F393020

General Info

Members Datasets Scaffolds Average Seq Length
296 144 594 255

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100103419|Ga0068868_1001034193
Length 288
Sequence VSGSALAATSPINGVSINFRNSTDFGQKLRVLMRTSVYLLXXXXTAASELQAQENYEIQVYASPTVQKGSTMVELHSNYTFDGARTAENKVLPTNHVLHETIEITHGWTPWFETGFYFFNTIGNDHRTTYVGSHIRPRVMVPSSWKWPVGVSLSMEAGYQKREYSEDDWSLEIRPIVDKQWDKLYLSFNPTFDKSFHGINKDQGYVFSPNFKASYNVTKVVAGGFEYYGSLGPLNHFQPYQTQQEQLFAAVDLDWSPDWELNFGFGWGLTQSTDNAIFKLILGYRFHK

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
65 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
100 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
101 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
102 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
103 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
104 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
105 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
106 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
107 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
113 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
114 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
115 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
116 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
117 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
118 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
119 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
120 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
121 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
122 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
123 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
124 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
125 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
126 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
127 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
128 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
129 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
130 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
131 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
138 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
140 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
141 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
142 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
143 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
144 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.69
Nodule 0
Rhizoplane 1.01
Rhizosphere 90.88
Stem 0
Stem Tuber 0
Unclassified 14.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100103419 3300005338 Bacteria 2307
2 rootH1_10003646 3300003316 Bacteria 13039
3 rootH1_10003646 3300003323 Bacteria 25405
4 rootH1_10180215 3300003316 Bacteria 1933
5 rootH1_10180215 3300003323 Bacteria 4440
6 rootH2_10000256 3300003320 Bacteria 54479
7 rootH2_10004568 3300003320 Bacteria 60983
8 rootH2_10036284 3300003320 Bacteria 10222
9 rootH2_10158664 3300003320 Bacteria 3498
10 rootH1_10006920 3300003323 Bacteria 63684
11 rootH1_10047217 3300003323 Bacteria 7450
12 rootH1_10223862 3300003323 Bacteria 1383
13 Ga0070658_10096425 3300005327 Unclassified 2442
