | Bacteria | 2310 |
| 271 | Ga0501080_0281953 | 3300049742 | Bacteria | 1510 |
| 272 | Ga0501081_0036874 | 3300049743 | Bacteria | 3335 |
| 273 | Ga0501081_0406514 | 3300049743 | Bacteria | 1008 |
| 274 | Ga0501081_1222539 | 3300049743 | Bacteria | 569 |
| 275 | Ga0501083_0268066 | 3300049744 | Bacteria | 1111 |
| 276 | Ga0501044_1544378 | 3300049823 | Bacteria | 529 |
| 277 | Ga0501045_0055805 | 3300049824 | Bacteria | 2889 |
| 278 | Ga0501045_0097222 | 3300049824 | Bacteria | 2178 |
| 279 | Ga0501045_0339495 | 3300049824 | Bacteria | 1118 |
| 280 | Ga0501045_0399318 | 3300049824 | Bacteria | 1023 |
| 281 | nmdc:mga05p37_449265_c1 | 3300050507 | Bacteria | 1492 |
| 282 | nmdc:mga05p37_952970_c1 | 3300050507 | Bacteria | 918 |
| 283 | nmdc:mga0n895_1282546_c1 | 3300050512 | Unclassified | 704 |
| 284 | nmdc:mga0rr50_1821751_c1 | 3300050513 | Unclassified | 512 |
| 285 | nmdc:mga0a205_1225524_c1 | 3300050515 | Bacteria | 598 |
| 286 | nmdc:mga0a205_600916_c1 | 3300050515 | Bacteria | 953 |
| 287 | Ga0495612_0000068 | 3300053078 | Bacteria | 47169 |
| 288 | Ga0501084_0057936 | 3300054114 | Bacteria | 3241 |
| 289 | Ga0501082_0087433 | 3300060353 | Bacteria | 2689 |
| 290 | Ga0501082_0432721 | 3300060353 | Bacteria | 1149 |
| 291 | Ga0501082_0554822 | 3300060353 | Bacteria | 1005 |
| 292 | Ga0501082_0635558 | 3300060353 | Bacteria | 934 |
| 293 | Ga0466962_0586162 | 3300061719 | Bacteria | 568 |
| 294 | Ga0530510_0009043 | 3300061734 | Bacteria | 6982 |
| 295 | Ga0530510_0088844 | 3300061734 | Bacteria | 2253 |
| 296 | Ga0530510_0390514 | 3300061734 | Unclassified | 1048 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049576 | Ga0501040_0271193 | Ga0501040_0271193_12_404 | 128 |
| 2 | 3300047321 | Ga0495676_0048565 | Ga0495676_0048565_1914_2381 | 132 |
| 3 | 3300047673 | Ga0495593_0213910 | Ga0495593_0213910_449_856 | 134 |
| 4 | 3300049582 | Ga0501048_0191226 | Ga0501048_0191226_1008_1412 | 134 |
| 5 | 3300048903 | Ga0496100_0004552 | Ga0496100_0004552_6932_7348 | 135 |
| 6 | 3300037418 | Ga0395900_1353471 | Ga0395900_1353471_178_615 | 136 |
| 7 | 3300005330 | Ga0070690_100301445 | Ga0070690_1003014451 | 138 |
| 8 | 3300005564 | Ga0070664_100552078 | Ga0070664_1005520782 | 138 |
| 9 | 3300049823 | Ga0501044_1544378 | Ga0501044_1544378_88_516 | 138 |
| 10 | 3300005445 | Ga0070708_100000572 | Ga0070708_10000057211 | 140 |
| 11 | 3300025898 | Ga0207692_10049838 | Ga0207692_100498382 | 140 |
| 12 | 3300037853 | Ga0436364_0911128 | Ga0436364_0911128_849_1295 | 140 |
| 13 | 3300048917 | Ga0496114_0078193 | Ga0496114_0078193_2108_2560 | 140 |
| 14 | 3300048918 | Ga0496115_0004548 | Ga0496115_0004548_6356_6808 | 140 |
| 15 | 3300048908 | Ga0496105_0224861 | Ga0496105_0224861_658_1155 | 144 |
| 16 | 3300049572 | Ga0501036_0183274 | Ga0501036_0183274_138_683 | 145 |
| 17 | 3300049577 | Ga0501041_0050745 | Ga0501041_0050745_1693_2238 | 145 |
| 18 | 3300049582 | Ga0501048_0101100 | Ga0501048_0101100_518_1063 | 145 |
| 19 | 3300049587 | Ga0501071_0023283 | Ga0501071_0023283_1564_2109 | 145 |
| 20 | 3300049590 | Ga0501074_0063013 | Ga0501074_0063013_1486_2031 | 145 |
| 21 | 3300049592 | Ga0501076_0016447 | Ga0501076_0016447_3374_3919 | 145 |
