F393005

General Info

Members Datasets Scaffolds Average Seq Length
296 217 592 169

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100035641|Ga0070683_1000356412
Length 188
Sequence MTNTLIRPALVTDLPRLTEIYNHYIIHTPVTFDTRPYTVEERIAWFQQFGETGRYRMLVAELDGKVAAYAGTTRFRPKPAYDTTVETTIYCAPESAGQGLGVRLYAALFHSLENENVHRIVAGYVPPNPASQALHKHFGFQAVGTFSETGFKFGRYWDVCWVERSRRPPIQTSKCTTASPGATGTTSS

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
148 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
149 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
150 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
151 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
152 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
153 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
154 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
155 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
156 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
157 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
158 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
159 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
160 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
162 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
163 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
164 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
165 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
166 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
167 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
178 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
179 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
180 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
181 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
182 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
183 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
193 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
197 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
198 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
199 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
200 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
201 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
202 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
203 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
204 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
205 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
206 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
207 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
211 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
212 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
213 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
214 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
215 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
216 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
217 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.08
Nodule 0
Rhizoplane 4.05
Rhizosphere 89.19
Stem 0
Stem Tuber 0
Unclassified 15.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100035641 3300005329 Bacteria 4548
2 Ga0065715_10110923 3300005293 Bacteria 2598
3 Ga0065715_10678195 3300005293 Unclassified 664
4 Ga0065707_10106940 3300005295 Bacteria 2576
5 Ga0070676_10021933 3300005328 Bacteria 3578
6 Ga0070690_100014230 3300005330 Bacteria 4717
7 Ga0070677_10024550 3300005333 Bacteria 2242
8 Ga0068869_100005790 3300005334 Bacteria 7798
