F393029

General Info

Members Datasets Scaffolds Average Seq Length
296 163 592 174

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_100149258|Ga0070668_1001492584
Length 178
Sequence LTKQQHTLSVLVENEFGVLARVAGLFSGRGFNIESLCVAANPLDPTMSRITLVTTGDDLVLEQITKQLNKIVHVVKVTDFKDVATVDRELALIKVAAEERSRGEVMNVVDIFRAKIVDVGSKSFIIEVTGNEEKIEALIDLLRPIGILEVVRTGRVAIARGNQKTTGSGTLPSKEKVA

Samples

Sample ID Description Type Environment
1 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
2 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
108 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
109 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
110 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
111 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
112 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
113 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
114 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
115 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
116 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
119 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
120 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
121 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
124 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
125 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
126 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
127 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
129 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
130 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
131 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
132 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
133 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
135 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
136 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
139 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
140 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
141 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
142 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
145 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
146 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
147 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
148 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
149 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
150 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
155 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
156 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
157 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
160 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
161 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
162 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
163 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.99
Metatranscriptomes 1.01
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.01
Rhizosphere 97.3
Stem 0
Stem Tuber 0
Unclassified 1.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070668_100149258 3300005347 Bacteria 1889
2 Ga0058858_1404229 3300004785 Bacteria 1625
3 Ga0058859_10120825 3300004798 Bacteria 6329
4 Ga0058860_10232447 3300004801 Bacteria 4389
5 Ga0065704_10353750 3300005289 Unclassified 806
6 Ga0065704_10571013 3300005289 Bacteria 623
7 Ga0065715_10459592 3300005293 Bacteria 817
8 Ga0065707_10410964 3300005295 Bacteria 841
9 Ga0070676_10395524 3300005328 Bacteria 960