| 22 | 3300049741 | Ga0501079_0095027 | Ga0501079_0095027_289_834 | 145 |
| 23 | 3300049743 | Ga0501081_0406514 | Ga0501081_0406514_198_743 | 145 |
| 24 | 3300049824 | Ga0501045_0097222 | Ga0501045_0097222_529_1074 | 145 |
| 25 | 3300005338 | Ga0068868_100918430 | Ga0068868_1009184302 | 146 |
| 26 | 3300005344 | Ga0070661_100314989 | Ga0070661_1003149892 | 146 |
| 27 | 3300009177 | Ga0105248_11018970 | Ga0105248_110189702 | 146 |
| 28 | 3300014745 | Ga0157377_10750897 | Ga0157377_107508972 | 146 |
| 29 | 3300026023 | Ga0207677_10080636 | Ga0207677_100806363 | 146 |
| 30 | 3300048905 | Ga0496102_0384725 | Ga0496102_0384725_32_505 | 146 |
| 31 | 3300048911 | Ga0496108_0000712 | Ga0496108_0000712_12960_13433 | 146 |
| 32 | 3300048912 | Ga0496109_0001732 | Ga0496109_0001732_14195_14668 | 146 |
| 33 | 3300048913 | Ga0496110_0002009 | Ga0496110_0002009_1731_2204 | 146 |
| 34 | 3300048914 | Ga0496111_0004528 | Ga0496111_0004528_6041_6514 | 146 |
| 35 | 3300048916 | Ga0496113_0361724 | Ga0496113_0361724_663_1136 | 146 |
| 36 | 3300005435 | Ga0070714_100005960 | Ga0070714_10000596010 | 147 |
| 37 | 3300005436 | Ga0070713_100593344 | Ga0070713_1005933442 | 147 |
| 38 | 3300005437 | Ga0070710_10190505 | Ga0070710_101905052 | 147 |
| 39 | 3300005437 | Ga0070710_10837702 | Ga0070710_108377021 | 147 |
| 40 | 3300005439 | Ga0070711_100014846 | Ga0070711_1000148463 | 147 |
| 41 | 3300006028 | Ga0070717_10051839 | Ga0070717_100518392 | 147 |
| 42 | 3300006175 | Ga0070712_100006788 | Ga0070712_1000067884 | 147 |
| 43 | 3300025915 | Ga0207693_10002593 | Ga0207693_100025936 | 147 |
| 44 | 3300025916 | Ga0207663_10193824 | Ga0207663_101938242 | 147 |
| 45 | 3300025929 | Ga0207664_10007850 | Ga0207664_100078502 | 147 |
| 46 | 3300046690 | Ga0495624_0002494 | Ga0495624_0002494_12310_12777 | 147 |
| 47 | 3300005468 | Ga0070707_100063285 | Ga0070707_1000632853 | 148 |
| 48 | 3300025922 | Ga0207646_10087677 | Ga0207646_100876773 | 148 |
| 49 | 3300003659 | JGI25404J52841_10004601 | JGI25404J52841_100046013 | 149 |
| 50 | 3300005445 | Ga0070708_100000666 | Ga0070708_1000006668 | 149 |
| 51 | 3300021388 | Ga0213875_10098974 | Ga0213875_100989742 | 149 |
| 52 | 3300028563 | Ga0265319_1042800 | Ga0265319_10428002 | 149 |
| 53 | 3300031240 | Ga0265320_10019761 | Ga0265320_100197612 | 149 |
| 54 | 3300031595 | Ga0265313_10114605 | Ga0265313_101146052 | 149 |
| 55 | 3300031711 | Ga0265314_10201323 | Ga0265314_102013232 | 149 |
| 56 | 3300039437 | Ga0436365_1276258 | Ga0436365_1276258_79_540 | 149 |
| 57 | 3300048911 | Ga0496108_0000630 | Ga0496108_0000630_23932_24390 | 149 |
| 58 | 3300048912 | Ga0496109_0000168 | Ga0496109_0000168_60873_61331 | 149 |
| 59 | 3300014968 | Ga0157379_10000487 | Ga0157379_1000048720 | 150 |
| 60 | 3300039438 | Ga0436360_0792183 | Ga0436360_0792183_432_902 | 150 |
| 61 | 3300041411 | Ga0439466_0172853 | Ga0439466_0172853_150_614 | 150 |
| 62 | 3300042146 | Ga0450907_054169 | Ga0450907_054169_23_487 | 150 |
| 63 | 3300046491 | Ga0495584_0185638 | Ga0495584_0185638_126_587 | 150 |
| 64 | 3300048905 | Ga0496102_0947711 | Ga0496102_0947711_166_624 | 150 |
