F393058

General Info

Members Datasets Scaffolds Average Seq Length
296 194 296 156

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100000373|Ga0070708_1000003735
Length 182
Sequence MATPDSKIGPTTRTSRIAAPGRSIHVRLPPFQTLVDAHAQELHRFLIASIGPDGADDALQETFLSALRAYPRLRDATHLRAWLYTIAQHKATDAVRRSIRHRASDIDEVDSRRIAVTPPPSPDDELWSAVRVLPPRQRSAVVHRFVFDLAYREVAERMGVSEEAARQNVSAALRRLRKDVNR

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
68 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
69 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
97 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
98 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
99 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
100 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
106 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
115 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
116 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
117 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
118 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
119 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
120 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
121 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
122 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
123 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
124 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
125 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
126 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
127 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
128 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
129 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
130 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
131 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
132 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
133 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
134 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
135 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
136 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
139 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
140 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
141 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
142 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
143 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
144 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
145 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
146 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
147 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
162 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
172 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
173 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
174 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
175 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
176 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
177 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
178 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
179 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
180 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
181 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
182 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
183 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
184 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
188 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
189 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
190 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
191 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
192 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
193 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
194 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 14.53
Rhizosphere 81.76
Stem 0
Stem Tuber 0
Unclassified 3.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10154025 3300003203 Bacteria 671
2 JGI25404J52841_10004601 3300003659 Bacteria 2808
3 Ga0070676_10634531 3300005328 Bacteria 774
4 Ga0070683_100002392 3300005329 Bacteria 14892
5 Ga0070690_100301445 3300005330 Bacteria 1149
6 Ga0070682_100265126 3300005337 Bacteria 1245
7 Ga0068868_100918430 3300005338 Bacteria 796
8 Ga0070689_100491287 3300005340 Bacteria 1050
9 Ga0070689_101476947 3300005340 Bacteria 615
10 Ga0070661_100314989 3300005344 Bacteria 1221
11 Ga0070668_100431209 3300005347 Bacteria 1130
12 Ga0070668_100501087 3300005347 Bacteria 1051
13 Ga0070669_100800315 3300005353 Bacteria 801
14 Ga0070675_100000053 3300005354 Bacteria 70601
15 Ga0070714_100005960 3300005435 Bacteria 9361
16 Ga0070713_100593344 3300005436 Bacteria 1052
17 Ga0070710_10190505 3300005437 Unclassified 1289
18 Ga0070710_10837702 3300005437 Unclassified 660
19 Ga0070711_100014846 3300005439 Bacteria 4918
20 Ga0070705_100963927 3300005440 Unclassified 690
21 Ga0070700_101285580 3300005441 Bacteria 614
22 Ga0070708_100000373 3300005445 Bacteria 33889
23 Ga0070708_100000572 3300005445 Bacteria 27610
24 Ga0070708_100000666 3300005445 Bacteria 26039
25 Ga0070663_100246262 3300005455 Bacteria 1413
26 Ga0070662_100954800 3300005457 Bacteria 733
27 Ga0070706_100044216 3300005467 Bacteria 4114
28 Ga0070707_100063285 3300005468 Bacteria 3551
29 Ga0070707_100087935 3300005468 Bacteria 3006
30 Ga0070697_100316348 3300005536 Bacteria 1344
31 Ga0068853_101315344 3300005539 Bacteria 699
32 Ga0070686_100706288 3300005544 Bacteria 805
33 Ga0070695_100446349 3300005545 Bacteria 990
34 Ga0070665_100303043 3300005548 Bacteria 1601
35 Ga0068855_101479343 3300005563 Bacteria 698
36 Ga0070664_100280986 3300005564 Bacteria 1501
37 Ga0070664_100552078 3300005564 Bacteria 1065
38 Ga0070664_101250359 3300005564 Bacteria 701
39 Ga0068854_100460292 3300005578 Bacteria 1064
40 Ga0068856_102092982 3300005614 Bacteria 576
41 Ga0068864_100652701 3300005618 Bacteria 1025
42 Ga0068858_100000267 3300005842 Bacteria 55818
43 Ga0068862_101401596 3300005844 Bacteria 702