14 Ga0070658_10225359 3300005327 Unclassified 1586
15 Ga0070683_100002171 3300005329 Bacteria 15517
16 Ga0068869_100008234 3300005334 Bacteria 6711
17 Ga0070666_10000038 3300005335 Bacteria 115799
18 Ga0070680_100001354 3300005336 Bacteria 17734
19 Ga0070680_100356249 3300005336 Bacteria 1244
20 Ga0070682_100006055 3300005337 Bacteria 6771
21 Ga0068868_100002182 3300005338 Bacteria 13493
22 Ga0068868_100052913 3300005338 Bacteria 3197
23 Ga0070660_100145281 3300005339 Bacteria 1905
24 Ga0070660_100166950 3300005339 Unclassified 1776
25 Ga0070691_10004273 3300005341 Bacteria 6485
26 Ga0070691_10122089 3300005341 Unclassified 1313
27 Ga0070673_100140112 3300005364 Bacteria 2039
28 Ga0070659_100032312 3300005366 Bacteria 4058
29 Ga0070659_100124420 3300005366 Bacteria 2091
30 Ga0070667_100002582 3300005367 Bacteria 15730
31 Ga0070667_100020872 3300005367 Bacteria 5440
32 Ga0070667_100028396 3300005367 Bacteria 4657
33 Ga0070667_100150916 3300005367 Bacteria 2041
34 Ga0070713_100485821 3300005436 Unclassified 1164
35 Ga0070681_10029472 3300005458 Bacteria 5512
36 Ga0070681_10465644 3300005458 Bacteria 1176
37 Ga0068867_100208275 3300005459 Bacteria 1569
38 Ga0068867_100253989 3300005459 Unclassified 1430
39 Ga0070679_100011682 3300005530 Bacteria 8373
40 Ga0068853_100007496 3300005539 Bacteria 8734
41 Ga0068853_100073091 3300005539 Unclassified 2989
42 Ga0068853_100553019 3300005539 Unclassified 1090
43 Ga0070672_100053237 3300005543 Bacteria 3164
44 Ga0070665_100000008 3300005548 Bacteria 606341
45 Ga0068855_100000463 3300005563 Bacteria 50000
46 Ga0068855_100006097 3300005563 Bacteria 14699
47 Ga0068855_100053955 3300005563 Bacteria 4728
48 Ga0068855_100139197 3300005563 Bacteria 2768
49 Ga0068855_100516117 3300005563 Unclassified 1297
50 Ga0068857_100000317 3300005577 Bacteria 33272
51 Ga0068857_100085992 3300005577 Bacteria 2811
52 Ga0068854_100280198 3300005578 Bacteria 1342
53 Ga0068856_100000031 3300005614 Bacteria 126668
54 Ga0068856_100018615 3300005614 Bacteria 6731
55 Ga0068856_100147554 3300005614 Unclassified 2360
56 Ga0068852_100003732 3300005616 Bacteria 10682
57 Ga0068852_100215877 3300005616 Bacteria 1822
58 Ga0068852_101055990 3300005616 Bacteria 832
59 Ga0068859_100000007 3300005617 Bacteria 390070
60 Ga0068859_100024676 3300005617 Bacteria 6034
61 Ga0068859_100591520 3300005617 Bacteria 1203
62 Ga0068864_100016460 3300005618 Bacteria 6154
63 Ga0068864_100675495 3300005618 Bacteria 1007
64 Ga0068851_10020122 3300005834 Bacteria 3227
65 Ga0068863_100012764 3300005841 Bacteria 8102
66 Ga0068863_100016779 3300005841 Bacteria 7026
67 Ga0068863_100557442 3300005841 Bacteria 1132
68 Ga0068858_100002116 3300005842 Bacteria 20141
69 Ga0068858_100574111 3300005842 Bacteria 1093
70 Ga0068860_100000039 3300005843 Bacteria 232543
71 Ga0068860_100001528 3300005843 Bacteria 24938
72 Ga0068860_100002660 3300005843 Bacteria 18599
73 Ga0068860_100144257 3300005843 Bacteria 2290
74 Ga0070717_10164511 3300006028 Unclassified 1926
75 Ga0097621_100003068 3300006237 Bacteria 11452
76 Ga0097621_100014656 3300006237 Bacteria 5874
77 Ga0097621_100133632 3300006237 Bacteria 2114
78 Ga0097621_100240825 3300006237 Bacteria 1581
79 Ga0068871_100002512 3300006358 Bacteria 12517
80 Ga0068871_100215147 3300006358 Bacteria 1663
81 Ga0068871_100257561 3300006358 Bacteria 1521
82 Ga0075433_10276781 3300006852 Bacteria 1487
83 Ga0075434_100021479 3300006871 Bacteria 6274
84 Ga0068865_100040675 3300006881 Bacteria 3161
85 Ga0097620_100000007 3300006931 Bacteria 390070
86 Ga0097620_100024676 3300006931 Bacteria 6034
87 Ga0097620_100591515 3300006931 Bacteria 1203
88 Ga0075435_100102472 3300007076 Bacteria 2372
89 Ga0105240_10001804 3300009093 Bacteria 36022
90 Ga0105240_10006266 3300009093 Bacteria 17502
91 Ga0105240_10008213 3300009093 Bacteria 14962
92 Ga0105240_10009924 3300009093 Bacteria 13426
93 Ga0105240_10011891 3300009093 Bacteria 12076
94 Ga0105240_10017609 3300009093 Bacteria 9625
95 Ga0105240_10039725 3300009093 Bacteria 6023
96 Ga0105240_10064502 3300009093 Unclassified 4551
97 Ga0105240_10369353 3300009093 Bacteria 1623
98 Ga0105240_10547579 3300009093 Bacteria 1281
99 Ga0105245_10197596 3300009098 Bacteria 1930
100 Ga0105247_10000702 3300009101 Bacteria 26164
101 Ga0105241_10003466 3300009174 Bacteria 11739
102 Ga0105241_10031946 3300009174 Bacteria 3943
103 Ga0105241_10122988 3300009174 Bacteria 2092
104 Ga0105241_10152475 3300009174 Bacteria 1892
105 Ga0105241_10287882 3300009174 Archaea 1405
106 Ga0105242_10207617 3300009176 Bacteria 1743
107 Ga0105237_10000277 3300009545 Bacteria 71828
108 Ga0105237_10002807 3300009545 Bacteria 21154
109 Ga0105237_10063982 3300009545 Unclassified 3675
110 Ga0105237_10065448 3300009545 Unclassified 3631
111 Ga0105237_10465030 3300009545 Bacteria 1271
112 Ga0105238_10001245 3300009551 Bacteria 25664
113 Ga0105238_10001751 3300009551 Bacteria 21779
114 Ga0105238_10071471 3300009551 Unclassified 3467
115 Ga0105238_10201318 3300009551 Unclassified 1967
116 Ga0105249_10002271 3300009553 Bacteria 16675
117 Ga0105239_10000433 3300010375 Bacteria 61072
118 Ga0105239_10000721 3300010375 Bacteria 46920
119 Ga0105239_10000915 3300010375 Bacteria 41833
120 Ga0105239_10048241 3300010375 Bacteria 4670
121 Ga0105239_10090705 3300010375 Unclassified 3372
122 Ga0105239_10130965 3300010375 Unclassified 2790
123 Ga0105239_10168038 3300010375 Bacteria 2453
124 Ga0105239_10202066 3300010375 Bacteria 2226
125 Ga0105239_10426832 3300010375 Unclassified 1502
126 Ga0157373_10131915 3300013100 Bacteria 1757
127 Ga0157371_10003120 3300013102 Bacteria 15321
128 Ga0157371_10026026 3300013102 Bacteria 4257
129 Ga0157371_10038289 3300013102 Bacteria 3431
130 Ga0157371_10209815 3300013102 Bacteria 1397
131 Ga0157370_10001960 3300013104 Bacteria 25352
132 Ga0157370_10002241 3300013104 Bacteria 23522
133 Ga0157370_10005273 3300013104 Bacteria 14521
134 Ga0157370_10285436 3300013104 Bacteria 1525
135 Ga0157370_10429886 3300013104 Bacteria 1214
136 Ga0157369_10043111 3300013105 Bacteria 4919
137 Ga0157369_10096168 3300013105 Bacteria 3160
138 Ga0157369_10145398 3300013105 Bacteria 2507
139 Ga0157369_10196366 3300013105 Bacteria 2119
140 Ga0157374_10000003 3300013296 Bacteria 854471
141 Ga0157374_10019904 3300013296 Bacteria 5948
142 Ga0157378_10002723 3300013297 Bacteria 15736
143 Ga0157378_10113769 3300013297 Bacteria 2485
144 Ga0157378_10135878 3300013297 Bacteria 2280
145 Ga0157378_10586953 3300013297 Bacteria 1124
146 Ga0163162_10002141 3300013306 Bacteria 18527
147 Ga0163162_10003482 3300013306 Bacteria 15044
148 Ga0163162_10248144 3300013306 Bacteria 1912
149 Ga0163162_10308159 3300013306 Bacteria 1716
150 Ga0157372_10002190 3300013307 Bacteria 21255
151 Ga0157372_10014072 3300013307 Bacteria 8545
152 Ga0157372_10022801 3300013307 Bacteria 6778
153 Ga0157372_10197859 3300013307 Bacteria 2328
154 Ga0157372_10198066 3300013307 Bacteria 2326
155 Ga0157372_10677874 3300013307 Bacteria 1200
156 Ga0157372_10704936 3300013307 Bacteria 1174
157 Ga0157375_10048669 3300013308 Unclassified 4148
158 Ga0157375_10617621 3300013308 Bacteria 1242
159 Ga0157375_11182168 3300013308 Bacteria 897
160 Ga0163163_10122150 3300014325 Bacteria 2639
161 Ga0163163_10123773 3300014325 Bacteria 2622
162 Ga0157379_10011358 3300014968 Bacteria 7767
163 Ga0157379_10359100 3300014968 Bacteria 1335
164 Ga0157376_10003578 3300014969 Bacteria 10716
165 Ga0157376_10005084 3300014969 Bacteria 9173
166 Ga0157376_10087404 3300014969 Unclassified 2690
167 Ga0157376_10804372 3300014969 Bacteria 953
168 Ga0163161_10027812 3300017792 Unclassified 4012
169 Ga0209233_1001432 3300025261 Bacteria 9412
170 Ga0209233_1018138 3300025261 Unclassified 1902
171 Ga0207656_10020507 3300025321 Bacteria 2628
172 Ga0207710_10003290 3300025900 Bacteria 7223
173 Ga0207680_10000015 3300025903 Bacteria 138253
174 Ga0207647_10000043 3300025904 Bacteria 91109
175 Ga0207647_10039094 3300025904 Unclassified 2996
176 Ga0207647_10167131 3300025904 Bacteria 1282
177 Ga0207705_10000045 3300025909 Bacteria 180625
178 Ga0207654_10001652 3300025911 Bacteria 11658
179 Ga0207654_10002571 3300025911 Bacteria 9211
180 Ga0207654_10015213 3300025911 Bacteria 3988
181 Ga0207707_10000823 3300025912 Bacteria 30438
182 Ga0207707_10606871 3300025912 Bacteria 926
183 Ga0207695_10000071 3300025913 Bacteria 315568
184 Ga0207695_10000447 3300025913 Bacteria 90113
185 Ga0207695_10001174 3300025913 Bacteria 45172
186 Ga0207695_10003194 3300025913 Bacteria 23345
187 Ga0207695_10004949 3300025913 Bacteria 17943
188 Ga0207695_10006041 3300025913 Bacteria 15815
189 Ga0207695_10035695 3300025913 Bacteria 5386
190 Ga0207695_10037393 3300025913 Bacteria 5238
191 Ga0207695_10262679 3300025913 Bacteria 1624
192 Ga0207695_10308802 3300025913 Bacteria 1472
193 Ga0207671_10000872 3300025914 Bacteria 38195
194 Ga0207671_10002899 3300025914 Bacteria 17715
195 Ga0207671_10004719 3300025914 Bacteria 12877
196 Ga0207671_10014213 3300025914 Bacteria 6301
197 Ga0207671_10105932 3300025914 Unclassified 2134
198 Ga0207671_10171975 3300025914 Bacteria 1683
199 Ga0207660_10118435 3300025917 Bacteria 2003
200 Ga0207657_10053880 3300025919 Bacteria 3482
201 Ga0207652_10016218 3300025921 Bacteria 6077
202 Ga0207652_10480363 3300025921 Bacteria 1119
203 Ga0207694_10373121 3300025924 Bacteria 1183
204 Ga0207694_10423698 3300025924 Unclassified 1109
205 Ga0207700_10044004 3300025928 Bacteria 3284
206 Ga0207644_10043363 3300025931 Unclassified 3192
207 Ga0207686_10226446 3300025934 Unclassified 1353
208 Ga0207709_10321625 3300025935 Bacteria 1158
209 Ga0207691_10409148 3300025940 Bacteria 1157
210 Ga0207689_10005587 3300025942 Bacteria 11206
211 Ga0207661_10075409 3300025944 Bacteria 2767
212 Ga0207667_10000046 3300025949 Bacteria 245420
213 Ga0207667_10000209 3300025949 Bacteria 83277
214 Ga0207667_10001285 3300025949 Bacteria 31480
215 Ga0207667_10019081 3300025949 Bacteria 7666
216 Ga0207667_10049901 3300025949 Bacteria 4417
217 Ga0207667_10453777 3300025949 Bacteria 1302
218 Ga0207668_10365566 3300025972 Bacteria 1210
219 Ga0207640_10034306 3300025981 Bacteria 3166
220 Ga0207640_10255002 3300025981 Bacteria 1364
221 Ga0207658_10002573 3300025986 Bacteria 13179
222 Ga0207658_10036853 3300025986 Unclassified 3509
223 Ga0207677_10048155 3300026023 Bacteria 2868
224 Ga0207677_10111217 3300026023 Bacteria 2040
225 Ga0207703_10022149 3300026035 Unclassified 4981
226 Ga0207639_10016190 3300026041 Bacteria 5269
227 Ga0207639_10403602 3300026041 Bacteria 1232
228 Ga0207702_10000071 3300026078 Bacteria 114394
229 Ga0207702_10022805 3300026078 Bacteria 5193
230 Ga0207702_10073072 3300026078 Unclassified 2956
231 Ga0207641_10000056 3300026088 Bacteria 170719
232 Ga0207641_10012677 3300026088 Bacteria 6912
233 Ga0207648_10145470 3300026089 Unclassified 2091
234 Ga0207648_10420563 3300026089 Bacteria 1213
235 Ga0207674_10001038 3300026116 Bacteria 36091
236 Ga0207674_10138378 3300026116 Unclassified 2395
237 Ga0207698_10013472 3300026142 Bacteria 5396
238 Ga0207698_10315898 3300026142 Bacteria 1461
239 Ga0268266_10000016 3300028379 Bacteria 629101
240 Ga0268264_10000080 3300028381 Bacteria 249126
241 Ga0268264_10001942 3300028381 Bacteria 18608
242 Ga0268264_10002034 3300028381 Bacteria 18102
243 Ga0268264_10004019 3300028381 Bacteria 12599
244 Ga0268264_10120015 3300028381 Bacteria 2316
245 Ga0307517_10183508 3300028786 Bacteria 1345
246 Ga0307517_10199630 3300028786 Unclassified 1253
247 Ga0307511_10000139 3300030521 Bacteria 67385
248 Ga0265327_10078293 3300031251 Bacteria 1638
249 Ga0265316_10002054 3300031344 Bacteria 21202
250 Ga0307509_10104788 3300031507 Unclassified 2852
251 Ga0307509_10247507 3300031507 Unclassified 1569
252 Ga0265314_10000348 3300031711 Bacteria 64175
253 Ga0307516_10003151 3300031730 Bacteria 21468
254 Ga0307516_10119521 3300031730 Bacteria 2428
255 Ga0307510_10013261 3300033180 Bacteria 9774
256 Ga0307510_10274468 3300033180 Bacteria 1160
257 Ga0373941_0009677 3300035115 Bacteria 2433
258 Ga0395899_0000001 3300037312 Bacteria 1750322
259 Ga0395900_0000048 3300037418 Bacteria 227760
260 Ga0395900_0038122 3300037418 Bacteria 4955
261 Ga0395905_0001316 3300037471 Bacteria 30508
262 Ga0395901_0004484 3300038443 Bacteria 14078
263 Ga0395901_0075895 3300038443 Bacteria 3507
264 Ga0436363_0559950 3300039450 Bacteria 1793
265 Ga0451577_0100215 3300042876 Unclassified 2587
266 Ga0466972_0001532 3300044658 Bacteria 11268
267 Ga0466961_0025131 3300044693 Bacteria 3833
268 Ga0466964_0031996 3300044706 Bacteria 2089
269 Ga0453684_0300560 3300044712 Bacteria 1824
270 Ga0466971_0019494 3300044719 Unclassified 3013
271 Ga0466959_0012605 3300045049 Bacteria 6114
272 Ga0495606_0066405 3300046507 Bacteria 2288
273 Ga0495606_0185060 3300046507 Bacteria 1198
274 Ga0495648_0019795 3300046524 Bacteria 4716
275 Ga0495609_0001929 3300046538 Bacteria 13185
276 Ga0495611_0000010 3300046648 Bacteria 156661
277 Ga0495625_0083341 3300046660 Bacteria 2223
278 Ga0495649_0137130 3300046694 Unclassified 1289
279 Ga0495687_000004 3300047443 Bacteria 779298
280 Ga0495686_0000016 3300047472 Bacteria 443701
281 Ga0496100_0333486 3300048903 Unclassified 1142
282 Ga0496104_0600198 3300048907 Bacteria 1011
283 Ga0496115_0310050 3300048918 Unclassified 1292
284 Ga0501031_0125219 3300049568 Unclassified 1679
285 Ga0501032_0023519 3300049569 Bacteria 4255
286 Ga0501034_0002422 3300049571 Bacteria 22576
287 Ga0501034_0235027 3300049571 Bacteria 1781
288 Ga0501036_0020716 3300049572 Bacteria 5524
289 Ga0501039_0108686 3300049575 Bacteria 2168
290 Ga0501043_0005610 3300049579 Bacteria 10104
291 Ga0501083_0226164 3300049744 Bacteria 1219
292 Ga0501035_0014169 3300049822 Bacteria 7356
293 Ga0501044_0178107 3300049823 Unclassified 2094
294 nmdc:mga0n895_304450_c1 3300050512 Bacteria 1616
295 Ga0500583_0000882 3300053092 Bacteria 8642
296 Ga0500622_0029540 3300053156 Bacteria 2883
297 Ga0500637_0075543 3300053178 Bacteria 1942
298 Ga0466962_0006673 3300061719 Bacteria 5537
299 Ga0068868_100103419
300 rootH1_10003646
301 rootH1_10180215
302 rootH2_10000256
303 rootH2_10004568
304 rootH2_10036284
305 rootH2_10158664
306 rootH1_10006920
307 rootH1_10047217
308 rootH1_10223862
309 Ga0070658_10096425
310 Ga0070658_10225359
311 Ga0070683_100002171
312 Ga0068869_100008234
313 Ga0070666_10000038
314 Ga0070680_100001354
315 Ga0070680_100356249
316 Ga0070682_100006055
317 Ga0068868_100002182
318 Ga0068868_100052913
319 Ga0070660_100145281
320 Ga0070660_100166950
321 Ga0070691_10004273
322 Ga0070691_10122089
323 Ga0070673_100140112
324 Ga0070659_100032312
325 Ga0070659_100124420
326 Ga0070667_100002582
327 Ga0070667_100020872
328 Ga0070667_100028396
329 Ga0070667_100150916
330 Ga0070713_100485821
331 Ga0070681_10029472
332 Ga0070681_10465644
333 Ga0068867_100208275
334 Ga0068867_100253989
335 Ga0070679_100011682
336 Ga0068853_100007496
337 Ga0068853_100073091
338 Ga0068853_100553019
339 Ga0070672_100053237
340 Ga0070665_100000008
341 Ga0068855_100000463
342 Ga0068855_100006097
343 Ga0068855_100053955
344 Ga0068855_100139197
345 Ga0068855_100516117
346 Ga0068857_100000317
347 Ga0068857_100085992
348 Ga0068854_100280198
349 Ga0068856_100000031
350 Ga0068856_100018615
351 Ga0068856_100147554
352 Ga0068852_100003732
353 Ga0068852_100215877
354 Ga0068852_101055990
355 Ga0068859_100000007
356 Ga0068859_100024676
357 Ga0068859_100591520
358 Ga0068864_100016460
359 Ga0068864_100675495
360 Ga0068851_10020122
361 Ga0068863_100012764
362 Ga0068863_100016779
363 Ga0068863_100557442
364 Ga0068858_100002116
365 Ga0068858_100574111
366 Ga0068860_100000039
367 Ga0068860_100001528
368 Ga0068860_100002660
369 Ga0068860_100144257
370 Ga0070717_10164511
371 Ga0097621_100003068
372 Ga0097621_100014656
373 Ga0097621_100133632
374 Ga0097621_100240825
375 Ga0068871_100002512
376 Ga0068871_100215147
377 Ga0068871_100257561
378 Ga0075433_10276781
379 Ga0075434_100021479
380 Ga0068865_100040675
381 Ga0097620_100000007
382 Ga0097620_100024676
383 Ga0097620_100591515
384 Ga0075435_100102472
385 Ga0105240_10001804
386 Ga0105240_10006266
387 Ga0105240_10008213
388 Ga0105240_10009924
389 Ga0105240_10011891
390 Ga0105240_10017609
391 Ga0105240_10039725
392 Ga0105240_10064502
393 Ga0105240_10369353
394 Ga0105240_10547579
395 Ga0105245_10197596
396 Ga0105247_10000702
397 Ga0105241_10003466
398 Ga0105241_10031946
399 Ga0105241_10122988
400 Ga0105241_10152475
401 Ga0105241_10287882
402 Ga0105242_10207617
403 Ga0105237_10000277
404 Ga0105237_10002807
405 Ga0105237_10063982
406 Ga0105237_10065448
407 Ga0105237_10465030
408 Ga0105238_10001245
409 Ga0105238_10001751
410 Ga0105238_10071471
411 Ga0105238_10201318
412 Ga0105249_10002271
413 Ga0105239_10000433
414 Ga0105239_10000721
415 Ga0105239_10000915
416 Ga0105239_10048241
417 Ga0105239_10090705
418 Ga0105239_10130965
419 Ga0105239_10168038
420 Ga0105239_10202066
421 Ga0105239_10426832
422 Ga0157373_10131915
423 Ga0157371_10003120
424 Ga0157371_10026026
425 Ga0157371_10038289
426 Ga0157371_10209815
427 Ga0157370_10001960
428 Ga0157370_10002241
429 Ga0157370_10005273
430 Ga0157370_10285436
431 Ga0157370_10429886
432 Ga0157369_10043111
433 Ga0157369_10096168
434 Ga0157369_10145398
435 Ga0157369_10196366
436 Ga0157374_10000003
437 Ga0157374_10019904
438 Ga0157378_10002723
439 Ga0157378_10113769
440 Ga0157378_10135878
441 Ga0157378_10586953
442 Ga0163162_10002141
443 Ga0163162_10003482
444 Ga0163162_10248144
445 Ga0163162_10308159
446 Ga0157372_10002190
447 Ga0157372_10014072
448 Ga0157372_10022801
449 Ga0157372_10197859
450 Ga0157372_10198066
451 Ga0157372_10677874
452 Ga0157372_10704936
453 Ga0157375_10048669
454 Ga0157375_10617621
455 Ga0157375_11182168
456 Ga0163163_10122150
457 Ga0163163_10123773
458 Ga0157379_10011358
459 Ga0157379_10359100
460 Ga0157376_10003578
461 Ga0157376_10005084
462 Ga0157376_10087404
463 Ga0157376_10804372
464 Ga0163161_10027812
465 Ga0209233_1001432
466 Ga0209233_1018138
467 Ga0207656_10020507
468 Ga0207710_10003290
469 Ga0207680_10000015
470 Ga0207647_10000043
471 Ga0207647_10039094
472 Ga0207647_10167131
473 Ga0207705_10000045
474 Ga0207654_10001652
475 Ga0207654_10002571
476 Ga0207654_10015213
477 Ga0207707_10000823
478 Ga0207707_10606871
479 Ga0207695_10000071
480 Ga0207695_10000447
481 Ga0207695_10001174
482 Ga0207695_10003194
483 Ga0207695_10004949
484 Ga0207695_10006041
485 Ga0207695_10035695
486 Ga0207695_10037393
487 Ga0207695_10262679
488 Ga0207695_10308802
489 Ga0207671_10000872
490 Ga0207671_10002899
491 Ga0207671_10004719
492 Ga0207671_10014213
493 Ga0207671_10105932
494 Ga0207671_10171975
495 Ga0207660_10118435
496 Ga0207657_10053880
497 Ga0207652_10016218
498 Ga0207652_10480363
499 Ga0207694_10373121
500 Ga0207694_10423698
501 Ga0207700_10044004
502 Ga0207644_10043363
503 Ga0207686_10226446
504 Ga0207709_10321625
505 Ga0207691_10409148
506 Ga0207689_10005587
507 Ga0207661_10075409
508 Ga0207667_10000046
509 Ga0207667_10000209
510 Ga0207667_10001285
511 Ga0207667_10019081
512 Ga0207667_10049901
513 Ga0207667_10453777
514 Ga0207668_10365566
515 Ga0207640_10034306
516 Ga0207640_10255002
517 Ga0207658_10002573
518 Ga0207658_10036853
519 Ga0207677_10048155
520 Ga0207677_10111217
521 Ga0207703_10022149
522 Ga0207639_10016190
523 Ga0207639_10403602
524 Ga0207702_10000071
525 Ga0207702_10022805
526 Ga0207702_10073072
527 Ga0207641_10000056
528 Ga0207641_10012677
529 Ga0207648_10145470
530 Ga0207648_10420563
531 Ga0207674_10001038
532 Ga0207674_10138378
533 Ga0207698_10013472
534 Ga0207698_10315898
535 Ga0268266_10000016
536 Ga0268264_10000080
537 Ga0268264_10001942
538 Ga0268264_10002034
539 Ga0268264_10004019
540 Ga0268264_10120015
541 Ga0307517_10183508
542 Ga0307517_10199630
543 Ga0307511_10000139
544 Ga0265327_10078293
545 Ga0265316_10002054
546 Ga0307509_10104788
547 Ga0307509_10247507
548 Ga0265314_10000348
549 Ga0307516_10003151
550 Ga0307516_10119521
551 Ga0307510_10013261
552 Ga0307510_10274468
553 Ga0373941_0009677
554 Ga0395899_0000001
555 Ga0395900_0000048
556 Ga0395900_0038122
557 Ga0395905_0001316
558 Ga0395901_0004484
559 Ga0395901_0075895
560 Ga0436363_0559950
561 Ga0451577_0100215
562 Ga0466972_0001532
563 Ga0466961_0025131
564 Ga0466964_0031996
565 Ga0453684_0300560
566 Ga0466971_0019494
567 Ga0466959_0012605
568 Ga0495606_0066405
569 Ga0495606_0185060
570 Ga0495648_0019795
571 Ga0495609_0001929
572 Ga0495611_0000010
573 Ga0495625_0083341
574 Ga0495649_0137130
575 Ga0495687_000004
576 Ga0495686_0000016
577 Ga0496100_0333486
578 Ga0496104_0600198
579 Ga0496115_0310050
580 Ga0501031_0125219
581 Ga0501032_0023519
582 Ga0501034_0002422
583 Ga0501034_0235027
584 Ga0501036_0020716
585 Ga0501039_0108686
586 Ga0501043_0005610
587 Ga0501083_0226164
588 Ga0501035_0014169
589 Ga0501044_0178107
590 nmdc:mga0n895_304450_c1
591 Ga0500583_0000882
592 Ga0500622_0029540
593 Ga0500637_0075543
594 Ga0466962_0006673

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lez-assembly1.cif.gz_A crystal structure of a halotolerant bacterial beta-lactamase 0.8065 207 245
1bvq-assembly1.cif.gz_A three-dimensional structure of 4-hydroxybenzoyl coa thioesterase from pseudomonas sp. strain cbs-3. 0.7225 61 107
5o68-assembly2.cif.gz_F crystal structure of the pseudomonas functional amyloid secretion protein fapf - r157a mutant 0.677 30 247
5o68-assembly3.cif.gz_G crystal structure of the pseudomonas functional amyloid secretion protein fapf - r157a mutant 0.6681 36 247
5o68-assembly3.cif.gz_H crystal structure of the pseudomonas functional amyloid secretion protein fapf - r157a mutant 0.6661 37 247
ID Description Score Start End Superfamily
5ne2A00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8174 209 245 3.40.710.10
af_P76773_24_229_2.40.160.40 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.681 42 247 2.40.160.40
af_P76773_24_229_2.40.160.40 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.6752 42 247 2.40.160.40
af_O53751_12_247_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.6736 205 245 3.10.129.10
3a76A01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.6479 127 177 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A2V8Q1S0-F1-model_v4 Transporter 0.9905 126 247
AF-A0A2V6TG88-F1-model_v4 Transporter 0.9813 134 247
AF-A0A2V9IJJ6-F1-model_v4 Bacterial surface antigen (D15) domain-containing protein 0.9625 153 245
AF-A0A2V9L5Q4-F1-model_v4 Transporter 0.9607 115 247
AF-A0A2V8M4H2-F1-model_v4 Outer membrane protein beta-barrel domain-containing protein 0.9554 19 247

Map