| 65 | 3300049580 | Ga0501046_0478629 | Ga0501046_0478629_389_853 | 150 |
| 66 | 3300060353 | Ga0501082_0635558 | Ga0501082_0635558_12_470 | 150 |
| 67 | 3300005340 | Ga0070689_100491287 | Ga0070689_1004912872 | 151 |
| 68 | 3300005347 | Ga0070668_100501087 | Ga0070668_1005010872 | 151 |
| 69 | 3300005440 | Ga0070705_100963927 | Ga0070705_1009639271 | 151 |
| 70 | 3300005844 | Ga0068862_101401596 | Ga0068862_1014015962 | 151 |
| 71 | 3300006852 | Ga0075433_11029893 | Ga0075433_110298931 | 151 |
| 72 | 3300006871 | Ga0075434_101015452 | Ga0075434_1010154522 | 151 |
| 73 | 3300007076 | Ga0075435_100389795 | Ga0075435_1003897952 | 151 |
| 74 | 3300007076 | Ga0075435_100503637 | Ga0075435_1005036371 | 151 |
| 75 | 3300009553 | Ga0105249_10494578 | Ga0105249_104945782 | 151 |
| 76 | 3300014326 | Ga0157380_10295390 | Ga0157380_102953903 | 151 |
| 77 | 3300021377 | Ga0213874_10029891 | Ga0213874_100298912 | 151 |
| 78 | 3300028380 | Ga0268265_10959064 | Ga0268265_109590642 | 151 |
| 79 | 3300031824 | Ga0307413_10617220 | Ga0307413_106172202 | 151 |
| 80 | 3300031901 | Ga0307406_11621943 | Ga0307406_116219431 | 151 |
| 81 | 3300031995 | Ga0307409_100226416 | Ga0307409_1002264162 | 151 |
| 82 | 3300032005 | Ga0307411_10414104 | Ga0307411_104141042 | 151 |
| 83 | 3300039437 | Ga0436365_0672482 | Ga0436365_0672482_746_1216 | 151 |
| 84 | 3300039450 | Ga0436363_1357328 | Ga0436363_1357328_253_720 | 151 |
| 85 | 3300042146 | Ga0450907_040040 | Ga0450907_040040_107_574 | 151 |
| 86 | 3300044693 | Ga0466961_0326956 | Ga0466961_0326956_189_653 | 151 |
| 87 | 3300044842 | Ga0466957_0500708 | Ga0466957_0500708_364_828 | 151 |
| 88 | 3300045049 | Ga0466959_0250969 | Ga0466959_0250969_313_777 | 151 |
| 89 | 3300045976 | Ga0466967_1158254 | Ga0466967_1158254_233_697 | 151 |
| 90 | 3300046499 | Ga0495594_0372417 | Ga0495594_0372417_252_800 | 151 |
| 91 | 3300046674 | Ga0495588_0207339 | Ga0495588_0207339_140_604 | 151 |
| 92 | 3300048911 | Ga0496108_1121737 | Ga0496108_1121737_148_612 | 151 |
| 93 | 3300048912 | Ga0496109_0484445 | Ga0496109_0484445_431_898 | 151 |
| 94 | 3300050512 | nmdc:mga0n895_1282546_c1 | nmdc:mga0n895_1282546_c1_43_510 | 151 |
| 95 | 3300050513 | nmdc:mga0rr50_1821751_c1 | nmdc:mga0rr50_1821751_c1_28_501 | 151 |
| 96 | 3300050515 | nmdc:mga0a205_1225524_c1 | nmdc:mga0a205_1225524_c1_67_564 | 151 |
| 97 | 3300005328 | Ga0070676_10634531 | Ga0070676_106345311 | 152 |
| 98 | 3300005337 | Ga0070682_100265126 | Ga0070682_1002651262 | 152 |
| 99 | 3300005340 | Ga0070689_101476947 | Ga0070689_1014769471 | 152 |
| 100 | 3300005347 | Ga0070668_100431209 | Ga0070668_1004312092 | 152 |
| 101 | 3300005353 | Ga0070669_100800315 | Ga0070669_1008003152 | 152 |
| 102 | 3300005441 | Ga0070700_101285580 | Ga0070700_1012855801 | 152 |
| 103 | 3300005445 | Ga0070708_100000373 | Ga0070708_1000003735 | 152 |
| 104 | 3300005455 | Ga0070663_100246262 | Ga0070663_1002462621 | 152 |
| 105 | 3300005467 | Ga0070706_100044216 | Ga0070706_1000442163 | 152 |
| 106 | 3300005468 | Ga0070707_100087935 | Ga0070707_1000879353 | 152 |
| 107 | 3300005539 | Ga0068853_101315344 | Ga0068853_1013153441 | 152 |