44 Ga0081455_10018302 3300005937 Bacteria 6678
45 Ga0081455_10312079 3300005937 Bacteria 1123
46 Ga0081455_10463286 3300005937 Bacteria 862
47 Ga0081540_1000006 3300005983 Bacteria 208724
48 Ga0081540_1000221 3300005983 Bacteria 59958
49 Ga0081539_10014219 3300005985 Bacteria 5908
50 Ga0081539_10126443 3300005985 Bacteria 1262
51 Ga0070717_10051839 3300006028 Bacteria 3379
52 Ga0070712_100006788 3300006175 Bacteria 7123
53 Ga0075431_100171091 3300006847 Bacteria 2232
54 Ga0075431_100278304 3300006847 Bacteria 1694
55 Ga0075433_10713248 3300006852 Bacteria 878
56 Ga0075433_11029893 3300006852 Bacteria 717
57 Ga0075434_100285819 3300006871 Bacteria 1669
58 Ga0075434_101015452 3300006871 Unclassified 843
59 Ga0068865_101789646 3300006881 Bacteria 555
60 Ga0075435_100389795 3300007076 Unclassified 1197
61 Ga0075435_100503637 3300007076 Bacteria 1047
62 Ga0111539_10079040 3300009094 Bacteria 3869
63 Ga0105245_10225213 3300009098 Bacteria 1811
64 Ga0105245_10571677 3300009098 Bacteria 1154
65 Ga0114129_10280686 3300009147 Bacteria 2225
66 Ga0114129_11692493 3300009147 Unclassified 772
67 Ga0105243_10960304 3300009148 Bacteria 854
68 Ga0105241_11042266 3300009174 Bacteria 767
69 Ga0105242_12042334 3300009176 Bacteria 616
70 Ga0105248_11018970 3300009177 Bacteria 935
71 Ga0105237_11214764 3300009545 Unclassified 760
72 Ga0105249_10494578 3300009553 Bacteria 1267
73 Ga0105239_10292759 3300010375 Bacteria 1833
74 Ga0105239_11413394 3300010375 Bacteria 803
75 Ga0157338_1009432 3300012515 Bacteria 966
76 Ga0157369_11651760 3300013105 Bacteria 651
77 Ga0157374_10001108 3300013296 Bacteria 23187
78 Ga0157378_10016158 3300013297 Bacteria 6536
79 Ga0163162_10882460 3300013306 Bacteria 1008
80 Ga0157372_10589717 3300013307 Bacteria 1295
81 Ga0157375_10021049 3300013308 Bacteria 5972
82 Ga0157380_10295390 3300014326 Bacteria 1490
83 Ga0157380_11048176 3300014326 Bacteria 852
84 Ga0157380_11367812 3300014326 Bacteria 757
85 Ga0182008_10085412 3300014497 Bacteria 1554
86 Ga0157377_10750897 3300014745 Bacteria 714
87 Ga0157379_10000487 3300014968 Bacteria 32201
88 Ga0213874_10029891 3300021377 Bacteria 1567
89 Ga0213876_10144179 3300021384 Bacteria 1266
90 Ga0213875_10098974 3300021388 Bacteria 1361
91 Ga0207692_10049838 3300025898 Unclassified 2115
92 Ga0207684_10106438 3300025910 Bacteria 2399
93 Ga0207693_10002593 3300025915 Bacteria 15710
94 Ga0207663_10193824 3300025916 Unclassified 1461
95 Ga0207652_10862325 3300025921 Bacteria 801
96 Ga0207646_10087677 3300025922 Bacteria 2785
97 Ga0207646_10274251 3300025922 Bacteria 1524
98 Ga0207659_10000010 3300025926 Bacteria 286639
99 Ga0207664_10007850 3300025929 Bacteria 7414
100 Ga0207644_10179866 3300025931 Bacteria 1657
101 Ga0207690_10926750 3300025932 Bacteria 723
102 Ga0207686_11596430 3300025934 Bacteria 539
103 Ga0207669_10418635 3300025937 Bacteria 1054
104 Ga0207704_11550533 3300025938 Bacteria 569
105 Ga0207661_10001740 3300025944 Bacteria 14901
106 Ga0207661_10391804 3300025944 Bacteria 1259
107 Ga0207679_10022838 3300025945 Bacteria 4266
108 Ga0207712_10336560 3300025961 Bacteria 1250
109 Ga0207640_10621608 3300025981 Bacteria 917
110 Ga0207677_10080636 3300026023 Bacteria 2332
111 Ga0207677_10774076 3300026023 Bacteria 857
112 Ga0207639_10301754 3300026041 Bacteria 1416
113 Ga0207708_10813908 3300026075 Bacteria 805
114 Ga0207641_10580434 3300026088 Bacteria 1096
115 Ga0207676_10404302 3300026095 Bacteria 1277
116 Ga0207674_11139934 3300026116 Bacteria 749
117 Ga0207675_100412250 3300026118 Bacteria 1333
118 Ga0207675_100618309 3300026118 Bacteria 1087
119 Ga0207428_10372827 3300027907 Bacteria 1048
120 Ga0268265_10268856 3300028380 Bacteria 1520
121 Ga0268265_10959064 3300028380 Bacteria 843
122 Ga0268265_11501587 3300028380 Bacteria 677
123 Ga0265319_1042800 3300028563 Bacteria 1523
124 Ga0265320_10019761 3300031240 Bacteria 3672
125 Ga0265313_10114605 3300031595 Bacteria 1182
126 Ga0265314_10201323 3300031711 Bacteria 1177
127 Ga0307413_10617220 3300031824 Bacteria 890
128 Ga0307406_10370405 3300031901 Bacteria 1126
129 Ga0307406_11621943 3300031901 Bacteria 572
130 Ga0307409_100226416 3300031995 Bacteria 1692
131 Ga0307416_100493951 3300032002 Bacteria 1287
132 Ga0307411_10414104 3300032005 Bacteria 1118
133 Ga0373931_1023108 3300035691 Bacteria 560
134 Ga0373947_0221744 3300035725 Bacteria 1243
135 Ga0373925_0054160 3300037068 Bacteria 3000
136 Ga0395899_0051174 3300037312 Bacteria 3066
137 Ga0395899_0348606 3300037312 Unclassified 991
138 Ga0395899_0974949 3300037312 Bacteria 513
139 Ga0395900_0024695 3300037418 Bacteria 6151
140 Ga0395900_1353471 3300037418 Unclassified 625
141 Ga0395898_0297151 3300037466 Bacteria 1541
142 Ga0436364_0734093 3300037853 Bacteria 1153
143 Ga0436364_0911128 3300037853 Bacteria 1763
144 Ga0395901_0404534 3300038443 Bacteria 1402
145 Ga0395901_0777694 3300038443 Bacteria 948
146 Ga0395901_0814013 3300038443 Bacteria 922
147 Ga0436365_0595486 3300039437 Bacteria 572
148 Ga0436365_0672482 3300039437 Bacteria 1798
149 Ga0436365_1276258 3300039437 Bacteria 1128
150 Ga0436360_0792183 3300039438 Bacteria 1350
151 Ga0436363_0515453 3300039450 Bacteria 5029
152 Ga0436363_1357328 3300039450 Bacteria 2210
153 Ga0439466_0172853 3300041411 Bacteria 659
154 Ga0439465_0090410 3300041413 Unclassified 1047
155 Ga0439454_010748 3300042011 Bacteria 1212
156 Ga0450907_040040 3300042146 Bacteria 802
157 Ga0450907_054169 3300042146 Unclassified 690
158 Ga0466966_0078214 3300044684 Bacteria 2063
159 Ga0466961_0326956 3300044693 Unclassified 935
160 Ga0466963_0960407 3300044694 Unclassified 602
161 Ga0466971_0032878 3300044719 Bacteria 2324
162 Ga0466968_0302998 3300044735 Unclassified 769
163 Ga0466957_0500708 3300044842 Bacteria 842
164 Ga0466960_0597449 3300044901 Bacteria 655
165 Ga0466959_0250969 3300045049 Bacteria 1220
166 Ga0466959_0602693 3300045049 Bacteria 739
167 Ga0466958_0034989 3300045836 Bacteria 3000
168 Ga0466958_0456058 3300045836 Bacteria 828
169 Ga0466967_1158254 3300045976 Bacteria 770
170 Ga0495603_0142079 3300046455 Bacteria 1396