9 Ga0070666_10036939 3300005335 Bacteria 3245
10 Ga0068868_100038337 3300005338 Bacteria 3720
11 Ga0070660_100113480 3300005339 Bacteria 2158
12 Ga0070689_100090713 3300005340 Bacteria 2408
13 Ga0070691_10001511 3300005341 Bacteria 9996
14 Ga0070687_100023263 3300005343 Bacteria 2943
15 Ga0070661_100002238 3300005344 Bacteria 13273
16 Ga0070669_100032941 3300005353 Bacteria 3745
17 Ga0070675_100145267 3300005354 Bacteria 2030
18 Ga0070671_100037097 3300005355 Bacteria 4042
19 Ga0070673_100453043 3300005364 Bacteria 1154
20 Ga0070688_100123159 3300005365 Bacteria 1739
21 Ga0070667_100020885 3300005367 Bacteria 5438
22 Ga0070709_10715504 3300005434 Unclassified 780
23 Ga0070709_10788952 3300005434 Bacteria 745
24 Ga0070714_100078707 3300005435 Bacteria 2866
25 Ga0070714_100079595 3300005435 Bacteria 2849
26 Ga0070714_101186421 3300005435 Unclassified 745
27 Ga0070714_101319561 3300005435 Unclassified 704
28 Ga0070713_100000004 3300005436 Bacteria 220768
29 Ga0070713_100075960 3300005436 Bacteria 2851
30 Ga0070713_100097314 3300005436 Bacteria 2543
31 Ga0070713_100363818 3300005436 Bacteria 1344
32 Ga0070710_10695940 3300005437 Unclassified 717
33 Ga0070701_10047613 3300005438 Bacteria 2209
34 Ga0070711_100059313 3300005439 Bacteria 2656
35 Ga0070705_100220337 3300005440 Unclassified 1313
36 Ga0070700_100029581 3300005441 Bacteria 3267
37 Ga0070694_100144928 3300005444 Bacteria 1729
38 Ga0070708_100208341 3300005445 Unclassified 1831
39 Ga0070678_100015926 3300005456 Bacteria 4791
40 Ga0070662_100093840 3300005457 Bacteria 2258
41 Ga0070662_100764099 3300005457 Bacteria 820
42 Ga0070681_10427253 3300005458 Bacteria 1237
43 Ga0070681_10548623 3300005458 Bacteria 1070
44 Ga0070685_10025050 3300005466 Bacteria 3284
45 Ga0070707_101273482 3300005468 Unclassified 701
46 Ga0070699_100109039 3300005518 Bacteria 2429
47 Ga0068853_100041341 3300005539 Bacteria 3937
48 Ga0068853_101849747 3300005539 Bacteria 585
49 Ga0070672_100045627 3300005543 Bacteria 3391
50 Ga0070686_100005336 3300005544 Bacteria 7109
51 Ga0070693_100054577 3300005547 Bacteria 2299
52 Ga0070665_100215179 3300005548 Bacteria 1922
53 Ga0068855_100008293 3300005563 Bacteria 12559
54 Ga0068855_100095353 3300005563 Bacteria 3429
55 Ga0068855_100110535 3300005563 Bacteria 3155
56 Ga0068855_100857929 3300005563 Bacteria 962
57 Ga0070664_100091293 3300005564 Bacteria 2636
58 Ga0068857_100285851 3300005577 Bacteria 1518
59 Ga0068854_100137791 3300005578 Bacteria 1870
60 Ga0068856_100000144 3300005614 Bacteria 72020
61 Ga0068856_100043780 3300005614 Bacteria 4403
62 Ga0068856_101101527 3300005614 Unclassified 811
63 Ga0068852_100875788 3300005616 Unclassified 914
64 Ga0068859_100023998 3300005617 Bacteria 6120
65 Ga0068861_100033266 3300005719 Bacteria 3802
66 Ga0068863_100059789 3300005841 Bacteria 3605
67 Ga0068858_100079852 3300005842 Bacteria 3039
68 Ga0068858_100092842 3300005842 Bacteria 2809
69 Ga0068860_100021116 3300005843 Bacteria 6305
70 Ga0068862_100039495 3300005844 Bacteria 4008
71 Ga0081455_10068696 3300005937 Bacteria 2948
72 Ga0070717_10107536 3300006028 Bacteria 2375
73 Ga0070717_10188375 3300006028 Unclassified 1802
74 Ga0075368_10012376 3300006042 Bacteria 3117
75 Ga0075364_10038090 3300006051 Bacteria 3115
76 Ga0070716_100300995 3300006173 Unclassified 1115
77 Ga0070716_100499264 3300006173 Unclassified 897
78 Ga0070712_100001654 3300006175 Bacteria 13655
79 Ga0075362_10001010 3300006177 Bacteria 8643
80 Ga0075367_10061600 3300006178 Unclassified 2239