| 108 | 3300005545 | Ga0070695_100446349 | Ga0070695_1004463491 | 152 |
| 109 | 3300005548 | Ga0070665_100303043 | Ga0070665_1003030432 | 152 |
| 110 | 3300005578 | Ga0068854_100460292 | Ga0068854_1004602922 | 152 |
| 111 | 3300005618 | Ga0068864_100652701 | Ga0068864_1006527012 | 152 |
| 112 | 3300005842 | Ga0068858_100000267 | Ga0068858_10000026737 | 152 |
| 113 | 3300005937 | Ga0081455_10312079 | Ga0081455_103120792 | 152 |
| 114 | 3300005937 | Ga0081455_10463286 | Ga0081455_104632862 | 152 |
| 115 | 3300005983 | Ga0081540_1000006 | Ga0081540_1000006206 | 152 |
| 116 | 3300005983 | Ga0081540_1000221 | Ga0081540_100022161 | 152 |
| 117 | 3300005985 | Ga0081539_10014219 | Ga0081539_100142193 | 152 |
| 118 | 3300006847 | Ga0075431_100171091 | Ga0075431_1001710912 | 152 |
| 119 | 3300006847 | Ga0075431_100278304 | Ga0075431_1002783043 | 152 |
| 120 | 3300006871 | Ga0075434_100285819 | Ga0075434_1002858192 | 152 |
| 121 | 3300006881 | Ga0068865_101789646 | Ga0068865_1017896461 | 152 |
| 122 | 3300009098 | Ga0105245_10225213 | Ga0105245_102252133 | 152 |
| 123 | 3300009098 | Ga0105245_10571677 | Ga0105245_105716772 | 152 |
| 124 | 3300009545 | Ga0105237_11214764 | Ga0105237_112147641 | 152 |
| 125 | 3300010375 | Ga0105239_10292759 | Ga0105239_102927593 | 152 |
| 126 | 3300010375 | Ga0105239_11413394 | Ga0105239_114133941 | 152 |
| 127 | 3300012515 | Ga0157338_1009432 | Ga0157338_10094322 | 152 |
| 128 | 3300013296 | Ga0157374_10001108 | Ga0157374_100011089 | 152 |
| 129 | 3300013308 | Ga0157375_10021049 | Ga0157375_100210495 | 152 |
| 130 | 3300014326 | Ga0157380_11048176 | Ga0157380_110481762 | 152 |
| 131 | 3300014326 | Ga0157380_11367812 | Ga0157380_113678122 | 152 |
| 132 | 3300025910 | Ga0207684_10106438 | Ga0207684_101064382 | 152 |
| 133 | 3300025921 | Ga0207652_10862325 | Ga0207652_108623252 | 152 |
| 134 | 3300025922 | Ga0207646_10274251 | Ga0207646_102742512 | 152 |
| 135 | 3300025931 | Ga0207644_10179866 | Ga0207644_101798662 | 152 |
| 136 | 3300025937 | Ga0207669_10418635 | Ga0207669_104186352 | 152 |
| 137 | 3300025938 | Ga0207704_11550533 | Ga0207704_115505331 | 152 |
| 138 | 3300025961 | Ga0207712_10336560 | Ga0207712_103365602 | 152 |
| 139 | 3300025981 | Ga0207640_10621608 | Ga0207640_106216081 | 152 |
| 140 | 3300026023 | Ga0207677_10774076 | Ga0207677_107740762 | 152 |
| 141 | 3300026041 | Ga0207639_10301754 | Ga0207639_103017543 | 152 |
| 142 | 3300026095 | Ga0207676_10404302 | Ga0207676_104043022 | 152 |
| 143 | 3300026116 | Ga0207674_11139934 | Ga0207674_111399342 | 152 |
| 144 | 3300026118 | Ga0207675_100412250 | Ga0207675_1004122502 | 152 |
| 145 | 3300026118 | Ga0207675_100618309 | Ga0207675_1006183091 | 152 |
| 146 | 3300028380 | Ga0268265_10268856 | Ga0268265_102688562 | 152 |
| 147 | 3300028380 | Ga0268265_11501587 | Ga0268265_115015872 | 152 |
| 148 | 3300031901 | Ga0307406_10370405 | Ga0307406_103704052 | 152 |
| 149 | 3300032002 | Ga0307416_100493951 | Ga0307416_1004939513 | 152 |
| 150 | 3300037312 | Ga0395899_0051174 | Ga0395899_0051174_1359_1844 | 152 |
| 151 | 3300037418 | Ga0395900_0024695 | Ga0395900_0024695_281_766 | 152 |
| 152 | 3300037853 | Ga0436364_0734093 | Ga0436364_0734093_561_1040 | 152 |