10 Ga0070690_100446610 3300005330 Bacteria 958
11 Ga0070690_100721240 3300005330 Bacteria 767
12 Ga0070670_100292612 3300005331 Bacteria 1423
13 Ga0070670_100302909 3300005331 Bacteria 1398
14 Ga0070670_100386213 3300005331 Bacteria 1234
15 Ga0070670_100388481 3300005331 Bacteria 1230
16 Ga0068868_100447281 3300005338 Bacteria 1123
17 Ga0070687_100086175 3300005343 Bacteria 1726
18 Ga0070687_100685496 3300005343 Bacteria 714
19 Ga0070668_100055802 3300005347 Bacteria 3050
20 Ga0070668_100219009 3300005347 Bacteria 1569
21 Ga0070668_101010978 3300005347 Bacteria 747
22 Ga0070669_100000705 3300005353 Bacteria 24491
23 Ga0070669_100233855 3300005353 Bacteria 1457
24 Ga0070669_100639946 3300005353 Bacteria 894
25 Ga0070675_100293437 3300005354 Bacteria 1431
26 Ga0070675_100408968 3300005354 Bacteria 1211
27 Ga0070671_101127707 3300005355 Bacteria 689
28 Ga0070674_100443232 3300005356 Bacteria 1070
29 Ga0070688_100617727 3300005365 Bacteria 831
30 Ga0070709_10375361 3300005434 Bacteria 1056
31 Ga0070701_10398629 3300005438 Bacteria 871
32 Ga0070711_100077464 3300005439 Bacteria 2360
33 Ga0070705_100144020 3300005440 Bacteria 1572
34 Ga0070705_100365997 3300005440 Unclassified 1056
35 Ga0070700_100033544 3300005441 Bacteria 3093
36 Ga0070700_100421508 3300005441 Bacteria 1009
37 Ga0070694_100343892 3300005444 Bacteria 1154
38 Ga0070708_101002862 3300005445 Bacteria 783
39 Ga0070663_100432717 3300005455 Bacteria 1081
40 Ga0070662_100290216 3300005457 Bacteria 1326
41 Ga0070662_100476858 3300005457 Bacteria 1038
42 Ga0068867_100233105 3300005459 Bacteria 1489
43 Ga0068867_100326384 3300005459 Bacteria 1273
44 Ga0070685_10478971 3300005466 Bacteria 877
45 Ga0070706_100558138 3300005467 Bacteria 1065
46 Ga0070707_100129316 3300005468 Bacteria 2455
47 Ga0070707_100734055 3300005468 Bacteria 951
48 Ga0070707_100756907 3300005468 Unclassified 935
49 Ga0070698_100146464 3300005471 Bacteria 2311
50 Ga0070698_100337241 3300005471 Bacteria 1439
51 Ga0070698_100434538 3300005471 Bacteria 1248
52 Ga0070698_100458225 3300005471 Bacteria 1211
53 Ga0070699_100006468 3300005518 Bacteria 10207
54 Ga0070699_100354578 3300005518 Bacteria 1322
55 Ga0070699_100556163 3300005518 Bacteria 1045
56 Ga0070699_101062461 3300005518 Bacteria 743
57 Ga0070699_101064706 3300005518 Bacteria 742
58 Ga0070697_100116460 3300005536 Bacteria 2232
59 Ga0070697_100126146 3300005536 Bacteria 2144
60 Ga0070697_100133844 3300005536 Bacteria 2081
61 Ga0070697_100140910 3300005536 Bacteria 2028
62 Ga0070697_100276082 3300005536 Bacteria 1441
63 Ga0070697_100307050 3300005536 Bacteria 1364
64 Ga0070697_100526781 3300005536 Bacteria 1035
65 Ga0070697_101009401 3300005536 Bacteria 740
66 Ga0068853_101265412 3300005539 Bacteria 713
67 Ga0070672_100172718 3300005543 Bacteria 1798
68 Ga0070672_100332461 3300005543 Bacteria 1293
69 Ga0070686_100009697 3300005544 Bacteria 5413
70 Ga0070696_100413488 3300005546 Bacteria 1058
71 Ga0070665_100255552 3300005548 Bacteria 1753
72 Ga0070665_100566075 3300005548 Bacteria 1149
73 Ga0070704_100177556 3300005549 Bacteria 1700
74 Ga0070704_100326048 3300005549 Bacteria 1288
75 Ga0068857_100652759 3300005577 Bacteria 997
76 Ga0068857_100762823 3300005577 Bacteria 922
77 Ga0070702_100079554 3300005615 Bacteria 1959
78 Ga0068859_100203262 3300005617 Bacteria 2066
79 Ga0068859_100774660 3300005617 Bacteria 1048
80 Ga0068864_100679226 3300005618 Bacteria 1005
81 Ga0068864_101015408 3300005618 Bacteria 823
82 Ga0068866_10573084 3300005718 Bacteria 758
83 Ga0068866_10646771 3300005718 Bacteria 719
84 Ga0068861_100130843 3300005719 Bacteria 2037
85 Ga0068861_100381073 3300005719 Bacteria 1246
86 Ga0068863_100039212 3300005841 Bacteria 4508
87 Ga0068863_100166370 3300005841 Bacteria 2114
88 Ga0068863_100611655 3300005841 Bacteria 1079
89 Ga0068863_101888493 3300005841 Bacteria 607
90 Ga0068858_100155406 3300005842 Bacteria 2152
91 Ga0068858_100337392 3300005842 Bacteria 1442
92 Ga0068858_100395021 3300005842 Bacteria 1328
93 Ga0068858_100818018 3300005842 Bacteria 909
94 Ga0068858_101411308 3300005842 Bacteria 686
95 Ga0068860_100071381 3300005843 Bacteria 3300
96 Ga0068860_100114973 3300005843 Bacteria 2573
97 Ga0068860_101424895 3300005843 Bacteria 714
98 Ga0068862_100023110 3300005844 Bacteria 5206
99 Ga0068862_101047035 3300005844 Bacteria 809
100 Ga0081539_10001836 3300005985 Bacteria 33487
101 Ga0070715_10055353 3300006163 Bacteria 1722
102 Ga0075428_100090727 3300006844 Bacteria 3333
103 Ga0075428_100709375 3300006844 Bacteria 1071
104 Ga0075428_100991848 3300006844 Bacteria 889
105 Ga0075430_100948023 3300006846 Bacteria 709
106 Ga0075431_100088130 3300006847 Bacteria 3203
107 Ga0075433_11074595 3300006852 Bacteria 700
108 Ga0075434_100063329 3300006871 Bacteria 3681
109 Ga0075434_100335540 3300006871 Bacteria 1532
110 Ga0075429_100363926 3300006880 Bacteria 1266
111 Ga0075429_100572059 3300006880 Bacteria 990
112 Ga0068865_100254272 3300006881 Bacteria 1388
113 Ga0068865_100484246 3300006881 Bacteria 1029
114 Ga0075436_100031784 3300006914 Bacteria 3637
115 Ga0097620_100203256 3300006931 Bacteria 2066
116 Ga0097620_100774671 3300006931 Bacteria 1048
117 Ga0075435_100209652 3300007076 Bacteria 1653
118 Ga0099794_10183657 3300007265 Bacteria 1068
119 Ga0111539_10012989 3300009094 Bacteria 10420
120 Ga0111539_10034116 3300009094 Bacteria 6174
121 Ga0111539_10492467 3300009094 Bacteria 1428
122 Ga0111539_11549288 3300009094 Bacteria 769
123 Ga0114129_10401859 3300009147 Bacteria 1805
124 Ga0114129_10492248 3300009147 Bacteria 1603
125 Ga0114129_10931957 3300009147 Bacteria 1098
126 Ga0114129_11071308 3300009147 Bacteria 1011
127 Ga0105242_10698257 3300009176 Bacteria 992
128 Ga0105248_10598900 3300009177 Bacteria 1244
129 Ga0105249_10146197 3300009553 Bacteria 2272
130 Ga0099796_10117358 3300010159 Bacteria 1019
131 Ga0105246_10038726 3300011119 Bacteria 3208
132 Ga0157378_10313189 3300013297 Bacteria 1523
133 Ga0157378_10849792 3300013297 Bacteria 941
134 Ga0163162_10199528 3300013306 Bacteria 2129
135 Ga0157375_10097756 3300013308 Bacteria 3011
136 Ga0157375_11946004 3300013308 Bacteria 698
137 Ga0163163_10024701 3300014325 Bacteria 5722
138 Ga0157380_10029491 3300014326 Bacteria 4193
139 Ga0157380_10081002 3300014326 Bacteria 2654
140 Ga0157380_10165679 3300014326 Bacteria 1925
141 Ga0157380_11477426 3300014326 Bacteria 732
142 Ga0157377_10102892 3300014745 Bacteria 1705
143 Ga0157379_10000731 3300014968 Bacteria 26584
144 Ga0157379_10344325 3300014968 Bacteria 1364
145 Ga0157379_10388358 3300014968 Bacteria 1282
146 Ga0163161_10053771 3300017792 Bacteria 2921
147 Ga0207680_10472621 3300025903 Bacteria 891
148 Ga0207685_10041049 3300025905 Bacteria 1729
149 Ga0207685_10092198 3300025905 Bacteria 1278
150 Ga0207684_10112621 3300025910 Bacteria 2329
151 Ga0207684_10379268 3300025910 Bacteria 1216
152 Ga0207684_10425192 3300025910 Bacteria 1141
153 Ga0207663_10373359 3300025916 Bacteria 1085
154 Ga0207662_10124738 3300025918 Bacteria 1618
155 Ga0207662_10339717 3300025918 Bacteria 1006
156 Ga0207646_10061461 3300025922 Bacteria 3353
157 Ga0207646_10164647 3300025922 Bacteria 2002
158 Ga0207646_10465024 3300025922 Bacteria 1141
159 Ga0207681_10017481 3300025923 Bacteria 4504
160 Ga0207681_10034809 3300025923 Bacteria 3314
161 Ga0207681_10628279 3300025923 Bacteria 889
162 Ga0207650_10168586 3300025925 Bacteria 1739
163 Ga0207644_10165633 3300025931 Bacteria 1722
164 Ga0207644_10390800 3300025931 Bacteria 1136
165 Ga0207690_10275390 3300025932 Bacteria 1309
166 Ga0207669_10647120 3300025937 Bacteria 864
167 Ga0207665_10034632 3300025939 Bacteria 3350
168 Ga0207665_10236436 3300025939 Bacteria 1345
169 Ga0207691_10178304 3300025940 Bacteria 1857
170 Ga0207691_10215804 3300025940 Bacteria 1665
171 Ga0207691_10472027 3300025940 Bacteria 1067
172 Ga0207651_10188997 3300025960 Bacteria 1641
173 Ga0207712_10074992 3300025961 Bacteria 2444
174 Ga0207712_10369610 3300025961 Bacteria 1197
175 Ga0207668_10040540 3300025972 Bacteria 3143
176 Ga0207668_10383822 3300025972 Bacteria 1183
177 Ga0207640_10147768 3300025981 Bacteria 1722
178 Ga0207658_10670316 3300025986 Bacteria 936
179 Ga0207677_10953003 3300026023 Bacteria 776
180 Ga0207703_10049202 3300026035 Bacteria 3407
181 Ga0207703_10418508 3300026035 Bacteria 1246
182 Ga0207639_10958430 3300026041 Bacteria 801
183 Ga0207708_10039591 3300026075 Bacteria 3592
184 Ga0207641_10080326 3300026088 Bacteria 2829
185 Ga0207641_10140477 3300026088 Bacteria 2179
186 Ga0207641_10283291 3300026088 Bacteria 1560
187 Ga0207641_11495822 3300026088 Bacteria 677
188 Ga0207676_10512944 3300026095 Bacteria 1140
189 Ga0207676_10792920 3300026095 Bacteria 924
190 Ga0207676_11003078 3300026095 Bacteria 823
191 Ga0207674_10741964 3300026116 Bacteria 948
192 Ga0207675_100279150 3300026118 Bacteria 1623
193 Ga0207675_100351835 3300026118 Bacteria 1444
194 Ga0207675_100406978 3300026118 Bacteria 1342
195 Ga0207675_100994951 3300026118 Bacteria 857
196 Ga0207428_10012921 3300027907 Bacteria 7321
197 Ga0207428_10240404 3300027907 Bacteria 1353
198 Ga0207428_10384562 3300027907 Bacteria 1029
199 Ga0268265_10036821 3300028380 Bacteria 3587
200 Ga0268265_10323731 3300028380 Bacteria 1397
201 Ga0268265_11627702 3300028380 Bacteria 651
202 Ga0268265_11669061 3300028380 Bacteria 643
203 Ga0268264_10194037 3300028381 Bacteria 1853
204 Ga0268264_10711394 3300028381 Bacteria 998
205 Ga0265322_10002498 3300028654 Bacteria 5666
206 Ga0265330_10037476 3300031235 Bacteria 2158
207 Ga0265330_10041153 3300031235 Bacteria 2050
208 Ga0265330_10042311 3300031235 Bacteria 2019
209 Ga0265330_10134275 3300031235 Bacteria 1053
210 Ga0265332_10005127 3300031238 Bacteria 6072
211 Ga0265332_10008555 3300031238 Bacteria 4599
212 Ga0265332_10067769 3300031238 Bacteria 1522
213 Ga0265332_10305933 3300031238 Bacteria 656
214 Ga0265328_10043947 3300031239 Bacteria 1643
215 Ga0265320_10007231 3300031240 Bacteria 6914
216 Ga0265329_10001809 3300031242 Bacteria 10164
217 Ga0265329_10018763 3300031242 Bacteria 2359
218 Ga0265339_10002578 3300031249 Bacteria 12916
219 Ga0265339_10011962 3300031249 Bacteria 5317
220 Ga0265339_10137733 3300031249 Bacteria 1244
221 Ga0265331_10000209 3300031250 Bacteria 71099
222 Ga0265331_10009320 3300031250 Bacteria 5519
223 Ga0265316_10000155 3300031344 Bacteria 76004
224 Ga0265316_10000278 3300031344 Bacteria 57605
225 Ga0307509_10238476 3300031507 Bacteria 1614