81 Ga0075367_10161306 3300006178 Bacteria 1394
82 Ga0075369_10222331 3300006186 Bacteria 874
83 Ga0075369_10312861 3300006186 Unclassified 734
84 Ga0075366_10018545 3300006195 Bacteria 4019
85 Ga0075366_10028908 3300006195 Bacteria 3254
86 Ga0097621_100251210 3300006237 Bacteria 1548
87 Ga0097621_100462819 3300006237 Bacteria 1144
88 Ga0068871_100151229 3300006358 Bacteria 1980
89 Ga0075428_100037414 3300006844 Bacteria 5342
90 Ga0075428_100087883 3300006844 Bacteria 3390
91 Ga0075431_100010754 3300006847 Bacteria 9201
92 Ga0075433_10014996 3300006852 Bacteria 6345
93 Ga0075434_100023925 3300006871 Bacteria 5963
94 Ga0075429_100007885 3300006880 Bacteria 9249
95 Ga0075429_100074919 3300006880 Bacteria 2948
96 Ga0068865_100107513 3300006881 Bacteria 2052
97 Ga0075436_100000768 3300006914 Bacteria 21264
98 Ga0075436_100213161 3300006914 Bacteria 1369
99 Ga0097620_100023998 3300006931 Bacteria 6120
100 Ga0075435_100387980 3300007076 Bacteria 1200
101 Ga0075435_100398270 3300007076 Bacteria 1184
102 Ga0075435_100405919 3300007076 Unclassified 1172
103 Ga0105240_10080659 3300009093 Bacteria 4001
104 Ga0111539_10018811 3300009094 Bacteria 8547
105 Ga0111539_10185055 3300009094 Unclassified 2432
106 Ga0105247_10441202 3300009101 Unclassified 936
107 Ga0114129_10082593 3300009147 Bacteria 4464
108 Ga0105243_10808421 3300009148 Unclassified 925
109 Ga0105241_10065102 3300009174 Bacteria 2816
110 Ga0105241_10235572 3300009174 Bacteria 1545
111 Ga0105241_10429612 3300009174 Unclassified 1164
112 Ga0105248_10279127 3300009177 Bacteria 1881
113 Ga0105237_10005433 3300009545 Bacteria 14391
114 Ga0105238_10003077 3300009551 Bacteria 16636
115 Ga0105238_10030096 3300009551 Bacteria 5525
116 Ga0105238_10426749 3300009551 Bacteria 1321
117 Ga0105238_11168565 3300009551 Bacteria 793
118 Ga0105249_10045083 3300009553 Bacteria 4010
119 Ga0105239_10027585 3300010375 Bacteria 6250
120 Ga0105246_10035179 3300011119 Bacteria 3346
121 Ga0157373_10030921 3300013100 Bacteria 3853
122 Ga0157370_10004736 3300013104 Bacteria 15511
123 Ga0157369_10036122 3300013105 Bacteria 5415
124 Ga0157369_10117479 3300013105 Bacteria 2823
125 Ga0157374_10077198 3300013296 Bacteria 3152
126 Ga0157374_10196975 3300013296 Bacteria 1972
127 Ga0157378_11041070 3300013297 Unclassified 854
128 Ga0157378_11233818 3300013297 Unclassified 788
129 Ga0163162_10025307 3300013306 Bacteria 5864
130 Ga0157372_10006651 3300013307 Bacteria 12303
131 Ga0157372_10119314 3300013307 Bacteria 3028
132 Ga0157375_10090730 3300013308 Bacteria 3115
133 Ga0163163_10400904 3300014325 Bacteria 1430
134 Ga0157380_10065691 3300014326 Bacteria 2917
135 Ga0157377_10020801 3300014745 Bacteria 3443
136 Ga0157379_10001575 3300014968 Bacteria 18792
137 Ga0157379_10130480 3300014968 Bacteria 2262
138 Ga0157376_10531295 3300014969 Unclassified 1161
139 Ga0163161_10060558 3300017792 Bacteria 2756
140 Ga0207697_10002285 3300025315 Bacteria 10015
141 Ga0207682_10044148 3300025893 Bacteria 1826
142 Ga0207692_10344650 3300025898 Bacteria 917
143 Ga0207688_10010360 3300025901 Bacteria 5073
144 Ga0207685_10134433 3300025905 Unclassified 1102
145 Ga0207699_10000181 3300025906 Bacteria 38302
146 Ga0207699_10319715 3300025906 Bacteria 1088
147 Ga0207645_10008795 3300025907 Bacteria 7021
148 Ga0207643_10005201 3300025908 Bacteria 6961
149 Ga0207654_10046442 3300025911 Bacteria 2476
150 Ga0207707_10107402 3300025912 Bacteria 2440
151 Ga0207707_10501595 3300025912 Bacteria 1035
152 Ga0207695_10007595 3300025913 Bacteria 13746
153 Ga0207693_10004885 3300025915 Bacteria 11265
154 Ga0207663_10040932 3300025916 Bacteria 2820
155 Ga0207660_10572077 3300025917 Bacteria 919
156 Ga0207662_10006765 3300025918 Bacteria 6202
157 Ga0207657_10390486 3300025919 Bacteria 1095
158 Ga0207681_10018366 3300025923 Bacteria 4406
159 Ga0207694_10161137 3300025924 Bacteria 1812
160 Ga0207694_10271324 3300025924 Bacteria 1392
161 Ga0207659_10017629 3300025926 Bacteria 4666
162 Ga0207700_10000011 3300025928 Bacteria 266323
163 Ga0207700_10062107 3300025928 Bacteria 2836
164 Ga0207700_10195789 3300025928 Bacteria 1701
165 Ga0207664_10023936 3300025929 Bacteria 4584
166 Ga0207664_10254185 3300025929 Bacteria 1535
167 Ga0207664_10393076 3300025929 Bacteria 1232
168 Ga0207644_10069428 3300025931 Bacteria 2573
169 Ga0207706_10009545 3300025933 Bacteria 8910
170 Ga0207670_10023409 3300025936 Bacteria 3845
171 Ga0207704_10066499 3300025938 Bacteria 2263
172 Ga0207665_10027268 3300025939 Bacteria 3775
173 Ga0207665_10109884 3300025939 Unclassified 1936
174 Ga0207665_10541012 3300025939 Unclassified 904
175 Ga0207665_11039467 3300025939 Unclassified 652
176 Ga0207691_10021552 3300025940 Bacteria 6084
177 Ga0207689_10017949 3300025942 Bacteria 5974
178 Ga0207661_10007046 3300025944 Bacteria 7979
179 Ga0207679_10009057 3300025945 Bacteria 6358
180 Ga0207667_10011849 3300025949 Bacteria 10100
181 Ga0207667_10013415 3300025949 Bacteria 9375
182 Ga0207667_10014415 3300025949 Bacteria 9016
183 Ga0207651_10068601 3300025960 Bacteria 2500
184 Ga0207658_10061201 3300025986 Bacteria 2812
185 Ga0207677_10066705 3300026023 Bacteria 2517
186 Ga0207703_10025474 3300026035 Bacteria 4652
187 Ga0207703_10033581 3300026035 Bacteria 4069
188 Ga0207639_10038682 3300026041 Bacteria 3549
189 Ga0207639_11563432 3300026041 Bacteria 619
190 Ga0207678_10176336 3300026067 Bacteria 1825
191 Ga0207702_10000226 3300026078 Bacteria 65919
192 Ga0207702_10664648 3300026078 Unclassified 1025
193 Ga0207641_10013255 3300026088 Bacteria 6760
194 Ga0207648_10263517 3300026089 Bacteria 1538
195 Ga0207676_10294894 3300026095 Bacteria 1478
196 Ga0207675_100077401 3300026118 Bacteria 3116
197 Ga0207683_10070889 3300026121 Bacteria 3080
198 Ga0207428_10006851 3300027907 Bacteria 10445
199 Ga0268266_10141290 3300028379 Bacteria 2161
200 Ga0268264_10125927 3300028381 Bacteria 2264
201 Ga0265330_10014118 3300031235 Bacteria 3709
202 Ga0265332_10000038 3300031238 Bacteria 133265
203 Ga0265328_10003425 3300031239 Bacteria 7005
204 Ga0265325_10214906 3300031241 Bacteria 882
205 Ga0265329_10053269 3300031242 Unclassified 1286
206 Ga0265340_10000158 3300031247 Bacteria 34190
207 Ga0265339_10000474 3300031249 Bacteria 31375
208 Ga0265339_10131493 3300031249 Bacteria 1279
209 Ga0265331_10000117 3300031250 Bacteria 104134
210 Ga0265331_10001097 3300031250 Bacteria 20842
211 Ga0265327_10000187 3300031251 Bacteria 131135
212 Ga0265316_10000031 3300031344 Bacteria 161451
213 Ga0265316_10034556 3300031344 Bacteria 4105
214 Ga0265316_10197047 3300031344 Bacteria 1494
215 Ga0265314_10000183 3300031711 Bacteria 92559
216 Ga0265314_10016156 3300031711 Bacteria 5909
217 Ga0265342_10014843 3300031712 Bacteria 5154
218 Ga0265342_10104136 3300031712 Bacteria 1613
219 Ga0265342_10247040 3300031712 Bacteria 953
220 Ga0373926_0014932 3300035083 Bacteria 2645
221 Ga0373926_0026778 3300035083 Bacteria 2018
222 Ga0373923_0331454 3300035111 Unclassified 724
223 Ga0373932_0038800 3300035112 Bacteria 1363
224 Ga0373945_0012310 3300035116 Bacteria 2839
225 Ga0373945_0031723 3300035116 Bacteria 1868
226 Ga0373956_0450064 3300035119 Unclassified 614
227 Ga0373957_0007390 3300035120 Bacteria 3515
228 Ga0373943_0010029 3300035170 Bacteria 4248
229 Ga0373955_0020039 3300035172 Bacteria 3355
230 Ga0373924_0000021 3300035410 Bacteria 39808
231 Ga0373924_0134394 3300035410 Bacteria 1077
232 Ga0373931_0005270 3300035691 Bacteria 5960
233 Ga0373927_0004861 3300035695 Bacteria 9345
234 Ga0373933_0028412 3300035724 Bacteria 3226
235 Ga0373933_0199664 3300035724 Unclassified 1280
236 Ga0373947_0574889 3300035725 Unclassified 767
237 Ga0373937_0218331 3300036401 Unclassified 1794
238 Ga0373937_1245899 3300036401 Bacteria 692
239 Ga0373925_0016147 3300037068 Bacteria 5405
240 Ga0373925_0161971 3300037068 Bacteria 1762
241 Ga0395905_0196984 3300037471 Bacteria 1889
242 Ga0451853_3450168 3300041512 Unclassified 745
243 Ga0495629_0553236 3300046459 Bacteria 772
244 Ga0495639_0053398 3300046475 Unclassified 1841
245 Ga0495608_0304396 3300046511 Bacteria 986
246 Ga0495628_0561401 3300046516 Unclassified 819
247 Ga0495667_0268135 3300046559 Bacteria 1085
248 Ga0495623_0167372 3300046679 Bacteria 1287
249 Ga0495581_0127630 3300047315 Bacteria 1481
250 Ga0495684_0567880 3300047471 Bacteria 770
251 Ga0496100_0543579 3300048903 Unclassified 898
252 Ga0496102_0444122 3300048905 Unclassified 1217
253 Ga0496102_0486127 3300048905 Unclassified 1156
254 Ga0496104_0107993 3300048907 Bacteria 2667
255 Ga0496104_0169528 3300048907 Bacteria 2093
256 Ga0496109_0175522 3300048912 Bacteria 2011
257 Ga0496110_0033436 3300048913 Bacteria 4448
258 Ga0496110_0375827 3300048913 Bacteria 1295
259 Ga0496111_0002758 3300048914 Bacteria 10684
260 Ga0496112_0021812 3300048915 Bacteria 6094
261 Ga0496113_0033939 3300048916 Bacteria 3720
262 Ga0496113_0093187 3300048916 Bacteria 2324
263 Ga0496119_0027423 3300048922 Bacteria 3914
264 Ga0501040_0009949 3300049576 Bacteria 6210
265 Ga0501042_0005067 3300049578 Bacteria 8454
266 Ga0501048_0683821 3300049582 Unclassified 737
267 Ga0501075_0383843 3300049591 Unclassified 1071
268 Ga0501076_0964715 3300049592 Bacteria 703
269 Ga0501080_0035874 3300049742 Bacteria 4629
270 Ga0501268_136068 3300049765 Unclassified 556
271 nmdc:mga03683_11544_c1 3300050489 Bacteria 3201
272 nmdc:mga03n38_177004_c1 3300050490 Unclassified 1090
273 nmdc:mga00v17_1877_c1 3300050491 Bacteria 10869
274 nmdc:mga00v17_83588_c1 3300050491 Bacteria 1997
275 nmdc:mga0k408_26478_c1 3300050493 Bacteria 3288
276 nmdc:mga0k408_7161_c1 3300050493 Bacteria 5961
277 nmdc:mga06z11_4776_c1 3300050494 Bacteria 5360
278 nmdc:mga06z11_55929_c1 3300050494 Bacteria 2039
279 nmdc:mga07m45_5352_c1 3300050496 Bacteria 6390
280 nmdc:mga09592_10444_c1 3300050508 Bacteria 7554
281 nmdc:mga06r32_8125_c1 3300050510 Bacteria 9442
282 nmdc:mga08y16_196186_c1 3300050511 Bacteria 2093
283 nmdc:mga0n895_15212_c1 3300050512 Bacteria 7011
284 nmdc:mga0n895_20432_c1 3300050512 Bacteria 6177
285 nmdc:mga0rr50_233637_c1 3300050513 Bacteria 1522
286 nmdc:mga0rr50_370821_c1 3300050513 Bacteria 1206
287 nmdc:mga0rr50_6095_c1 3300050513 Bacteria 7289
288 nmdc:mga08x19_129_c1 3300050514 Bacteria 66982
289 nmdc:mga08x19_81729_c1 3300050514 Unclassified 2122
290 nmdc:mga0a205_4936_c1 3300050515 Bacteria 12001
291 Ga0495595_0469452 3300053084 Bacteria 640
292 Ga0495619_0124423 3300053085 Bacteria 1769
293 Ga0501084_0165614 3300054114 Bacteria 1866
294 Ga0501084_0168145 3300054114 Bacteria 1851
295 Ga0501082_0856870 3300060353 Bacteria 795
296 Ga0530510_0093803 3300061734 Bacteria 2192
297 Ga0070683_100035641
298 Ga0065715_10110923
299 Ga0065715_10678195
300 Ga0065707_10106940
301 Ga0070676_10021933
302 Ga0070690_100014230
303 Ga0070677_10024550
304 Ga0068869_100005790
305 Ga0070666_10036939
306 Ga0068868_100038337
307 Ga0070660_100113480
308 Ga0070689_100090713
309 Ga0070691_10001511
310 Ga0070687_100023263
311 Ga0070661_100002238
312 Ga0070669_100032941
313 Ga0070675_100145267
314 Ga0070671_100037097
315 Ga0070673_100453043
316 Ga0070688_100123159
317 Ga0070667_100020885
318 Ga0070709_10715504
319 Ga0070709_10788952
320 Ga0070714_100078707
321 Ga0070714_100079595
322 Ga0070714_101186421
323 Ga0070714_101319561
324 Ga0070713_100000004
325 Ga0070713_100075960
326 Ga0070713_100097314
327 Ga0070713_100363818
328 Ga0070710_10695940
329 Ga0070701_10047613
330 Ga0070711_100059313
331 Ga0070705_100220337
332 Ga0070700_100029581
333 Ga0070694_100144928
334 Ga0070708_100208341
335 Ga0070678_100015926
336 Ga0070662_100093840
337 Ga0070662_100764099
338 Ga0070681_10427253
339 Ga0070681_10548623
340 Ga0070685_10025050
341 Ga0070707_101273482
342 Ga0070699_100109039
343 Ga0068853_100041341
344 Ga0068853_101849747
345 Ga0070672_100045627
346 Ga0070686_100005336
347 Ga0070693_100054577
348 Ga0070665_100215179
349 Ga0068855_100008293
350 Ga0068855_100095353
351 Ga0068855_100110535
352 Ga0068855_100857929
353 Ga0070664_100091293
354 Ga0068857_100285851
355 Ga0068854_100137791
356 Ga0068856_100000144
357 Ga0068856_100043780
358 Ga0068856_101101527
359 Ga0068852_100875788
360 Ga0068859_100023998
361 Ga0068861_100033266
362 Ga0068863_100059789
363 Ga0068858_100079852
364 Ga0068858_100092842
365 Ga0068860_100021116
366 Ga0068862_100039495
367 Ga0081455_10068696
368 Ga0070717_10107536
369 Ga0070717_10188375
370 Ga0075368_10012376
371 Ga0075364_10038090
372 Ga0070716_100300995
373 Ga0070716_100499264
374 Ga0070712_100001654
375 Ga0075362_10001010
376 Ga0075367_10061600
377 Ga0075367_10161306
378 Ga0075369_10222331
379 Ga0075369_10312861
380 Ga0075366_10018545
381 Ga0075366_10028908
382 Ga0097621_100251210
383 Ga0097621_100462819
384 Ga0068871_100151229
385 Ga0075428_100037414
386 Ga0075428_100087883
387 Ga0075431_100010754
388 Ga0075433_10014996
389 Ga0075434_100023925
390 Ga0075429_100007885
391 Ga0075429_100074919
392 Ga0068865_100107513
393 Ga0075436_100000768
394 Ga0075436_100213161
395 Ga0097620_100023998
396 Ga0075435_100387980
397 Ga0075435_100398270
398 Ga0075435_100405919
399 Ga0105240_10080659
400 Ga0111539_10018811
401 Ga0111539_10185055
402 Ga0105247_10441202
403 Ga0114129_10082593
404 Ga0105243_10808421
405 Ga0105241_10065102
406 Ga0105241_10235572
407 Ga0105241_10429612
408 Ga0105248_10279127
409 Ga0105237_10005433
410 Ga0105238_10003077
411 Ga0105238_10030096
412 Ga0105238_10426749
413 Ga0105238_11168565
414 Ga0105249_10045083
415 Ga0105239_10027585
416 Ga0105246_10035179
417 Ga0157373_10030921
418 Ga0157370_10004736
419 Ga0157369_10036122
420 Ga0157369_10117479
421 Ga0157374_10077198
422 Ga0157374_10196975
423 Ga0157378_11041070
424 Ga0157378_11233818
425 Ga0163162_10025307
426 Ga0157372_10006651
427 Ga0157372_10119314
428 Ga0157375_10090730
429 Ga0163163_10400904
430 Ga0157380_10065691
431 Ga0157377_10020801
432 Ga0157379_10001575
433 Ga0157379_10130480
434 Ga0157376_10531295
435 Ga0163161_10060558
436 Ga0207697_10002285
437 Ga0207682_10044148
438 Ga0207692_10344650
439 Ga0207688_10010360
440 Ga0207685_10134433
441 Ga0207699_10000181
442 Ga0207699_10319715
443 Ga0207645_10008795
444 Ga0207643_10005201
445 Ga0207654_10046442
446 Ga0207707_10107402
447 Ga0207707_10501595
448 Ga0207695_10007595
449 Ga0207693_10004885
450 Ga0207663_10040932
451 Ga0207660_10572077
452 Ga0207662_10006765
453 Ga0207657_10390486
454 Ga0207681_10018366
455 Ga0207694_10161137
456 Ga0207694_10271324
457 Ga0207659_10017629
458 Ga0207700_10000011
459 Ga0207700_10062107
460 Ga0207700_10195789
461 Ga0207664_10023936
462 Ga0207664_10254185
463 Ga0207664_10393076
464 Ga0207644_10069428
465 Ga0207706_10009545
466 Ga0207670_10023409
467 Ga0207704_10066499
468 Ga0207665_10027268
469 Ga0207665_10109884
470 Ga0207665_10541012
471 Ga0207665_11039467
472 Ga0207691_10021552
473 Ga0207689_10017949
474 Ga0207661_10007046
475 Ga0207679_10009057
476 Ga0207667_10011849
477 Ga0207667_10013415
478 Ga0207667_10014415
479 Ga0207651_10068601
480 Ga0207658_10061201
481 Ga0207677_10066705
482 Ga0207703_10025474
483 Ga0207703_10033581
484 Ga0207639_10038682
485 Ga0207639_11563432
486 Ga0207678_10176336
487 Ga0207702_10000226
488 Ga0207702_10664648
489 Ga0207641_10013255
490 Ga0207648_10263517
491 Ga0207676_10294894
492 Ga0207675_100077401
493 Ga0207683_10070889
494 Ga0207428_10006851
495 Ga0268266_10141290
496 Ga0268264_10125927
497 Ga0265330_10014118
498 Ga0265332_10000038
499 Ga0265328_10003425
500 Ga0265325_10214906
501 Ga0265329_10053269
502 Ga0265340_10000158
503 Ga0265339_10000474
504 Ga0265339_10131493
505 Ga0265331_10000117
506 Ga0265331_10001097
507 Ga0265327_10000187
508 Ga0265316_10000031
509 Ga0265316_10034556
510 Ga0265316_10197047
511 Ga0265314_10000183
512 Ga0265314_10016156
513 Ga0265342_10014843
514 Ga0265342_10104136
515 Ga0265342_10247040
516 Ga0373926_0014932
517 Ga0373926_0026778
518 Ga0373923_0331454
519 Ga0373932_0038800
520 Ga0373945_0012310
521 Ga0373945_0031723
522 Ga0373956_0450064
523 Ga0373957_0007390
524 Ga0373943_0010029
525 Ga0373955_0020039
526 Ga0373924_0000021
527 Ga0373924_0134394
528 Ga0373931_0005270
529 Ga0373927_0004861
530 Ga0373933_0028412
531 Ga0373933_0199664
532 Ga0373947_0574889
533 Ga0373937_0218331
534 Ga0373937_1245899
535 Ga0373925_0016147
536 Ga0373925_0161971
537 Ga0395905_0196984
538 Ga0451853_3450168
539 Ga0495629_0553236
540 Ga0495639_0053398
541 Ga0495608_0304396
542 Ga0495628_0561401
543 Ga0495667_0268135
544 Ga0495623_0167372
545 Ga0495581_0127630
546 Ga0495684_0567880
547 Ga0496100_0543579
548 Ga0496102_0444122
549 Ga0496102_0486127
550 Ga0496104_0107993
551 Ga0496104_0169528
552 Ga0496109_0175522
553 Ga0496110_0033436
554 Ga0496110_0375827
555 Ga0496111_0002758
556 Ga0496112_0021812
557 Ga0496113_0033939
558 Ga0496113_0093187
559 Ga0496119_0027423
560 Ga0501040_0009949
561 Ga0501042_0005067
562 Ga0501048_0683821
563 Ga0501075_0383843
564 Ga0501076_0964715
565 Ga0501080_0035874
566 Ga0501268_136068
567 nmdc:mga03683_11544_c1
568 nmdc:mga03n38_177004_c1
569 nmdc:mga00v17_1877_c1
570 nmdc:mga00v17_83588_c1
571 nmdc:mga0k408_26478_c1
572 nmdc:mga0k408_7161_c1
573 nmdc:mga06z11_4776_c1
574 nmdc:mga06z11_55929_c1
575 nmdc:mga07m45_5352_c1
576 nmdc:mga09592_10444_c1
577 nmdc:mga06r32_8125_c1
578 nmdc:mga08y16_196186_c1
579 nmdc:mga0n895_15212_c1
580 nmdc:mga0n895_20432_c1
581 nmdc:mga0rr50_233637_c1
582 nmdc:mga0rr50_370821_c1
583 nmdc:mga0rr50_6095_c1
584 nmdc:mga08x19_129_c1
585 nmdc:mga08x19_81729_c1
586 nmdc:mga0a205_4936_c1
587 Ga0495595_0469452
588 Ga0495619_0124423
589 Ga0501084_0165614
590 Ga0501084_0168145
591 Ga0501082_0856870
592 Ga0530510_0093803

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13420

Acetyltransf_4

Acetyltransferase (GNAT) domain

6

161

0.94

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

28

156

0.84

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

3

141

0.83

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

17

140

0.8

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

53

142

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yr0-assembly2.cif.gz_D crystal structure of phosphinothricin acetyltransferase from agrobacterium tumefaciens 0.9603 4 166
2j8n-assembly1.cif.gz_A structure of p. aeruginosa acetyltransferase pa4866 solved at room temperature 0.9585 5 167
4j3g-assembly2.cif.gz_C crystal structure of ribosomal-protein-alanine n-acetyltransferase from brucella melitensis 0.9582 5 166
1yvo-assembly1.cif.gz_A hypothetical acetyltransferase from p.aeruginosa pa01 0.9556 5 167
4jxr-assembly1.cif.gz_B crystal structure of a gnat superfamily phosphinothricin acetyltransferase (pat) from sinorhizobium meliloti in complex with accoa 0.9483 3 166
ID Description Score Start End Superfamily
af_C7IYZ1_1_59_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9485 119 166 3.40.630.30
5dwmA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9463 4 166 3.40.630.30
2jlmC00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9356 4 166 3.40.630.30
6m7gE00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9317 4 170 3.40.630.30
3dr6B00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9243 5 170 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A3Q8W8C6-F1-model_v4 N-acetyltransferase 0.9973 4 166 GO:0016747
AF-F8JMX8-F1-model_v4 Phosphinothricin acetyltransferase 0.9963 4 167 GO:0016747
AF-A0A4R2EDQ5-F1-model_v4 deleted 0.9941 2 166
AF-C9YWD9-F1-model_v4 Putative N-acetyltransferase 0.9939 2 166 GO:0016747
AF-A0A7Z9HV35-F1-model_v4 N-acetyltransferase family protein 0.9936 4 166 GO:0016747

Map