| 153 | 3300038443 | Ga0395901_0814013 | Ga0395901_0814013_404_865 | 152 |
| 154 | 3300039437 | Ga0436365_0595486 | Ga0436365_0595486_71_541 | 152 |
| 155 | 3300041413 | Ga0439465_0090410 | Ga0439465_0090410_359_850 | 152 |
| 156 | 3300042011 | Ga0439454_010748 | Ga0439454_010748_159_629 | 152 |
| 157 | 3300044735 | Ga0466968_0302998 | Ga0466968_0302998_122_592 | 152 |
| 158 | 3300044901 | Ga0466960_0597449 | Ga0466960_0597449_56_526 | 152 |
| 159 | 3300045836 | Ga0466958_0456058 | Ga0466958_0456058_343_810 | 152 |
| 160 | 3300046457 | Ga0495590_0065320 | Ga0495590_0065320_755_1222 | 152 |
| 161 | 3300046516 | Ga0495628_0049243 | Ga0495628_0049243_267_734 | 152 |
| 162 | 3300046516 | Ga0495628_0077274 | Ga0495628_0077274_1591_2082 | 152 |
| 163 | 3300046535 | Ga0495586_0007791 | Ga0495586_0007791_4974_5435 | 152 |
| 164 | 3300048904 | Ga0496101_0180989 | Ga0496101_0180989_45_512 | 152 |
| 165 | 3300048907 | Ga0496104_0193467 | Ga0496104_0193467_98_565 | 152 |
| 166 | 3300048908 | Ga0496105_0010020 | Ga0496105_0010020_3088_3555 | 152 |
| 167 | 3300048908 | Ga0496105_0243422 | Ga0496105_0243422_941_1408 | 152 |
| 168 | 3300048910 | Ga0496107_0198693 | Ga0496107_0198693_690_1157 | 152 |
| 169 | 3300048911 | Ga0496108_0226360 | Ga0496108_0226360_823_1290 | 152 |
| 170 | 3300048912 | Ga0496109_0036482 | Ga0496109_0036482_1936_2403 | 152 |
| 171 | 3300048912 | Ga0496109_0931808 | Ga0496109_0931808_121_588 | 152 |
| 172 | 3300048913 | Ga0496110_0120801 | Ga0496110_0120801_1066_1533 | 152 |
| 173 | 3300048915 | Ga0496112_0012587 | Ga0496112_0012587_2361_2828 | 152 |
| 174 | 3300048915 | Ga0496112_0272637 | Ga0496112_0272637_900_1367 | 152 |
| 175 | 3300048916 | Ga0496113_0040585 | Ga0496113_0040585_690_1157 | 152 |
| 176 | 3300048917 | Ga0496114_0077717 | Ga0496114_0077717_28_495 | 152 |
| 177 | 3300049568 | Ga0501031_0056650 | Ga0501031_0056650_67_537 | 152 |
| 178 | 3300049572 | Ga0501036_0710017 | Ga0501036_0710017_216_686 | 152 |
| 179 | 3300049573 | Ga0501037_0414371 | Ga0501037_0414371_58_528 | 152 |
| 180 | 3300049575 | Ga0501039_0279845 | Ga0501039_0279845_63_533 | 152 |
| 181 | 3300049576 | Ga0501040_0017372 | Ga0501040_0017372_1865_2335 | 152 |
| 182 | 3300049576 | Ga0501040_0020214 | Ga0501040_0020214_2859_3329 | 152 |
| 183 | 3300049576 | Ga0501040_0171585 | Ga0501040_0171585_449_919 | 152 |
| 184 | 3300049577 | Ga0501041_0168417 | Ga0501041_0168417_557_1027 | 152 |
| 185 | 3300049578 | Ga0501042_0002137 | Ga0501042_0002137_5044_5514 | 152 |
| 186 | 3300049578 | Ga0501042_0022940 | Ga0501042_0022940_2014_2484 | 152 |
| 187 | 3300049583 | Ga0501067_0003672 | Ga0501067_0003672_6828_7313 | 152 |
| 188 | 3300049584 | Ga0501068_0157576 | Ga0501068_0157576_932_1402 | 152 |
| 189 | 3300049584 | Ga0501068_0374186 | Ga0501068_0374186_433_903 | 152 |
| 190 | 3300049585 | Ga0501069_0023959 | Ga0501069_0023959_1719_2204 | 152 |
| 191 | 3300049586 | Ga0501070_1046396 | Ga0501070_1046396_77_547 | 152 |
| 192 | 3300049587 | Ga0501071_0073120 | Ga0501071_0073120_145_615 | 152 |
| 193 | 3300049587 | Ga0501071_1014392 | Ga0501071_1014392_151_621 | 152 |
| 194 | 3300049588 | Ga0501072_0114476 | Ga0501072_0114476_1096_1566 | 152 |