226 Ga0307408_100303228 3300031548 Bacteria 1339
227 Ga0316575_10079053 3300031665 Bacteria 1325
228 Ga0316579_10010222 3300031691 Bacteria 3962
229 Ga0265314_10000387 3300031711 Bacteria 59711
230 Ga0265314_10002172 3300031711 Bacteria 20531
231 Ga0265314_10154121 3300031711 Bacteria 1405
232 Ga0265342_10000134 3300031712 Bacteria 82702
233 Ga0265342_10007954 3300031712 Bacteria 7682
234 Ga0307410_10496377 3300031852 Bacteria 1004
235 Ga0316583_10008268 3300032133 Bacteria 3751
236 Ga0373926_0008528 3300035083 Bacteria 3413
237 Ga0373934_0014410 3300035086 Bacteria 2996
238 Ga0373934_0029963 3300035086 Bacteria 2127
239 Ga0373944_0107269 3300035089 Bacteria 950
240 Ga0373923_0102445 3300035111 Bacteria 1264
241 Ga0373945_0108220 3300035116 Unclassified 1094
242 Ga0373954_0014083 3300035118 Bacteria 3565
243 Ga0373943_0049724 3300035170 Bacteria 2058
244 Ga0373924_0134223 3300035410 Bacteria 1078
245 Ga0373931_0131513 3300035691 Unclassified 1441
246 Ga0373935_0010859 3300035692 Bacteria 5470
247 Ga0373935_0036765 3300035692 Bacteria 3063
248 Ga0373927_0011374 3300035695 Bacteria 5925
249 Ga0373927_0404156 3300035695 Bacteria 901
250 Ga0373933_0171569 3300035724 Bacteria 1380
251 Ga0373933_0230526 3300035724 Bacteria 1189
252 Ga0373947_0004841 3300035725 Bacteria 7866
253 Ga0373947_0108752 3300035725 Bacteria 1749
254 Ga0373937_0001212 3300036401 Bacteria 21715
255 Ga0373937_0015086 3300036401 Bacteria 6826
256 Ga0316582_0038562 3300036647 Bacteria 2970
257 Ga0316582_0601851 3300036647 Bacteria 757
258 Ga0373925_0007012 3300037068 Bacteria 8229
259 Ga0373925_0065010 3300037068 Bacteria 2747
260 Ga0400489_51405 3300039093 Bacteria 4961
261 Ga0453683_0000014 3300044673 Bacteria 364381
262 Ga0453683_0167178 3300044673 Bacteria 1393
263 Ga0453684_0001583 3300044712 Bacteria 62833
264 Ga0451576_0680796 3300045051 Bacteria 1081
265 Ga0451576_0811666 3300045051 Bacteria 982
266 Ga0495603_0426085 3300046455 Bacteria 760
267 Ga0495580_0064131 3300046472 Bacteria 2576
268 Ga0495580_0134061 3300046472 Bacteria 1717
269 Ga0495580_0641444 3300046472 Bacteria 699
270 Ga0495639_0191336 3300046475 Bacteria 999
271 Ga0495594_0225285 3300046499 Bacteria 1069
272 Ga0495668_0485268 3300046616 Bacteria 681
273 Ga0495635_0308365 3300046663 Bacteria 1061
274 Ga0495658_0576883 3300046683 Bacteria 720
275 Ga0496102_0643635 3300048905 Bacteria 983
276 Ga0496104_0793340 3300048907 Bacteria 853
277 Ga0496104_1064188 3300048907 Bacteria 713
278 Ga0501041_0564378 3300049577 Bacteria 726
279 Ga0501068_0873789 3300049584 Bacteria 591
280 Ga0501073_0412962 3300049589 Bacteria 933
281 nmdc:mga0qj67_958322_c1 3300050509 Bacteria 672
282 nmdc:mga06r32_525690_c1 3300050510 Bacteria 1158
283 nmdc:mga08y16_10545_c1 3300050511 Bacteria 9698
284 nmdc:mga08y16_23107_c1 3300050511 Bacteria 6565
285 nmdc:mga08y16_78441_c1 3300050511 Bacteria 3443
286 nmdc:mga0n895_130074_c1 3300050512 Bacteria 2542
287 nmdc:mga0n895_157087_c1 3300050512 Bacteria 2305
288 nmdc:mga0n895_1776396_c1 3300050512 Bacteria 578
289 nmdc:mga0n895_189346_c1 3300050512 Bacteria 2089
290 nmdc:mga0n895_318213_c1 3300050512 Bacteria 1577
291 nmdc:mga0rr50_996750_c1 3300050513 Bacteria 714
292 nmdc:mga08x19_134156_c1 3300050514 Bacteria 1668
293 nmdc:mga08x19_397418_c1 3300050514 Bacteria 966
294 nmdc:mga0a205_382902_c1 3300050515 Bacteria 1272
295 nmdc:mga0a205_873502_c1 3300050515 Bacteria 746
296 Ga0495619_0734140 3300053085 Bacteria 670
297 Ga0070668_100149258
298 Ga0058858_1404229
299 Ga0058859_10120825
300 Ga0058860_10232447
301 Ga0065704_10353750
302 Ga0065704_10571013
303 Ga0065715_10459592
304 Ga0065707_10410964
305 Ga0070676_10395524
306 Ga0070690_100446610
307 Ga0070690_100721240
308 Ga0070670_100292612
309 Ga0070670_100302909
310 Ga0070670_100386213
311 Ga0070670_100388481
312 Ga0068868_100447281
313 Ga0070687_100086175
314 Ga0070687_100685496
315 Ga0070668_100055802
316 Ga0070668_100219009
317 Ga0070668_101010978
318 Ga0070669_100000705
319 Ga0070669_100233855
320 Ga0070669_100639946
321 Ga0070675_100293437
322 Ga0070675_100408968
323 Ga0070671_101127707
324 Ga0070674_100443232
325 Ga0070688_100617727
326 Ga0070709_10375361
327 Ga0070701_10398629
328 Ga0070711_100077464
329 Ga0070705_100144020
330 Ga0070705_100365997
331 Ga0070700_100033544
332 Ga0070700_100421508
333 Ga0070694_100343892
334 Ga0070708_101002862
335 Ga0070663_100432717
336 Ga0070662_100290216
337 Ga0070662_100476858
338 Ga0068867_100233105
339 Ga0068867_100326384
340 Ga0070685_10478971
341 Ga0070706_100558138
342 Ga0070707_100129316
343 Ga0070707_100734055
344 Ga0070707_100756907
345 Ga0070698_100146464
346 Ga0070698_100337241
347 Ga0070698_100434538
348 Ga0070698_100458225
349 Ga0070699_100006468
350 Ga0070699_100354578
351 Ga0070699_100556163
352 Ga0070699_101062461
353 Ga0070699_101064706
354 Ga0070697_100116460
355 Ga0070697_100126146
356 Ga0070697_100133844
357 Ga0070697_100140910
358 Ga0070697_100276082
359 Ga0070697_100307050
360 Ga0070697_100526781
361 Ga0070697_101009401
362 Ga0068853_101265412
363 Ga0070672_100172718
364 Ga0070672_100332461
365 Ga0070686_100009697
366 Ga0070696_100413488
367 Ga0070665_100255552
368 Ga0070665_100566075
369 Ga0070704_100177556
370 Ga0070704_100326048
371 Ga0068857_100652759
372 Ga0068857_100762823
373 Ga0070702_100079554
374 Ga0068859_100203262
375 Ga0068859_100774660
376 Ga0068864_100679226
377 Ga0068864_101015408
378 Ga0068866_10573084
379 Ga0068866_10646771
380 Ga0068861_100130843
381 Ga0068861_100381073
382 Ga0068863_100039212
383 Ga0068863_100166370
384 Ga0068863_100611655
385 Ga0068863_101888493
386 Ga0068858_100155406
387 Ga0068858_100337392
388 Ga0068858_100395021
389 Ga0068858_100818018
390 Ga0068858_101411308
391 Ga0068860_100071381
392 Ga0068860_100114973
393 Ga0068860_101424895
394 Ga0068862_100023110
395 Ga0068862_101047035
396 Ga0081539_10001836
397 Ga0070715_10055353
398 Ga0075428_100090727
399 Ga0075428_100709375
400 Ga0075428_100991848
401 Ga0075430_100948023
402 Ga0075431_100088130
403 Ga0075433_11074595
404 Ga0075434_100063329
405 Ga0075434_100335540
406 Ga0075429_100363926
407 Ga0075429_100572059
408 Ga0068865_100254272
409 Ga0068865_100484246
410 Ga0075436_100031784
411 Ga0097620_100203256
412 Ga0097620_100774671
413 Ga0075435_100209652
414 Ga0099794_10183657
415 Ga0111539_10012989
416 Ga0111539_10034116
417 Ga0111539_10492467
418 Ga0111539_11549288
419 Ga0114129_10401859
420 Ga0114129_10492248
421 Ga0114129_10931957
422 Ga0114129_11071308
423 Ga0105242_10698257
424 Ga0105248_10598900
425 Ga0105249_10146197
426 Ga0099796_10117358
427 Ga0105246_10038726
428 Ga0157378_10313189
429 Ga0157378_10849792
430 Ga0163162_10199528
431 Ga0157375_10097756
432 Ga0157375_11946004
433 Ga0163163_10024701
434 Ga0157380_10029491
435 Ga0157380_10081002
436 Ga0157380_10165679
437 Ga0157380_11477426
438 Ga0157377_10102892
439 Ga0157379_10000731
440 Ga0157379_10344325
441 Ga0157379_10388358
442 Ga0163161_10053771
443 Ga0207680_10472621
444 Ga0207685_10041049
445 Ga0207685_10092198
446 Ga0207684_10112621
447 Ga0207684_10379268
448 Ga0207684_10425192
449 Ga0207663_10373359
450 Ga0207662_10124738
451 Ga0207662_10339717
452 Ga0207646_10061461
453 Ga0207646_10164647
454 Ga0207646_10465024
455 Ga0207681_10017481
456 Ga0207681_10034809
457 Ga0207681_10628279
458 Ga0207650_10168586
459 Ga0207644_10165633
460 Ga0207644_10390800
461 Ga0207690_10275390
462 Ga0207669_10647120
463 Ga0207665_10034632
464 Ga0207665_10236436
465 Ga0207691_10178304
466 Ga0207691_10215804
467 Ga0207691_10472027
468 Ga0207651_10188997
469 Ga0207712_10074992
470 Ga0207712_10369610
471 Ga0207668_10040540
472 Ga0207668_10383822
473 Ga0207640_10147768
474 Ga0207658_10670316
475 Ga0207677_10953003
476 Ga0207703_10049202
477 Ga0207703_10418508
478 Ga0207639_10958430
479 Ga0207708_10039591
480 Ga0207641_10080326
481 Ga0207641_10140477
482 Ga0207641_10283291
483 Ga0207641_11495822
484 Ga0207676_10512944
485 Ga0207676_10792920
486 Ga0207676_11003078
487 Ga0207674_10741964
488 Ga0207675_100279150
489 Ga0207675_100351835
490 Ga0207675_100406978
491 Ga0207675_100994951
492 Ga0207428_10012921
493 Ga0207428_10240404
494 Ga0207428_10384562
495 Ga0268265_10036821
496 Ga0268265_10323731
497 Ga0268265_11627702
498 Ga0268265_11669061
499 Ga0268264_10194037
500 Ga0268264_10711394
501 Ga0265322_10002498
502 Ga0265330_10037476
503 Ga0265330_10041153
504 Ga0265330_10042311
505 Ga0265330_10134275
506 Ga0265332_10005127
507 Ga0265332_10008555
508 Ga0265332_10067769
509 Ga0265332_10305933
510 Ga0265328_10043947
511 Ga0265320_10007231
512 Ga0265329_10001809
513 Ga0265329_10018763
514 Ga0265339_10002578
515 Ga0265339_10011962
516 Ga0265339_10137733
517 Ga0265331_10000209
518 Ga0265331_10009320
519 Ga0265316_10000155
520 Ga0265316_10000278
521 Ga0307509_10238476
522 Ga0307408_100303228
523 Ga0316575_10079053
524 Ga0316579_10010222
525 Ga0265314_10000387
526 Ga0265314_10002172
527 Ga0265314_10154121
528 Ga0265342_10000134
529 Ga0265342_10007954
530 Ga0307410_10496377
531 Ga0316583_10008268
532 Ga0373926_0008528
533 Ga0373934_0014410
534 Ga0373934_0029963
535 Ga0373944_0107269
536 Ga0373923_0102445
537 Ga0373945_0108220
538 Ga0373954_0014083
539 Ga0373943_0049724
540 Ga0373924_0134223
541 Ga0373931_0131513
542 Ga0373935_0010859
543 Ga0373935_0036765
544 Ga0373927_0011374
545 Ga0373927_0404156
546 Ga0373933_0171569
547 Ga0373933_0230526
548 Ga0373947_0004841
549 Ga0373947_0108752
550 Ga0373937_0001212
551 Ga0373937_0015086
552 Ga0316582_0038562
553 Ga0316582_0601851
554 Ga0373925_0007012
555 Ga0373925_0065010
556 Ga0400489_51405
557 Ga0453683_0000014
558 Ga0453683_0167178
559 Ga0453684_0001583
560 Ga0451576_0680796
561 Ga0451576_0811666
562 Ga0495603_0426085
563 Ga0495580_0064131
564 Ga0495580_0134061
565 Ga0495580_0641444
566 Ga0495639_0191336
567 Ga0495594_0225285
568 Ga0495668_0485268
569 Ga0495635_0308365
570 Ga0495658_0576883
571 Ga0496102_0643635
572 Ga0496104_0793340
573 Ga0496104_1064188
574 Ga0501041_0564378
575 Ga0501068_0873789
576 Ga0501073_0412962
577 nmdc:mga0qj67_958322_c1
578 nmdc:mga06r32_525690_c1
579 nmdc:mga08y16_10545_c1
580 nmdc:mga08y16_23107_c1
581 nmdc:mga08y16_78441_c1
582 nmdc:mga0n895_130074_c1
583 nmdc:mga0n895_157087_c1
584 nmdc:mga0n895_1776396_c1
585 nmdc:mga0n895_189346_c1
586 nmdc:mga0n895_318213_c1
587 nmdc:mga0rr50_996750_c1
588 nmdc:mga08x19_134156_c1
589 nmdc:mga08x19_397418_c1
590 nmdc:mga0a205_382902_c1
591 nmdc:mga0a205_873502_c1
592 Ga0495619_0734140

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10369

ALS_ss_C

Small subunit of acetolactate synthase

88

161

0.99

PF01842

ACT

ACT domain

6

73

0.97

PF13710

ACT_5

ACT domain

14

77

0.95

PF22629

AHAS-like_ACT

AHAS-like ACT domain

8

76

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6u9h-assembly1.cif.gz_G arabidopsis thaliana acetohydroxyacid synthase complex 0.9152 2 158
2f1f-assembly1.cif.gz_A crystal structure of the regulatory subunit of acetohydroxyacid synthase isozyme iii from e. coli 0.9131 1 162
2pc6-assembly1.cif.gz_A crystal structure of putative acetolactate synthase- small subunit from nitrosomonas europaea 0.9047 1 160
2f1f-assembly1.cif.gz_A crystal structure of the regulatory subunit of acetohydroxyacid synthase isozyme iii from e. coli 0.9028 1 162
6u9d-assembly2.cif.gz_X-2 saccharomyces cerevisiae acetohydroxyacid synthase 0.9005 2 160
ID Description Score Start End Superfamily
af_Q93YZ7_400_477_3.30.70.1150 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 0.9771 84 156 3.30.70.1150
af_P9WKJ3_86_164_3.30.70.1150 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 0.9604 84 161 3.30.70.1150
af_Q57625_89_166_3.30.70.1150 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 0.9583 84 159 3.30.70.1150
2fgdA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 0.9464 81 156 3.30.70.1150
af_P9WKJ3_86_164_3.30.70.1150 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 0.9372 84 161 3.30.70.1150
ID Description Score Start End GO Terms
AF-A0A8A5Z5S2-F1-model_v4 deleted 0.9841 81 157
AF-A0A2H0M709-F1-model_v4 Acetolactate synthase small subunit C-terminal domain-containing protein 0.9525 82 156 GO:0003984
GO:0005829
GO:0009097
GO:0009099
GO:1990610
AF-A0A287SCJ2-F1-model_v4 deleted 0.9497 74 157
AF-A0A661DVT3-F1-model_v4 Acetolactate synthase small subunit (AHAS) (ALS) (EC 2.2.1.6) (Acetohydroxy-acid synthase small subunit) 0.9468 78 162 GO:0003984
GO:0005829
GO:0009097
GO:0009099
GO:1990610
AF-A0A1F1URG7-F1-model_v4 Acetolactate synthase small subunit (AHAS) (ALS) (EC 2.2.1.6) (Acetohydroxy-acid synthase small subunit) 0.9457 1 161 GO:0003984
GO:0005829
GO:0009097
GO:0009099
GO:1990610

Map