171 Ga0495590_0065320 3300046457 Bacteria 1274
172 Ga0495641_0081376 3300046461 Bacteria 1451
173 Ga0495662_0520257 3300046476 Bacteria 583
174 Ga0495584_0185638 3300046491 Bacteria 1057
175 Ga0495594_0372417 3300046499 Bacteria 813
176 Ga0495628_0049243 3300046516 Bacteria 3337
177 Ga0495628_0077274 3300046516 Bacteria 2590
178 Ga0495630_0000018 3300046517 Bacteria 186064
179 Ga0495586_0007791 3300046535 Bacteria 5710
180 Ga0495656_0105133 3300046615 Bacteria 1312
181 Ga0495588_0080408 3300046674 Bacteria 1701
182 Ga0495588_0207339 3300046674 Bacteria 1035
183 Ga0495647_0002735 3300046681 Bacteria 5594
184 Ga0495613_0071758 3300046689 Bacteria 2524
185 Ga0495624_0002494 3300046690 Bacteria 13951
186 Ga0495676_0048565 3300047321 Bacteria 3421
187 Ga0495676_0206513 3300047321 Bacteria 1362
188 Ga0495593_0213910 3300047673 Unclassified 968
189 Ga0496100_0002460 3300048903 Bacteria 9406
190 Ga0496100_0004552 3300048903 Bacteria 7367
191 Ga0496101_0180989 3300048904 Bacteria 1623
192 Ga0496102_0384725 3300048905 Bacteria 1320
193 Ga0496102_0947711 3300048905 Bacteria 782
194 Ga0496103_0043439 3300048906 Bacteria 2767
195 Ga0496104_0193467 3300048907 Bacteria 1946
196 Ga0496105_0010020 3300048908 Bacteria 7436
197 Ga0496105_0224861 3300048908 Bacteria 1527
198 Ga0496105_0243422 3300048908 Bacteria 1459
199 Ga0496107_0198693 3300048910 Bacteria 1490
200 Ga0496108_0000630 3300048911 Bacteria 27529
201 Ga0496108_0000712 3300048911 Bacteria 25838
202 Ga0496108_0037723 3300048911 Bacteria 4026
203 Ga0496108_0192042 3300048911 Bacteria 1770
204 Ga0496108_0226360 3300048911 Bacteria 1625
205 Ga0496108_1121737 3300048911 Bacteria 668
206 Ga0496109_0000028 3300048912 Bacteria 168138
207 Ga0496109_0000168 3300048912 Bacteria 64462
208 Ga0496109_0001732 3300048912 Bacteria 18212
209 Ga0496109_0036482 3300048912 Bacteria 4437
210 Ga0496109_0484445 3300048912 Bacteria 1168
211 Ga0496109_0897198 3300048912 Bacteria 824
212 Ga0496109_0914622 3300048912 Bacteria 815
213 Ga0496109_0931808 3300048912 Bacteria 806
214 Ga0496110_0002009 3300048913 Bacteria 15145
215 Ga0496110_0054701 3300048913 Bacteria 3511
216 Ga0496110_0120801 3300048913 Bacteria 2360
217 Ga0496110_0170843 3300048913 Bacteria 1972
218 Ga0496111_0004528 3300048914 Bacteria 8794
219 Ga0496111_0041014 3300048914 Bacteria 3321
220 Ga0496111_0171406 3300048914 Bacteria 1612
221 Ga0496112_0012587 3300048915 Bacteria 7774
222 Ga0496112_0272637 3300048915 Bacteria 1640
223 Ga0496112_0410333 3300048915 Bacteria 1294
224 Ga0496113_0040585 3300048916 Bacteria 3430
225 Ga0496113_0361724 3300048916 Bacteria 1164
226 Ga0496114_0077717 3300048917 Bacteria 2799
227 Ga0496114_0078193 3300048917 Bacteria 2791
228 Ga0496114_0928805 3300048917 Bacteria 752
229 Ga0496115_0000006 3300048918 Bacteria 252944
230 Ga0496115_0000015 3300048918 Bacteria 200845
231 Ga0496115_0004548 3300048918 Bacteria 10037
232 Ga0496122_0135518 3300048925 Bacteria 1553
233 Ga0501031_0056650 3300049568 Bacteria 2554
234 Ga0501036_0183274 3300049572 Bacteria 1762
235 Ga0501036_0710017 3300049572 Bacteria 831
236 Ga0501037_0414371 3300049573 Bacteria 923
237 Ga0501039_0279845 3300049575 Bacteria 1311
238 Ga0501039_0526363 3300049575 Unclassified 928
239 Ga0501040_0017372 3300049576 Bacteria 4774
240 Ga0501040_0020214 3300049576 Bacteria 4436
241 Ga0501040_0171585 3300049576 Bacteria 1536
242 Ga0501040_0271193 3300049576 Bacteria 1212
243 Ga0501040_0768439 3300049576 Unclassified 697
244 Ga0501041_0050745 3300049577 Bacteria 2528
245 Ga0501041_0168417 3300049577 Bacteria 1370
246 Ga0501042_0002137 3300049578 Bacteria 12004
247 Ga0501042_0022940 3300049578 Bacteria 4361
248 Ga0501042_0381690 3300049578 Bacteria 1020
249 Ga0501046_0478629 3300049580 Unclassified 893
250 Ga0501048_0101100 3300049582 Bacteria 2034
251 Ga0501048_0191226 3300049582 Bacteria 1450
252 Ga0501048_0482425 3300049582 Bacteria 889
253 Ga0501067_0003672 3300049583 Bacteria 8458
254 Ga0501068_0157576 3300049584 Bacteria 1430
255 Ga0501068_0374186 3300049584 Bacteria 917
256 Ga0501069_0023959 3300049585 Bacteria 3328
257 Ga0501070_1046396 3300049586 Bacteria 631
258 Ga0501071_0023283 3300049587 Bacteria 4326
259 Ga0501071_0073120 3300049587 Bacteria 2500
260 Ga0501071_1011594 3300049587 Bacteria 642
261 Ga0501071_1014392 3300049587 Bacteria 641
262 Ga0501072_0114476 3300049588 Bacteria 2147
263 Ga0501074_0063013 3300049590 Bacteria 2671
264 Ga0501074_0066631 3300049590 Bacteria 2590
265 Ga0501075_0018912 3300049591 Bacteria 4993
266 Ga0501075_0397767 3300049591 Bacteria 1050
267 Ga0501076_0016447 3300049592 Bacteria 5609
268 Ga0501076_0191550 3300049592 Bacteria 1669
269 Ga0501079_0051116 3300049741 Bacteria 3190
270 Ga0501079_0095027 3300049741 Bacteria 2310
271 Ga0501080_0281953 3300049742 Bacteria 1510
272 Ga0501081_0036874 3300049743 Bacteria 3335
273 Ga0501081_0406514 3300049743 Bacteria 1008
274 Ga0501081_1222539 3300049743 Bacteria 569
275 Ga0501083_0268066 3300049744 Bacteria 1111
276 Ga0501044_1544378 3300049823 Bacteria 529
277 Ga0501045_0055805 3300049824 Bacteria 2889
278 Ga0501045_0097222 3300049824 Bacteria 2178
279 Ga0501045_0339495 3300049824 Bacteria 1118
280 Ga0501045_0399318 3300049824 Bacteria 1023
281 nmdc:mga05p37_449265_c1 3300050507 Bacteria 1492
282 nmdc:mga05p37_952970_c1 3300050507 Bacteria 918
283 nmdc:mga0n895_1282546_c1 3300050512 Unclassified 704
284 nmdc:mga0rr50_1821751_c1 3300050513 Unclassified 512
285 nmdc:mga0a205_1225524_c1 3300050515 Bacteria 598
286 nmdc:mga0a205_600916_c1 3300050515 Bacteria 953
287 Ga0495612_0000068 3300053078 Bacteria 47169
288 Ga0501084_0057936 3300054114 Bacteria 3241
289 Ga0501082_0087433 3300060353 Bacteria 2689
290 Ga0501082_0432721 3300060353 Bacteria 1149
291 Ga0501082_0554822 3300060353 Bacteria 1005
292 Ga0501082_0635558 3300060353 Bacteria 934
293 Ga0466962_0586162 3300061719 Bacteria 568
294 Ga0530510_0009043 3300061734 Bacteria 6982
295 Ga0530510_0088844 3300061734 Bacteria 2253
296 Ga0530510_0390514 3300061734 Unclassified 1048

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049576 Ga0501040_0271193 Ga0501040_0271193_12_404 128
2 3300047321 Ga0495676_0048565 Ga0495676_0048565_1914_2381 132
3 3300047673 Ga0495593_0213910 Ga0495593_0213910_449_856 134
4 3300049582 Ga0501048_0191226 Ga0501048_0191226_1008_1412 134
5 3300048903 Ga0496100_0004552 Ga0496100_0004552_6932_7348 135
6 3300037418 Ga0395900_1353471 Ga0395900_1353471_178_615 136
7 3300005330 Ga0070690_100301445 Ga0070690_1003014451 138
8 3300005564 Ga0070664_100552078 Ga0070664_1005520782 138
9 3300049823 Ga0501044_1544378 Ga0501044_1544378_88_516 138
10 3300005445 Ga0070708_100000572 Ga0070708_10000057211 140
11 3300025898 Ga0207692_10049838 Ga0207692_100498382 140
12 3300037853 Ga0436364_0911128 Ga0436364_0911128_849_1295 140
13 3300048917 Ga0496114_0078193 Ga0496114_0078193_2108_2560 140
14 3300048918 Ga0496115_0004548 Ga0496115_0004548_6356_6808 140
15 3300048908 Ga0496105_0224861 Ga0496105_0224861_658_1155 144
16 3300049572 Ga0501036_0183274 Ga0501036_0183274_138_683 145
17 3300049577 Ga0501041_0050745 Ga0501041_0050745_1693_2238 145
18 3300049582 Ga0501048_0101100 Ga0501048_0101100_518_1063 145
19 3300049587 Ga0501071_0023283 Ga0501071_0023283_1564_2109 145
20 3300049590 Ga0501074_0063013 Ga0501074_0063013_1486_2031 145
21 3300049592 Ga0501076_0016447 Ga0501076_0016447_3374_3919 145
22 3300049741 Ga0501079_0095027 Ga0501079_0095027_289_834 145
23 3300049743 Ga0501081_0406514 Ga0501081_0406514_198_743 145
24 3300049824 Ga0501045_0097222 Ga0501045_0097222_529_1074 145
25 3300005338 Ga0068868_100918430 Ga0068868_1009184302 146
26 3300005344 Ga0070661_100314989 Ga0070661_1003149892 146
27 3300009177 Ga0105248_11018970 Ga0105248_110189702 146
28 3300014745 Ga0157377_10750897 Ga0157377_107508972 146
29 3300026023 Ga0207677_10080636 Ga0207677_100806363 146
30 3300048905 Ga0496102_0384725 Ga0496102_0384725_32_505 146
31 3300048911 Ga0496108_0000712 Ga0496108_0000712_12960_13433 146
32 3300048912 Ga0496109_0001732 Ga0496109_0001732_14195_14668 146
33 3300048913 Ga0496110_0002009 Ga0496110_0002009_1731_2204 146
34 3300048914 Ga0496111_0004528 Ga0496111_0004528_6041_6514 146
35 3300048916 Ga0496113_0361724 Ga0496113_0361724_663_1136 146
36 3300005435 Ga0070714_100005960 Ga0070714_10000596010 147
37 3300005436 Ga0070713_100593344 Ga0070713_1005933442 147
38 3300005437 Ga0070710_10190505 Ga0070710_101905052 147
39 3300005437 Ga0070710_10837702 Ga0070710_108377021 147
40 3300005439 Ga0070711_100014846 Ga0070711_1000148463 147
41 3300006028 Ga0070717_10051839 Ga0070717_100518392 147
42 3300006175 Ga0070712_100006788 Ga0070712_1000067884 147
43 3300025915 Ga0207693_10002593 Ga0207693_100025936 147
44 3300025916 Ga0207663_10193824 Ga0207663_101938242 147
45 3300025929 Ga0207664_10007850 Ga0207664_100078502 147
46 3300046690 Ga0495624_0002494 Ga0495624_0002494_12310_12777 147
47 3300005468 Ga0070707_100063285 Ga0070707_1000632853 148
48 3300025922 Ga0207646_10087677 Ga0207646_100876773 148
49 3300003659 JGI25404J52841_10004601 JGI25404J52841_100046013 149
50 3300005445 Ga0070708_100000666 Ga0070708_1000006668 149
51 3300021388 Ga0213875_10098974 Ga0213875_100989742 149
52 3300028563 Ga0265319_1042800 Ga0265319_10428002 149
53 3300031240 Ga0265320_10019761 Ga0265320_100197612 149
54 3300031595 Ga0265313_10114605 Ga0265313_101146052 149
55 3300031711 Ga0265314_10201323 Ga0265314_102013232 149
56 3300039437 Ga0436365_1276258 Ga0436365_1276258_79_540 149
57 3300048911 Ga0496108_0000630 Ga0496108_0000630_23932_24390 149
58 3300048912 Ga0496109_0000168 Ga0496109_0000168_60873_61331 149
59 3300014968 Ga0157379_10000487 Ga0157379_1000048720 150
60 3300039438 Ga0436360_0792183 Ga0436360_0792183_432_902 150
61 3300041411 Ga0439466_0172853 Ga0439466_0172853_150_614 150
62 3300042146 Ga0450907_054169 Ga0450907_054169_23_487 150
63 3300046491 Ga0495584_0185638 Ga0495584_0185638_126_587 150
64 3300048905 Ga0496102_0947711 Ga0496102_0947711_166_624 150
65 3300049580 Ga0501046_0478629 Ga0501046_0478629_389_853 150
66 3300060353 Ga0501082_0635558 Ga0501082_0635558_12_470 150
67 3300005340 Ga0070689_100491287 Ga0070689_1004912872 151
68 3300005347 Ga0070668_100501087 Ga0070668_1005010872 151
69 3300005440 Ga0070705_100963927 Ga0070705_1009639271 151
70 3300005844 Ga0068862_101401596 Ga0068862_1014015962 151
71 3300006852 Ga0075433_11029893 Ga0075433_110298931 151
72 3300006871 Ga0075434_101015452 Ga0075434_1010154522 151
73 3300007076 Ga0075435_100389795 Ga0075435_1003897952 151
74 3300007076 Ga0075435_100503637 Ga0075435_1005036371 151
75 3300009553 Ga0105249_10494578 Ga0105249_104945782 151
76 3300014326 Ga0157380_10295390 Ga0157380_102953903 151
77 3300021377 Ga0213874_10029891 Ga0213874_100298912 151
78 3300028380 Ga0268265_10959064 Ga0268265_109590642 151
79 3300031824 Ga0307413_10617220 Ga0307413_106172202 151
80 3300031901 Ga0307406_11621943 Ga0307406_116219431 151
81 3300031995 Ga0307409_100226416 Ga0307409_1002264162 151
82 3300032005 Ga0307411_10414104 Ga0307411_104141042 151
83 3300039437 Ga0436365_0672482 Ga0436365_0672482_746_1216 151
84 3300039450 Ga0436363_1357328 Ga0436363_1357328_253_720 151
85 3300042146 Ga0450907_040040 Ga0450907_040040_107_574 151
86 3300044693 Ga0466961_0326956 Ga0466961_0326956_189_653 151
87 3300044842 Ga0466957_0500708 Ga0466957_0500708_364_828 151
88 3300045049 Ga0466959_0250969 Ga0466959_0250969_313_777 151
89 3300045976 Ga0466967_1158254 Ga0466967_1158254_233_697 151
90 3300046499 Ga0495594_0372417 Ga0495594_0372417_252_800 151
91 3300046674 Ga0495588_0207339 Ga0495588_0207339_140_604 151
92 3300048911 Ga0496108_1121737 Ga0496108_1121737_148_612 151
93 3300048912 Ga0496109_0484445 Ga0496109_0484445_431_898 151
94 3300050512 nmdc:mga0n895_1282546_c1 nmdc:mga0n895_1282546_c1_43_510 151
95 3300050513 nmdc:mga0rr50_1821751_c1 nmdc:mga0rr50_1821751_c1_28_501 151
96 3300050515 nmdc:mga0a205_1225524_c1 nmdc:mga0a205_1225524_c1_67_564 151
97 3300005328 Ga0070676_10634531 Ga0070676_106345311 152
98 3300005337 Ga0070682_100265126 Ga0070682_1002651262 152
99 3300005340 Ga0070689_101476947 Ga0070689_1014769471 152
100 3300005347 Ga0070668_100431209 Ga0070668_1004312092 152
101 3300005353 Ga0070669_100800315 Ga0070669_1008003152 152
102 3300005441 Ga0070700_101285580 Ga0070700_1012855801 152
103 3300005445 Ga0070708_100000373 Ga0070708_1000003735 152
104 3300005455 Ga0070663_100246262 Ga0070663_1002462621 152
105 3300005467 Ga0070706_100044216 Ga0070706_1000442163 152
106 3300005468 Ga0070707_100087935 Ga0070707_1000879353 152
107 3300005539 Ga0068853_101315344 Ga0068853_1013153441 152
108 3300005545 Ga0070695_100446349 Ga0070695_1004463491 152
109 3300005548 Ga0070665_100303043 Ga0070665_1003030432 152
110 3300005578 Ga0068854_100460292 Ga0068854_1004602922 152
111 3300005618 Ga0068864_100652701 Ga0068864_1006527012 152
112 3300005842 Ga0068858_100000267 Ga0068858_10000026737 152
113 3300005937 Ga0081455_10312079 Ga0081455_103120792 152
114 3300005937 Ga0081455_10463286 Ga0081455_104632862 152
115 3300005983 Ga0081540_1000006 Ga0081540_1000006206 152
116 3300005983 Ga0081540_1000221 Ga0081540_100022161 152
117 3300005985 Ga0081539_10014219 Ga0081539_100142193 152
118 3300006847 Ga0075431_100171091 Ga0075431_1001710912 152
119 3300006847 Ga0075431_100278304 Ga0075431_1002783043 152
120 3300006871 Ga0075434_100285819 Ga0075434_1002858192 152
121 3300006881 Ga0068865_101789646 Ga0068865_1017896461 152
122 3300009098 Ga0105245_10225213 Ga0105245_102252133 152
123 3300009098 Ga0105245_10571677 Ga0105245_105716772 152
124 3300009545 Ga0105237_11214764 Ga0105237_112147641 152
125 3300010375 Ga0105239_10292759 Ga0105239_102927593 152
126 3300010375 Ga0105239_11413394 Ga0105239_114133941 152
127 3300012515 Ga0157338_1009432 Ga0157338_10094322 152
128 3300013296 Ga0157374_10001108 Ga0157374_100011089 152
129 3300013308 Ga0157375_10021049 Ga0157375_100210495 152
130 3300014326 Ga0157380_11048176 Ga0157380_110481762 152
131 3300014326 Ga0157380_11367812 Ga0157380_113678122 152
132 3300025910 Ga0207684_10106438 Ga0207684_101064382 152
133 3300025921 Ga0207652_10862325 Ga0207652_108623252 152
134 3300025922 Ga0207646_10274251 Ga0207646_102742512 152
135 3300025931 Ga0207644_10179866 Ga0207644_101798662 152
136 3300025937 Ga0207669_10418635 Ga0207669_104186352 152
137 3300025938 Ga0207704_11550533 Ga0207704_115505331 152
138 3300025961 Ga0207712_10336560 Ga0207712_103365602 152
139 3300025981 Ga0207640_10621608 Ga0207640_106216081 152
140 3300026023 Ga0207677_10774076 Ga0207677_107740762 152
141 3300026041 Ga0207639_10301754 Ga0207639_103017543 152
142 3300026095 Ga0207676_10404302 Ga0207676_104043022 152
143 3300026116 Ga0207674_11139934 Ga0207674_111399342 152
144 3300026118 Ga0207675_100412250 Ga0207675_1004122502 152
145 3300026118 Ga0207675_100618309 Ga0207675_1006183091 152
146 3300028380 Ga0268265_10268856 Ga0268265_102688562 152
147 3300028380 Ga0268265_11501587 Ga0268265_115015872 152
148 3300031901 Ga0307406_10370405 Ga0307406_103704052 152
149 3300032002 Ga0307416_100493951 Ga0307416_1004939513 152
150 3300037312 Ga0395899_0051174 Ga0395899_0051174_1359_1844 152
151 3300037418 Ga0395900_0024695 Ga0395900_0024695_281_766 152
152 3300037853 Ga0436364_0734093 Ga0436364_0734093_561_1040 152
153 3300038443 Ga0395901_0814013 Ga0395901_0814013_404_865 152
154 3300039437 Ga0436365_0595486 Ga0436365_0595486_71_541 152
155 3300041413 Ga0439465_0090410 Ga0439465_0090410_359_850 152
156 3300042011 Ga0439454_010748 Ga0439454_010748_159_629 152
157 3300044735 Ga0466968_0302998 Ga0466968_0302998_122_592 152
158 3300044901 Ga0466960_0597449 Ga0466960_0597449_56_526 152
159 3300045836 Ga0466958_0456058 Ga0466958_0456058_343_810 152
160 3300046457 Ga0495590_0065320 Ga0495590_0065320_755_1222 152
161 3300046516 Ga0495628_0049243 Ga0495628_0049243_267_734 152
162 3300046516 Ga0495628_0077274 Ga0495628_0077274_1591_2082 152
163 3300046535 Ga0495586_0007791 Ga0495586_0007791_4974_5435 152
164 3300048904 Ga0496101_0180989 Ga0496101_0180989_45_512 152
165 3300048907 Ga0496104_0193467 Ga0496104_0193467_98_565 152
166 3300048908 Ga0496105_0010020 Ga0496105_0010020_3088_3555 152
167 3300048908 Ga0496105_0243422 Ga0496105_0243422_941_1408 152
168 3300048910 Ga0496107_0198693 Ga0496107_0198693_690_1157 152
169 3300048911 Ga0496108_0226360 Ga0496108_0226360_823_1290 152
170 3300048912 Ga0496109_0036482 Ga0496109_0036482_1936_2403 152
171 3300048912 Ga0496109_0931808 Ga0496109_0931808_121_588 152
172 3300048913 Ga0496110_0120801 Ga0496110_0120801_1066_1533 152
173 3300048915 Ga0496112_0012587 Ga0496112_0012587_2361_2828 152
174 3300048915 Ga0496112_0272637 Ga0496112_0272637_900_1367 152
175 3300048916 Ga0496113_0040585 Ga0496113_0040585_690_1157 152
176 3300048917 Ga0496114_0077717 Ga0496114_0077717_28_495 152
177 3300049568 Ga0501031_0056650 Ga0501031_0056650_67_537 152
178 3300049572 Ga0501036_0710017 Ga0501036_0710017_216_686 152
179 3300049573 Ga0501037_0414371 Ga0501037_0414371_58_528 152
180 3300049575 Ga0501039_0279845 Ga0501039_0279845_63_533 152
181 3300049576 Ga0501040_0017372 Ga0501040_0017372_1865_2335 152
182 3300049576 Ga0501040_0020214 Ga0501040_0020214_2859_3329 152
183 3300049576 Ga0501040_0171585 Ga0501040_0171585_449_919 152
184 3300049577 Ga0501041_0168417 Ga0501041_0168417_557_1027 152
185 3300049578 Ga0501042_0002137 Ga0501042_0002137_5044_5514 152
186 3300049578 Ga0501042_0022940 Ga0501042_0022940_2014_2484 152
187 3300049583 Ga0501067_0003672 Ga0501067_0003672_6828_7313 152
188 3300049584 Ga0501068_0157576 Ga0501068_0157576_932_1402 152
189 3300049584 Ga0501068_0374186 Ga0501068_0374186_433_903 152
190 3300049585 Ga0501069_0023959 Ga0501069_0023959_1719_2204 152
191 3300049586 Ga0501070_1046396 Ga0501070_1046396_77_547 152
192 3300049587 Ga0501071_0073120 Ga0501071_0073120_145_615 152
193 3300049587 Ga0501071_1014392 Ga0501071_1014392_151_621 152
194 3300049588 Ga0501072_0114476 Ga0501072_0114476_1096_1566 152
195 3300049590 Ga0501074_0066631 Ga0501074_0066631_137_607 152
196 3300049591 Ga0501075_0018912 Ga0501075_0018912_4406_4876 152
197 3300049591 Ga0501075_0397767 Ga0501075_0397767_144_614 152
198 3300049592 Ga0501076_0191550 Ga0501076_0191550_760_1248 152
199 3300049741 Ga0501079_0051116 Ga0501079_0051116_2029_2499 152
200 3300049742 Ga0501080_0281953 Ga0501080_0281953_142_612 152
201 3300049743 Ga0501081_0036874 Ga0501081_0036874_553_1023 152
202 3300049743 Ga0501081_1222539 Ga0501081_1222539_16_486 152
203 3300049744 Ga0501083_0268066 Ga0501083_0268066_464_934 152
204 3300049824 Ga0501045_0055805 Ga0501045_0055805_1494_1964 152
205 3300049824 Ga0501045_0399318 Ga0501045_0399318_349_819 152
206 3300053078 Ga0495612_0000068 Ga0495612_0000068_9113_9604 152
207 3300054114 Ga0501084_0057936 Ga0501084_0057936_922_1392 152
208 3300060353 Ga0501082_0087433 Ga0501082_0087433_1546_2016 152
209 3300060353 Ga0501082_0554822 Ga0501082_0554822_419_889 152
210 3300061734 Ga0530510_0009043 Ga0530510_0009043_552_1037 152
211 3300061734 Ga0530510_0088844 Ga0530510_0088844_115_585 152
212 3300061734 Ga0530510_0390514 Ga0530510_0390514_145_615 152
213 3300005457 Ga0070662_100954800 Ga0070662_1009548002 153
214 3300005536 Ga0070697_100316348 Ga0070697_1003163482 153
215 3300005544 Ga0070686_100706288 Ga0070686_1007062882 153
216 3300005563 Ga0068855_101479343 Ga0068855_1014793431 153
217 3300005564 Ga0070664_101250359 Ga0070664_1012503591 153
218 3300005614 Ga0068856_102092982 Ga0068856_1020929821 153
219 3300005937 Ga0081455_10018302 Ga0081455_100183025 153
220 3300006852 Ga0075433_10713248 Ga0075433_107132482 153
221 3300009094 Ga0111539_10079040 Ga0111539_100790401 153
222 3300009148 Ga0105243_10960304 Ga0105243_109603042 153
223 3300009174 Ga0105241_11042266 Ga0105241_110422662 153
224 3300009176 Ga0105242_12042334 Ga0105242_120423342 153
225 3300013105 Ga0157369_11651760 Ga0157369_116517602 153
226 3300013306 Ga0163162_10882460 Ga0163162_108824602 153
227 3300013307 Ga0157372_10589717 Ga0157372_105897172 153
228 3300014497 Ga0182008_10085412 Ga0182008_100854122 153
229 3300021384 Ga0213876_10144179 Ga0213876_101441791 153
230 3300025932 Ga0207690_10926750 Ga0207690_109267502 153
231 3300025934 Ga0207686_11596430 Ga0207686_115964301 153
232 3300025944 Ga0207661_10391804 Ga0207661_103918042 153
233 3300026088 Ga0207641_10580434 Ga0207641_105804342 153
234 3300027907 Ga0207428_10372827 Ga0207428_103728272 153
235 3300035691 Ga0373931_1023108 Ga0373931_1023108_59_529 153
236 3300035725 Ga0373947_0221744 Ga0373947_0221744_562_1032 153
237 3300037068 Ga0373925_0054160 Ga0373925_0054160_1899_2369 153
238 3300037312 Ga0395899_0348606 Ga0395899_0348606_428_961 153
239 3300037312 Ga0395899_0974949 Ga0395899_0974949_31_498 153
240 3300037466 Ga0395898_0297151 Ga0395898_0297151_800_1333 153
241 3300038443 Ga0395901_0404534 Ga0395901_0404534_46_579 153
242 3300038443 Ga0395901_0777694 Ga0395901_0777694_284_817 153
243 3300039450 Ga0436363_0515453 Ga0436363_0515453_3041_3526 153
244 3300044684 Ga0466966_0078214 Ga0466966_0078214_430_906 153
245 3300044719 Ga0466971_0032878 Ga0466971_0032878_182_655 153
246 3300045049 Ga0466959_0602693 Ga0466959_0602693_171_644 153
247 3300045836 Ga0466958_0034989 Ga0466958_0034989_325_798 153
248 3300046455 Ga0495603_0142079 Ga0495603_0142079_351_821 153
249 3300046615 Ga0495656_0105133 Ga0495656_0105133_404_877 153
250 3300047321 Ga0495676_0206513 Ga0495676_0206513_76_546 153
251 3300048911 Ga0496108_0192042 Ga0496108_0192042_117_599 153
252 3300048912 Ga0496109_0897198 Ga0496109_0897198_318_788 153
253 3300048912 Ga0496109_0914622 Ga0496109_0914622_298_780 153
254 3300048913 Ga0496110_0054701 Ga0496110_0054701_680_1162 153
255 3300048913 Ga0496110_0170843 Ga0496110_0170843_177_647 153
256 3300048914 Ga0496111_0041014 Ga0496111_0041014_473_955 153
257 3300048914 Ga0496111_0171406 Ga0496111_0171406_750_1220 153
258 3300048915 Ga0496112_0410333 Ga0496112_0410333_719_1201 153
259 3300048917 Ga0496114_0928805 Ga0496114_0928805_238_708 153
260 3300049575 Ga0501039_0526363 Ga0501039_0526363_419_889 153
261 3300049576 Ga0501040_0768439 Ga0501040_0768439_170_640 153
262 3300049578 Ga0501042_0381690 Ga0501042_0381690_502_972 153
263 3300049582 Ga0501048_0482425 Ga0501048_0482425_73_543 153
264 3300049587 Ga0501071_1011594 Ga0501071_1011594_73_543 153
265 3300049824 Ga0501045_0339495 Ga0501045_0339495_279_749 153
266 3300050507 nmdc:mga05p37_952970_c1 nmdc:mga05p37_952970_c1_269_736 153
267 3300050515 nmdc:mga0a205_600916_c1 nmdc:mga0a205_600916_c1_392_859 153
268 3300060353 Ga0501082_0432721 Ga0501082_0432721_245_790 153
269 3300061719 Ga0466962_0586162 Ga0466962_0586162_27_497 153
270 3300005329 Ga0070683_100002392 Ga0070683_1000023925 154
271 3300005354 Ga0070675_100000053 Ga0070675_10000005368 154
272 3300005564 Ga0070664_100280986 Ga0070664_1002809862 154
273 3300009147 Ga0114129_11692493 Ga0114129_116924932 154
274 3300013297 Ga0157378_10016158 Ga0157378_100161584 154
275 3300025926 Ga0207659_10000010 Ga0207659_10000010231 154
276 3300025944 Ga0207661_10001740 Ga0207661_100017405 154
277 3300025945 Ga0207679_10022838 Ga0207679_100228385 154
278 3300026075 Ga0207708_10813908 Ga0207708_108139081 154
279 3300044694 Ga0466963_0960407 Ga0466963_0960407_18_521 154
280 3300046461 Ga0495641_0081376 Ga0495641_0081376_655_1122 154
281 3300046476 Ga0495662_0520257 Ga0495662_0520257_72_554 154
282 3300046517 Ga0495630_0000018 Ga0495630_0000018_136551_137018 154
283 3300046674 Ga0495588_0080408 Ga0495588_0080408_1120_1638 154
284 3300046681 Ga0495647_0002735 Ga0495647_0002735_2067_2534 154
285 3300046689 Ga0495613_0071758 Ga0495613_0071758_1823_2353 154
286 3300048903 Ga0496100_0002460 Ga0496100_0002460_3884_4390 154
287 3300048906 Ga0496103_0043439 Ga0496103_0043439_1003_1509 154
288 3300048911 Ga0496108_0037723 Ga0496108_0037723_3437_3904 154
289 3300048912 Ga0496109_0000028 Ga0496109_0000028_30328_30795 154
290 3300048918 Ga0496115_0000006 Ga0496115_0000006_36580_37086 154
291 3300048918 Ga0496115_0000015 Ga0496115_0000015_125477_125986 154
292 3300048925 Ga0496122_0135518 Ga0496122_0135518_621_1127 154
293 3300009147 Ga0114129_10280686 Ga0114129_102806863 156
294 3300050507 nmdc:mga05p37_449265_c1 nmdc:mga05p37_449265_c1_125_670 156
295 3300003203 JGI25406J46586_10154025 JGI25406J46586_101540251 157
296 3300005985 Ga0081539_10126443 Ga0081539_101264432 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08281

Sigma70_r4_2

Sigma-70, region 4

123

176

0.97

PF04545

Sigma70_r4

Sigma-70, region 4

129

178

0.96

PF04542

Sigma70_r2

Sigma-70 region 2

34

101

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o8x-assembly1.cif.gz_A "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.9781 107 153
2h27-assembly2.cif.gz_D crystal structure of escherichia coli sigmae region 4 bound to its-35 element dna 0.9714 103 156
5fgm-assembly1.cif.gz_A streptomyces coelicolor sigr region 4 0.9634 105 156
2o8x-assembly1.cif.gz_B "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.9627 105 153
3vfz-assembly3.cif.gz_A crystal structure of -35 promoter binding domain of sigd of mycobacterium tuberculosis 0.9541 105 156
ID Description Score Start End Superfamily
2o8xA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9781 107 153 1.10.10.10
2h27D00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9714 103 156 1.10.10.10
4cxfA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9684 105 155 1.10.10.10
af_P0AGB6_121_191_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9683 103 155 1.10.10.10
1or7B02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9628 103 156 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7W0LQK6-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.8727 1 155 GO:0003677
GO:0006352
GO:0016987
AF-A0A4Q7L7W3-F1-model_v4 RNA polymerase sigma factor 0.8683 8 156 GO:0003677
GO:0006352
GO:0006950
GO:0016987
AF-A0A1F5UDL4-F1-model_v4 RNA polymerase subunit sigma-24 0.8653 7 155 GO:0003677
GO:0006352
GO:0016987
AF-A0A432F7G9-F1-model_v4 RNA polymerase subunit sigma 0.8643 9 155 GO:0003677
GO:0006352
GO:0016987
AF-A0A7W0MYA1-F1-model_v4 RNA polymerase sigma factor 0.8637 1 156 GO:0003677
GO:0006352
GO:0016987

Feature Viewer

pLDDT pTM Quality
86.05 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map