| 195 | 3300049590 | Ga0501074_0066631 | Ga0501074_0066631_137_607 | 152 |
| 196 | 3300049591 | Ga0501075_0018912 | Ga0501075_0018912_4406_4876 | 152 |
| 197 | 3300049591 | Ga0501075_0397767 | Ga0501075_0397767_144_614 | 152 |
| 198 | 3300049592 | Ga0501076_0191550 | Ga0501076_0191550_760_1248 | 152 |
| 199 | 3300049741 | Ga0501079_0051116 | Ga0501079_0051116_2029_2499 | 152 |
| 200 | 3300049742 | Ga0501080_0281953 | Ga0501080_0281953_142_612 | 152 |
| 201 | 3300049743 | Ga0501081_0036874 | Ga0501081_0036874_553_1023 | 152 |
| 202 | 3300049743 | Ga0501081_1222539 | Ga0501081_1222539_16_486 | 152 |
| 203 | 3300049744 | Ga0501083_0268066 | Ga0501083_0268066_464_934 | 152 |
| 204 | 3300049824 | Ga0501045_0055805 | Ga0501045_0055805_1494_1964 | 152 |
| 205 | 3300049824 | Ga0501045_0399318 | Ga0501045_0399318_349_819 | 152 |
| 206 | 3300053078 | Ga0495612_0000068 | Ga0495612_0000068_9113_9604 | 152 |
| 207 | 3300054114 | Ga0501084_0057936 | Ga0501084_0057936_922_1392 | 152 |
| 208 | 3300060353 | Ga0501082_0087433 | Ga0501082_0087433_1546_2016 | 152 |
| 209 | 3300060353 | Ga0501082_0554822 | Ga0501082_0554822_419_889 | 152 |
| 210 | 3300061734 | Ga0530510_0009043 | Ga0530510_0009043_552_1037 | 152 |
| 211 | 3300061734 | Ga0530510_0088844 | Ga0530510_0088844_115_585 | 152 |
| 212 | 3300061734 | Ga0530510_0390514 | Ga0530510_0390514_145_615 | 152 |
| 213 | 3300005457 | Ga0070662_100954800 | Ga0070662_1009548002 | 153 |
| 214 | 3300005536 | Ga0070697_100316348 | Ga0070697_1003163482 | 153 |
| 215 | 3300005544 | Ga0070686_100706288 | Ga0070686_1007062882 | 153 |
| 216 | 3300005563 | Ga0068855_101479343 | Ga0068855_1014793431 | 153 |
| 217 | 3300005564 | Ga0070664_101250359 | Ga0070664_1012503591 | 153 |
| 218 | 3300005614 | Ga0068856_102092982 | Ga0068856_1020929821 | 153 |
| 219 | 3300005937 | Ga0081455_10018302 | Ga0081455_100183025 | 153 |
| 220 | 3300006852 | Ga0075433_10713248 | Ga0075433_107132482 | 153 |
| 221 | 3300009094 | Ga0111539_10079040 | Ga0111539_100790401 | 153 |
| 222 | 3300009148 | Ga0105243_10960304 | Ga0105243_109603042 | 153 |
| 223 | 3300009174 | Ga0105241_11042266 | Ga0105241_110422662 | 153 |
| 224 | 3300009176 | Ga0105242_12042334 | Ga0105242_120423342 | 153 |
| 225 | 3300013105 | Ga0157369_11651760 | Ga0157369_116517602 | 153 |
| 226 | 3300013306 | Ga0163162_10882460 | Ga0163162_108824602 | 153 |
| 227 | 3300013307 | Ga0157372_10589717 | Ga0157372_105897172 | 153 |
| 228 | 3300014497 | Ga0182008_10085412 | Ga0182008_100854122 | 153 |
| 229 | 3300021384 | Ga0213876_10144179 | Ga0213876_101441791 | 153 |
| 230 | 3300025932 | Ga0207690_10926750 | Ga0207690_109267502 | 153 |
| 231 | 3300025934 | Ga0207686_11596430 | Ga0207686_115964301 | 153 |
| 232 | 3300025944 | Ga0207661_10391804 | Ga0207661_103918042 | 153 |
| 233 | 3300026088 | Ga0207641_10580434 | Ga0207641_105804342 | 153 |
| 234 | 3300027907 | Ga0207428_10372827 | Ga0207428_103728272 | 153 |
| 235 | 3300035691 | Ga0373931_1023108 | Ga0373931_1023108_59_529 | 153 |
| 236 | 3300035725 | Ga0373947_0221744 | Ga0373947_0221744_562_1032 | 153 |
| 237 | 3300037068 | Ga0373925_0054160 | Ga0373925_0054160_1899_2369 | 153 |
| 238 | 3300037312 | Ga0395899_0348606 | Ga0395899_0348606_428_961 | 153 |
| 239 | 3300037312 | Ga0395899_0974949 | Ga0395899_0974949_31_498 | 153 |
| 240 | 3300037466 | Ga0395898_0297151 | Ga0395898_0297151_800_1333 | 153 |
| 241 | 3300038443 | Ga0395901_0404534 | Ga0395901_0404534_46_579 | 153 |
| 242 | 3300038443 | Ga0395901_0777694 | Ga0395901_0777694_284_817 | 153 |
| 243 | 3300039450 | Ga0436363_0515453 | Ga0436363_0515453_3041_3526 | 153 |
| 244 | 3300044684 | Ga0466966_0078214 | Ga0466966_0078214_430_906 | 153 |
| 245 | 3300044719 | Ga0466971_0032878 | Ga0466971_0032878_182_655 | 153 |
| 246 | 3300045049 | Ga0466959_0602693 | Ga0466959_0602693_171_644 | 153 |
| 247 | 3300045836 | Ga0466958_0034989 | Ga0466958_0034989_325_798 | 153 |
| 248 | 3300046455 | Ga0495603_0142079 | Ga0495603_0142079_351_821 | 153 |
| 249 | 3300046615 | Ga0495656_0105133 | Ga0495656_0105133_404_877 | 153 |
| 250 | 3300047321 | Ga0495676_0206513 | Ga0495676_0206513_76_546 | 153 |
| 251 | 3300048911 | Ga0496108_0192042 | Ga0496108_0192042_117_599 | 153 |
| 252 | 3300048912 | Ga0496109_0897198 | Ga0496109_0897198_318_788 | 153 |
| 253 | 3300048912 | Ga0496109_0914622 | Ga0496109_0914622_298_780 | 153 |
| 254 | 3300048913 | Ga0496110_0054701 | Ga0496110_0054701_680_1162 | 153 |
| 255 | 3300048913 | Ga0496110_0170843 | Ga0496110_0170843_177_647 | 153 |
| 256 | 3300048914 | Ga0496111_0041014 | Ga0496111_0041014_473_955 | 153 |
| 257 | 3300048914 | Ga0496111_0171406 | Ga0496111_0171406_750_1220 | 153 |
| 258 | 3300048915 | Ga0496112_0410333 | Ga0496112_0410333_719_1201 | 153 |
| 259 | 3300048917 | Ga0496114_0928805 | Ga0496114_0928805_238_708 | 153 |
| 260 | 3300049575 | Ga0501039_0526363 | Ga0501039_0526363_419_889 | 153 |
| 261 | 3300049576 | Ga0501040_0768439 | Ga0501040_0768439_170_640 | 153 |
| 262 | 3300049578 | Ga0501042_0381690 | Ga0501042_0381690_502_972 | 153 |
| 263 | 3300049582 | Ga0501048_0482425 | Ga0501048_0482425_73_543 | 153 |
| 264 | 3300049587 | Ga0501071_1011594 | Ga0501071_1011594_73_543 | 153 |
| 265 | 3300049824 | Ga0501045_0339495 | Ga0501045_0339495_279_749 | 153 |
| 266 | 3300050507 | nmdc:mga05p37_952970_c1 | nmdc:mga05p37_952970_c1_269_736 | 153 |
| 267 | 3300050515 | nmdc:mga0a205_600916_c1 | nmdc:mga0a205_600916_c1_392_859 | 153 |
| 268 | 3300060353 | Ga0501082_0432721 | Ga0501082_0432721_245_790 | 153 |
| 269 | 3300061719 | Ga0466962_0586162 | Ga0466962_0586162_27_497 | 153 |
| 270 | 3300005329 | Ga0070683_100002392 | Ga0070683_1000023925 | 154 |
| 271 | 3300005354 | Ga0070675_100000053 | Ga0070675_10000005368 | 154 |
| 272 | 3300005564 | Ga0070664_100280986 | Ga0070664_1002809862 | 154 |
| 273 | 3300009147 | Ga0114129_11692493 | Ga0114129_116924932 | 154 |
| 274 | 3300013297 | Ga0157378_10016158 | Ga0157378_100161584 | 154 |
| 275 | 3300025926 | Ga0207659_10000010 | Ga0207659_10000010231 | 154 |
| 276 | 3300025944 | Ga0207661_10001740 | Ga0207661_100017405 | 154 |
| 277 | 3300025945 | Ga0207679_10022838 | Ga0207679_100228385 | 154 |
| 278 | 3300026075 | Ga0207708_10813908 | Ga0207708_108139081 | 154 |
| 279 | 3300044694 | Ga0466963_0960407 | Ga0466963_0960407_18_521 | 154 |
| 280 | 3300046461 | Ga0495641_0081376 | Ga0495641_0081376_655_1122 | 154 |
| 281 | 3300046476 | Ga0495662_0520257 | Ga0495662_0520257_72_554 | 154 |
| 282 | 3300046517 | Ga0495630_0000018 | Ga0495630_0000018_136551_137018 | 154 |
| 283 | 3300046674 | Ga0495588_0080408 | Ga0495588_0080408_1120_1638 | 154 |
| 284 | 3300046681 | Ga0495647_0002735 | Ga0495647_0002735_2067_2534 | 154 |
| 285 | 3300046689 | Ga0495613_0071758 | Ga0495613_0071758_1823_2353 | 154 |
| 286 | 3300048903 | Ga0496100_0002460 | Ga0496100_0002460_3884_4390 | 154 |
| 287 | 3300048906 | Ga0496103_0043439 | Ga0496103_0043439_1003_1509 | 154 |
| 288 | 3300048911 | Ga0496108_0037723 | Ga0496108_0037723_3437_3904 | 154 |
| 289 | 3300048912 | Ga0496109_0000028 | Ga0496109_0000028_30328_30795 | 154 |
| 290 | 3300048918 | Ga0496115_0000006 | Ga0496115_0000006_36580_37086 | 154 |
| 291 | 3300048918 | Ga0496115_0000015 | Ga0496115_0000015_125477_125986 | 154 |
| 292 | 3300048925 | Ga0496122_0135518 | Ga0496122_0135518_621_1127 | 154 |
| 293 | 3300009147 | Ga0114129_10280686 | Ga0114129_102806863 | 156 |
| 294 | 3300050507 | nmdc:mga05p37_449265_c1 | nmdc:mga05p37_449265_c1_125_670 | 156 |
| 295 | 3300003203 | JGI25406J46586_10154025 | JGI25406J46586_101540251 | 157 |
| 296 | 3300005985 | Ga0081539_10126443 | Ga0081539_101264432 | 157 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2o8x-assembly1.cif.gz_A | "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" | 0.9781 | 107 | 153 |
| 2h27-assembly2.cif.gz_D | crystal structure of escherichia coli sigmae region 4 bound to its-35 element dna | 0.9714 | 103 | 156 |
| 5fgm-assembly1.cif.gz_A | streptomyces coelicolor sigr region 4 | 0.9634 | 105 | 156 |
| 2o8x-assembly1.cif.gz_B | "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" | 0.9627 | 105 | 153 |
| 3vfz-assembly3.cif.gz_A | crystal structure of -35 promoter binding domain of sigd of mycobacterium tuberculosis | 0.9541 | 105 | 156 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2o8xA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9781 | 107 | 153 | 1.10.10.10 |
| 2h27D00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9714 | 103 | 156 | 1.10.10.10 |
| 4cxfA02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9684 | 105 | 155 | 1.10.10.10 |
| af_P0AGB6_121_191_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9683 | 103 | 155 | 1.10.10.10 |
| 1or7B02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9628 | 103 | 156 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0LQK6-F1-model_v4 | Sigma-70 family RNA polymerase sigma factor | 0.8727 | 1 | 155 |
GO:0003677
GO:0006352 GO:0016987 |
| AF-A0A4Q7L7W3-F1-model_v4 | RNA polymerase sigma factor | 0.8683 | 8 | 156 |
GO:0003677
GO:0006352 GO:0006950 GO:0016987 |
| AF-A0A1F5UDL4-F1-model_v4 | RNA polymerase subunit sigma-24 | 0.8653 | 7 | 155 |
GO:0003677
GO:0006352 GO:0016987 |
| AF-A0A432F7G9-F1-model_v4 | RNA polymerase subunit sigma | 0.8643 | 9 | 155 |
GO:0003677
GO:0006352 GO:0016987 |
| AF-A0A7W0MYA1-F1-model_v4 | RNA polymerase sigma factor | 0.8637 | 1 | 156 |
GO:0003677
GO:0006352 GO:0016987 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar