F392911

General Info

Members Datasets Scaffolds Average Seq Length
295 217 590 170

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2515154202|2516084580
Length 205
Sequence GTRAPAVASPLASPDEWATGQYLGGVLGLVGENPGMSELAITVIGRDRPGIVADVAEVLARLGANLTDSTMTRLRGHFAMTLICVGPAAAEAEAALAPLAADGQLLATVRAVVPDAEQTSSGVPYVLAVHGADRMGIVAAMTRVLAEAGGNVTDLSTRLAGALYVVLAEVELPPDVAEQVTARLAATAADLGVEVTLRPADPDLL

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
88 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
89 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
92 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
96 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
101 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
102 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
103 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
104 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
105 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
111 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
112 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
113 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
114 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
115 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
116 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
117 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
118 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
119 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
120 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
121 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
122 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
123 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
124 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
125 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
126 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
129 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
132 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
133 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
134 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
135 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
136 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
137 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
147 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
148 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
149 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
150 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
151 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
152 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
153 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
154 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
156 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
157 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
158 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
159 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
162 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
163 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
164 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
165 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
166 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
167 2501939600 Micromonospora sp. L5 Isolate Unclassified
168 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
169 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
170 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
171 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
172 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
173 2643221561 Nocardioides sp. Root151 Isolate Unclassified
174 2643221604 Nocardioides sp. Root190 Isolate Unclassified
175 2643221696 Nocardioides sp. Root140 Isolate Unclassified
176 2738541305 Nocardioides sp. CF167 Isolate Unclassified
177 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
178 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
179 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
180 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
181 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
182 2855683550 Micromonospora sp. RP3T Isolate Unclassified
183 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
184 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
185 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
186 2858868258 Micromonospora sp. MH33 Isolate Unclassified
187 2858882152 Micromonospora noduli MED15 Isolate Nodule
188 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
189 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
190 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
191 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
192 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
193 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
194 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
195 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
196 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
197 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
198 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
199 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
200 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
201 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
202 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
203 2902582711 Micromonospora sp. AP08 Isolate Unclassified
204 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
205 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
206 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
207 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
208 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
209 649633069 Micromonospora sp. L5 Isolate Unclassified
210 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
211 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
212 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
213 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
214 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
215 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
216 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
217 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 82.37
Metatranscriptomes 0
Isolates 17.63

Biome Distribution

Category Percentage (%)
Aerial Root 0.68
Bulb 0
Endosphere 0.68
Nodule 2.03
Rhizoplane 6.44
Rhizosphere 76.61
Stem 0
Stem Tuber 0
Unclassified 0.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10029849 3300005327 Bacteria 4380
2 Ga0070676_10024930 3300005328 Bacteria 3375
3 Ga0070683_100003890 3300005329 Bacteria 12215
4 Ga0070683_100089761 3300005329 Bacteria 2885
5 Ga0070690_100456848 3300005330 Bacteria 948
6 Ga0068869_100054309 3300005334 Bacteria 2916
7 Ga0068869_100294962 3300005334 Bacteria 1307
8 Ga0070680_100985506 3300005336 Bacteria 728
9 Ga0070682_100848210 3300005337 Bacteria 746
10 Ga0070660_100086638 3300005339 Bacteria 2464
11 Ga0070689_100735861 3300005340 Bacteria 863
12 Ga0070691_10098948 3300005341 Bacteria 1446
13 Ga0070661_100012736 3300005344 Bacteria 5886
14 Ga0070668_100015245 3300005347 Bacteria 5742
15 Ga0070675_100008872 3300005354 Bacteria 7818
16 Ga0070659_100035474 3300005366 Bacteria 3884
17 Ga0070700_100016932 3300005441 Bacteria 4159
18 Ga0070694_100433062 3300005444 Bacteria 1035
19 Ga0070663_100057934 3300005455 Bacteria 2781
20 Ga0070681_10348494 3300005458 Bacteria 1391
21 Ga0070679_100817626 3300005530 Bacteria 875
22 Ga0070684_100013957 3300005535 Bacteria 6493
23 Ga0070684_100033833 3300005535 Bacteria 4367
24 Ga0070672_100907696 3300005543 Bacteria 778
25 Ga0070693_100459438 3300005547 Bacteria 895
26 Ga0070664_100027518 3300005564 Bacteria 4725
27 Ga0070664_100046900 3300005564 Bacteria 3650
28 Ga0070664_100314214 3300005564 Bacteria 1418
29 Ga0068857_100055899 3300005577 Bacteria 3502
30 Ga0068857_100456568 3300005577 Bacteria 1195
31 Ga0068854_100163672 3300005578 Bacteria 1725
32 Ga0068856_101860496 3300005614 Bacteria 613
33 Ga0068866_10280421 3300005718 Bacteria 1032
34 Ga0068866_10355415 3300005718 Bacteria 932
35 Ga0068861_100312865 3300005719 Bacteria 1365
36 Ga0068861_100479592 3300005719 Bacteria 1120
37 Ga0068861_101271808 3300005719 Bacteria 714
38 Ga0068870_10121350 3300005840 Bacteria 1506
39 Ga0068863_100875000 3300005841 Bacteria 898
40 Ga0068858_100563709 3300005842 Bacteria 1103
41 Ga0068860_101063998 3300005843 Bacteria 828
42 Ga0068862_100020996 3300005844 Bacteria 5457
43 Ga0068862_100143209 3300005844 Bacteria 2123
44 Ga0081540_1000838 3300005983 Bacteria 28040
45 Ga0070717_10472574 3300006028 Bacteria 1132
46 Ga0075428_100018671 3300006844 Bacteria 7666
47 Ga0075428_100075332 3300006844 Bacteria 3685
48 Ga0075430_100026033 3300006846 Bacteria 4977
49 Ga0075431_100022250 3300006847 Bacteria 6481
50 Ga0075431_100986558 3300006847 Bacteria 810
51 Ga0075431_101205309 3300006847 Bacteria 720
52 Ga0075431_101369191 3300006847 Bacteria 668
53 Ga0075429_100850085 3300006880 Bacteria 799
54 Ga0068865_100441372 3300006881 Bacteria 1074
55 Ga0111539_10038747 3300009094 Bacteria 5750
56 Ga0111539_10602133 3300009094 Bacteria 1280
57 Ga0105245_10077325 3300009098 Bacteria 3034
58 Ga0105245_10079213 3300009098 Bacteria 3000
59 Ga0105247_10065977 3300009101 Bacteria 2252
60 Ga0114129_10010115 3300009147 Bacteria 13448
61 Ga0114129_10705863 3300009147 Bacteria 1296
62 Ga0105237_10291881 3300009545 Bacteria 1633
63 Ga0105237_10536146 3300009545 Bacteria 1177
64 Ga0105237_10562225 3300009545 Bacteria 1147
65 Ga0105239_10027314 3300010375 Bacteria 6282
66 Ga0105239_10211459 3300010375 Bacteria 2174
67 Ga0157375_10017945 3300013308 Bacteria 6405
68 Ga0157375_10657425 3300013308 Bacteria 1204
69 Ga0163163_10391988 3300014325 Bacteria 1447
70 Ga0157377_10023617 3300014745 Bacteria 3261
71 Ga0157379_10581080 3300014968 Bacteria 1044
72 Ga0207642_10204084 3300025899 Bacteria 1094
73 Ga0207688_10007097 3300025901 Bacteria 6092
74 Ga0207647_10020070 3300025904 Bacteria 4485
75 Ga0207699_10199080 3300025906 Bacteria 1356
76 Ga0207705_10374877 3300025909 Bacteria 1099
77 Ga0207684_10922364 3300025910 Bacteria 733
78 Ga0207671_10744675 3300025914 Bacteria 778
79 Ga0207657_10024696 3300025919 Bacteria 5557
80 Ga0207649_10006298 3300025920 Bacteria 6445
81 Ga0207659_10101510 3300025926 Bacteria 2170
82 Ga0207687_10064887 3300025927 Bacteria 2591
83 Ga0207687_10085515 3300025927 Bacteria 2288
84 Ga0207690_10052033 3300025932 Bacteria 2742
85 Ga0207709_10083887 3300025935 Bacteria 2061
86 Ga0207704_10298210 3300025938 Bacteria 1233
87 Ga0207691_10455984 3300025940 Bacteria 1088
88 Ga0207689_10173308 3300025942 Bacteria 1779
89 Ga0207689_10284074 3300025942 Bacteria 1370
90 Ga0207661_10016638 3300025944 Bacteria 5428
91 Ga0207661_10254237 3300025944 Bacteria 1563
92 Ga0207679_10016115 3300025945 Bacteria 4957
93 Ga0207679_10084292 3300025945 Bacteria 2439
94 Ga0207679_10131551 3300025945 Bacteria 2008
95 Ga0207679_10524232 3300025945 Bacteria 1060
96 Ga0207712_10548097 3300025961 Bacteria 994
97 Ga0207668_10001735 3300025972 Bacteria 12771
98 Ga0207640_10145445 3300025981 Bacteria 1734
99 Ga0207658_10097640 3300025986 Bacteria 2294
100 Ga0207677_10321454 3300026023 Bacteria 1286
101 Ga0207703_10381144 3300026035 Bacteria 1304
102 Ga0207678_10075684 3300026067 Bacteria 2884
103 Ga0207708_10007431 3300026075 Bacteria 8099
104 Ga0207702_10832681 3300026078 Bacteria 913
105 Ga0207641_10816175 3300026088 Bacteria 923
106 Ga0207648_10297501 3300026089 Bacteria 1447
107 Ga0207676_10338175 3300026095 Bacteria 1388
108 Ga0207674_10132506 3300026116 Bacteria 2455
109 Ga0207674_10500533 3300026116 Bacteria 1174
110 Ga0207675_100310341 3300026118 Bacteria 1538
111 Ga0207698_10685213 3300026142 Bacteria 1018
112 Ga0268266_10606525 3300028379 Bacteria 1052
113 Ga0268265_10019884 3300028380 Bacteria 4677
114 Ga0268265_10223245 3300028380 Bacteria 1650
115 Ga0268264_10727713 3300028381 Bacteria 987
116 Ga0307512_10135416 3300030522 Bacteria 1528
117 Ga0265328_10019808 3300031239 Bacteria 2581
118 Ga0307509_10008625 3300031507 Bacteria 12944
119 Ga0307408_100575955 3300031548 Bacteria 997
120 Ga0307508_10006134 3300031616 Bacteria 11340
121 Ga0307516_10687973 3300031730 Bacteria 679
122 Ga0307405_10087424 3300031731 Bacteria 2054
123 Ga0307405_10426928 3300031731 Bacteria 1045
124 Ga0307405_10530847 3300031731 Bacteria 949
125 Ga0307413_10066239 3300031824 Bacteria 2253
126 Ga0307413_10432485 3300031824 Bacteria 1040
127 Ga0307413_10838724 3300031824 Bacteria 776
128 Ga0307406_10054717 3300031901 Bacteria 2548
129 Ga0307406_10181500 3300031901 Bacteria 1533
130 Ga0307406_10255725 3300031901 Bacteria 1322
131 Ga0307406_10260403 3300031901 Bacteria 1312
132 Ga0307407_10343148 3300031903 Bacteria 1055
133 Ga0307412_11171765 3300031911 Bacteria 687
134 Ga0307409_100181884 3300031995 Bacteria 1862
135 Ga0307409_100203258 3300031995 Bacteria 1774
136 Ga0307416_100608872 3300032002 Bacteria 1173
137 Ga0307416_102257814 3300032002 Bacteria 645
138 Ga0307415_100107968 3300032126 Bacteria 2058
139 Ga0307415_100135906 3300032126 Bacteria 1870
140 Ga0307415_100220795 3300032126 Bacteria 1519
141 Ga0307415_100285269 3300032126 Bacteria 1360
142 Ga0307415_100860348 3300032126 Bacteria 833
143 Ga0307507_10051653 3300033179 Bacteria 3953
144 Ga0373939_0064618 3300035114 Bacteria 1175
145 Ga0373931_0909682 3300035691 Bacteria 592
146 Ga0373935_0140809 3300035692 Bacteria 1629
147 Ga0395899_0086006 3300037312 Bacteria 2284
148 Ga0395900_0042844 3300037418 Bacteria 4663
149 Ga0395900_0747928 3300037418 Bacteria 908
150 Ga0395898_0009742 3300037466 Bacteria 10069
151 Ga0395905_0004526 3300037471 Bacteria 14400
152 Ga0395901_0015200 3300038443 Bacteria 7830
153 Ga0451853_1586819 3300041512 Bacteria 767
154 Ga0466965_0004595 3300044683 Bacteria 6146
155 Ga0466965_0051815 3300044683 Bacteria 2037
156 Ga0466961_0407277 3300044693 Bacteria 825
157 Ga0466960_0058240 3300044901 Bacteria 1886
158 Ga0466958_0710772 3300045836 Bacteria 655
159 Ga0495641_0032542 3300046461 Bacteria 2481
160 Ga0495653_0420581 3300046463 Bacteria 846
161 Ga0495594_0069971 3300046499 Bacteria 1950
162 Ga0495606_0014626 3300046507 Bacteria 6106
163 Ga0495620_0171550 3300046515 Bacteria 841
164 Ga0495668_0000642 3300046616 Bacteria 42122
165 Ga0495625_0001727 3300046660 Bacteria 25329
166 Ga0495670_0214431 3300046691 Bacteria 1022
167 Ga0495680_0446043 3300047322 Unclassified 886
168 Ga0495680_0760012 3300047322 Bacteria 636
169 Ga0495686_0265770 3300047472 Bacteria 959
170 Ga0495686_0315363 3300047472 Bacteria 859
171 Ga0495626_0000455 3300048091 Bacteria 41789
172 Ga0496101_0047605 3300048904 Bacteria 3079
173 Ga0496104_0045134 3300048907 Bacteria 4144
174 Ga0496105_0562297 3300048908 Bacteria 889
175 Ga0496108_0000089 3300048911 Bacteria 97102
176 Ga0496108_0044119 3300048911 Bacteria 3723
177 Ga0496108_0333706 3300048911 Bacteria 1322
178 Ga0496109_0008048 3300048912 Bacteria 8934
179 Ga0496109_0033038 3300048912 Bacteria 4654
180 Ga0496110_0006285 3300048913 Bacteria 9377
181 Ga0496110_0436225 3300048913 Bacteria 1194
182 Ga0496111_0001806 3300048914 Bacteria 12564
183 Ga0496111_0071764 3300048914 Bacteria 2520
184 Ga0496112_0051129 3300048915 Bacteria 4053
185 Ga0496112_0330927 3300048915 Bacteria 1467
186 Ga0496113_0190911 3300048916 Bacteria 1626
187 Ga0496113_1020465 3300048916 Bacteria 651
188 Ga0496114_0175888 3300048917 Bacteria 1867
189 Ga0496114_0335703 3300048917 Bacteria 1336
190 Ga0496114_0542209 3300048917 Bacteria 1028
191 Ga0496119_0174173 3300048922 Bacteria 1134
192 Ga0501031_0060608 3300049568 Bacteria 2466
193 Ga0501032_0077964 3300049569 Bacteria 2206
194 Ga0501036_0259768 3300049572 Bacteria 1455
195 Ga0501037_0104257 3300049573 Bacteria 2045
196 Ga0501038_0396695 3300049574 Bacteria 1068
197 Ga0501040_0018903 3300049576 Bacteria 4579
198 Ga0501040_0247737 3300049576 Bacteria 1271
199 Ga0501042_0094313 3300049578 Bacteria 2149
200 Ga0501042_0959626 3300049578 Bacteria 623
201 Ga0501046_0117938 3300049580 Bacteria 2022
202 Ga0501048_0296927 3300049582 Bacteria 1149
203 Ga0501048_0322998 3300049582 Bacteria 1100
204 Ga0501070_0576867 3300049586 Bacteria 898
205 Ga0501071_0314607 3300049587 Bacteria 1188
206 Ga0501072_0047119 3300049588 Bacteria 3394
207 Ga0501074_0034782 3300049590 Bacteria 3652
208 Ga0501075_0230945 3300049591 Bacteria 1411
209 Ga0501075_0265340 3300049591 Bacteria 1309
210 Ga0501075_0483765 3300049591 Bacteria 944
211 Ga0501076_0019750 3300049592 Bacteria 5153
212 Ga0501076_0415857 3300049592 Bacteria 1106
213 Ga0501077_0081419 3300049593 Bacteria 2051
214 Ga0501077_0456852 3300049593 Bacteria 818
215 Ga0501081_0197404 3300049743 Bacteria 1459
216 Ga0501081_0778164 3300049743 Bacteria 720
217 Ga0501081_0908865 3300049743 Bacteria 664
218 Ga0501035_0280325 3300049822 Bacteria 1409
219 Ga0501045_0039625 3300049824 Bacteria 3428
220 Ga0501045_0312907 3300049824 Bacteria 1168
221 nmdc:mga05p37_1431176_c1 3300050507 Bacteria 694
222 nmdc:mga05p37_149555_c2 3300050507 Bacteria 854
223 nmdc:mga09592_25825_c1 3300050508 Bacteria 4865
224 nmdc:mga09592_333984_c2 3300050508 Bacteria 1004
225 nmdc:mga0qj67_44936_c1 3300050509 Bacteria 3484
226 nmdc:mga06r32_12329_c1 3300050510 Bacteria 7709
227 nmdc:mga06r32_1284575_c1 3300050510 Bacteria 676
228 nmdc:mga06r32_1379441_c1 3300050510 Bacteria 647
229 nmdc:mga06r32_286017_c1 3300050510 Bacteria 1635
230 nmdc:mga06r32_61568_c1 3300050510 Bacteria 3613
231 nmdc:mga06r32_758616_c1 3300050510 Bacteria 933
232 nmdc:mga08y16_1230250_c1 3300050511 Bacteria 718
233 nmdc:mga08y16_63857_c1 3300050511 Bacteria 3846
234 Ga0500643_001107 3300053087 Bacteria 16141
235 Ga0500630_216807 3300053159 Bacteria 723
236 Ga0501084_0041531 3300054114 Bacteria 3848
237 Ga0501084_0752450 3300054114 Bacteria 821
238 Ga0501082_0212241 3300060353 Bacteria 1684
239 Ga0501082_1305819 3300060353 Bacteria 634
240 Ga0530510_0022615 3300061734 Bacteria 4479
241 Ga0530510_0249431 3300061734 Bacteria 1323
242 Ga0530510_0668127 3300061734 Bacteria 791
243 Ga0530510_0769877 3300061734 Bacteria 734
244 2516084580 2515154202 Bacteria 5471270
245 2501943513 2501939600 Bacteria 6907073
246 2515498110 2515154088 Bacteria 5526283
247 2515720363 2515154129 Bacteria 5584369
248 2515759217 2515154137 Bacteria 5711575
249 2516090956 2515154203 Bacteria 5458536
250 2623585406 2622736626 Bacteria 7181580
251 2643827760 2643221561 Bacteria 4984412
252 2644035210 2643221604 Bacteria 5014917
253 2644532472 2643221696 Bacteria 5431823
254 2738867625 2738541305 Bacteria 4910150
255 2772645317 2772190715 Bacteria 6959372
256 2831939532 2831935698 Bacteria 5963223
257 2832005799 2832004796 Bacteria 6538017
258 2855675865 2855670206 Bacteria 7120389
259 2855677204 2855676851 Bacteria 7063653
260 2855687899 2855683550 Bacteria 7134265
261 2856859322 2856858025 Bacteria 7255264
262 2857291459 2857288857 Bacteria 7189066
263 2858850238 2858848962 Bacteria 6963058
264 2858872636 2858868258 Bacteria 7683772
265 2858884740 2858882152 Bacteria 7230291
266 2858893307 2858888857 Bacteria 7060307
267 2858900357 2858895516 Bacteria 7378898
268 2858902617 2858902515 Bacteria 7086037
269 2866068824 2866065130 Bacteria 6518152
270 2867306341 2867302475 Bacteria 7087181
271 2867317148 2867312974 Bacteria 7058875
272 2867322970 2867319477 Bacteria 7069771
273 2867510569 2867507094 Bacteria 6506033
274 2868092827 2868088558 Bacteria 7609351
275 2869048756 2869048445 Bacteria 6875584
276 2869064338 2869061728 Bacteria 7112407
277 2869072202 2869068681 Bacteria 7205615
278 2880494813 2880489317 Bacteria 7096270
279 2880497501 2880495981 Bacteria 7340502
280 2887485701 2887478801 Bacteria 8972725
281 2902584372 2902582711 Bacteria 6187705
282 2929226064 2929219909 Bacteria 6984360
283 2929232729 2929226422 Bacteria 7248583
284 2984579703 2984576629 Bacteria 4248407
285 2990257309 2990256926 Bacteria 4252839
286 2996228183 2996221748 Bacteria 6799777
287 649812814 649633069 Bacteria 6962533
288 8001783105 8001781756 Bacteria 9586736
289 8003833315 8003830390 Bacteria 6541657
290 8003861258 8003856774 Bacteria 7675274
291 8003872521 8003870546 Bacteria 7396674
292 8054704180 8054704163 Bacteria 7247792
293 8054732351 8054727385 Bacteria 7558670
294 8054739314 8054734606 Bacteria 6947278
295 8055418437 8055412473 Bacteria 6257500
296 Ga0070658_10029849
297 Ga0070676_10024930
298 Ga0070683_100003890
299 Ga0070683_100089761
300 Ga0070690_100456848
301 Ga0068869_100054309
302 Ga0068869_100294962
303 Ga0070680_100985506
304 Ga0070682_100848210
305 Ga0070660_100086638
306 Ga0070689_100735861
307 Ga0070691_10098948
308 Ga0070661_100012736
309 Ga0070668_100015245
310 Ga0070675_100008872
311 Ga0070659_100035474
312 Ga0070700_100016932
313 Ga0070694_100433062
314 Ga0070663_100057934
315 Ga0070681_10348494
316 Ga0070679_100817626
317 Ga0070684_100013957
318 Ga0070684_100033833
319 Ga0070672_100907696
320 Ga0070693_100459438
321 Ga0070664_100027518
322 Ga0070664_100046900
323 Ga0070664_100314214
324 Ga0068857_100055899
325 Ga0068857_100456568
326 Ga0068854_100163672
327 Ga0068856_101860496
328 Ga0068866_10280421
329 Ga0068866_10355415
330 Ga0068861_100312865
331 Ga0068861_100479592
332 Ga0068861_101271808
333 Ga0068870_10121350
334 Ga0068863_100875000
335 Ga0068858_100563709
336 Ga0068860_101063998
337 Ga0068862_100020996
338 Ga0068862_100143209
339 Ga0081540_1000838
340 Ga0070717_10472574
341 Ga0075428_100018671
342 Ga0075428_100075332
343 Ga0075430_100026033
344 Ga0075431_100022250
345 Ga0075431_100986558
346 Ga0075431_101205309
347 Ga0075431_101369191
348 Ga0075429_100850085
349 Ga0068865_100441372
350 Ga0111539_10038747
351 Ga0111539_10602133
352 Ga0105245_10077325
353 Ga0105245_10079213
354 Ga0105247_10065977
355 Ga0114129_10010115
356 Ga0114129_10705863
357 Ga0105237_10291881
358 Ga0105237_10536146
359 Ga0105237_10562225
360 Ga0105239_10027314
361 Ga0105239_10211459
362 Ga0157375_10017945
363 Ga0157375_10657425
364 Ga0163163_10391988
365 Ga0157377_10023617
366 Ga0157379_10581080
367 Ga0207642_10204084
368 Ga0207688_10007097
369 Ga0207647_10020070
370 Ga0207699_10199080
371 Ga0207705_10374877
372 Ga0207684_10922364
373 Ga0207671_10744675
374 Ga0207657_10024696
375 Ga0207649_10006298
376 Ga0207659_10101510
377 Ga0207687_10064887
378 Ga0207687_10085515
379 Ga0207690_10052033
380 Ga0207709_10083887
381 Ga0207704_10298210
382 Ga0207691_10455984
383 Ga0207689_10173308
384 Ga0207689_10284074
385 Ga0207661_10016638
386 Ga0207661_10254237
387 Ga0207679_10016115
388 Ga0207679_10084292
389 Ga0207679_10131551
390 Ga0207679_10524232
391 Ga0207712_10548097
392 Ga0207668_10001735
393 Ga0207640_10145445
394 Ga0207658_10097640
395 Ga0207677_10321454
396 Ga0207703_10381144
397 Ga0207678_10075684
398 Ga0207708_10007431
399 Ga0207702_10832681
400 Ga0207641_10816175
401 Ga0207648_10297501
402 Ga0207676_10338175
403 Ga0207674_10132506
404 Ga0207674_10500533
405 Ga0207675_100310341
406 Ga0207698_10685213
407 Ga0268266_10606525
408 Ga0268265_10019884
409 Ga0268265_10223245
410 Ga0268264_10727713
411 Ga0307512_10135416
412 Ga0265328_10019808
413 Ga0307509_10008625
414 Ga0307408_100575955
415 Ga0307508_10006134
416 Ga0307516_10687973
417 Ga0307405_10087424
418 Ga0307405_10426928
419 Ga0307405_10530847
420 Ga0307413_10066239
421 Ga0307413_10432485
422 Ga0307413_10838724
423 Ga0307406_10054717
424 Ga0307406_10181500
425 Ga0307406_10255725
426 Ga0307406_10260403
427 Ga0307407_10343148
428 Ga0307412_11171765
429 Ga0307409_100181884
430 Ga0307409_100203258
431 Ga0307416_100608872
432 Ga0307416_102257814
433 Ga0307415_100107968
434 Ga0307415_100135906
435 Ga0307415_100220795
436 Ga0307415_100285269
437 Ga0307415_100860348
438 Ga0307507_10051653
439 Ga0373939_0064618
440 Ga0373931_0909682
441 Ga0373935_0140809
442 Ga0395899_0086006
443 Ga0395900_0042844
444 Ga0395900_0747928
445 Ga0395898_0009742
446 Ga0395905_0004526
447 Ga0395901_0015200
448 Ga0451853_1586819
449 Ga0466965_0004595
450 Ga0466965_0051815
451 Ga0466961_0407277
452 Ga0466960_0058240
453 Ga0466958_0710772
454 Ga0495641_0032542
455 Ga0495653_0420581
456 Ga0495594_0069971
457 Ga0495606_0014626
458 Ga0495620_0171550
459 Ga0495668_0000642
460 Ga0495625_0001727
461 Ga0495670_0214431
462 Ga0495680_0446043
463 Ga0495680_0760012
464 Ga0495686_0265770
465 Ga0495686_0315363
466 Ga0495626_0000455
467 Ga0496101_0047605
468 Ga0496104_0045134
469 Ga0496105_0562297
470 Ga0496108_0000089
471 Ga0496108_0044119
472 Ga0496108_0333706
473 Ga0496109_0008048
474 Ga0496109_0033038
475 Ga0496110_0006285
476 Ga0496110_0436225
477 Ga0496111_0001806
478 Ga0496111_0071764
479 Ga0496112_0051129
480 Ga0496112_0330927
481 Ga0496113_0190911
482 Ga0496113_1020465
483 Ga0496114_0175888
484 Ga0496114_0335703
485 Ga0496114_0542209
486 Ga0496119_0174173
487 Ga0501031_0060608
488 Ga0501032_0077964
489 Ga0501036_0259768
490 Ga0501037_0104257
491 Ga0501038_0396695
492 Ga0501040_0018903
493 Ga0501040_0247737
494 Ga0501042_0094313
495 Ga0501042_0959626
496 Ga0501046_0117938
497 Ga0501048_0296927
498 Ga0501048_0322998
499 Ga0501070_0576867
500 Ga0501071_0314607
501 Ga0501072_0047119
502 Ga0501074_0034782
503 Ga0501075_0230945
504 Ga0501075_0265340
505 Ga0501075_0483765
506 Ga0501076_0019750
507 Ga0501076_0415857
508 Ga0501077_0081419
509 Ga0501077_0456852
510 Ga0501081_0197404
511 Ga0501081_0778164
512 Ga0501081_0908865
513 Ga0501035_0280325
514 Ga0501045_0039625
515 Ga0501045_0312907
516 nmdc:mga05p37_1431176_c1
517 nmdc:mga05p37_149555_c2
518 nmdc:mga09592_25825_c1
519 nmdc:mga09592_333984_c2
520 nmdc:mga0qj67_44936_c1
521 nmdc:mga06r32_12329_c1
522 nmdc:mga06r32_1284575_c1
523 nmdc:mga06r32_1379441_c1
524 nmdc:mga06r32_286017_c1
525 nmdc:mga06r32_61568_c1
526 nmdc:mga06r32_758616_c1
527 nmdc:mga08y16_1230250_c1
528 nmdc:mga08y16_63857_c1
529 Ga0500643_001107
530 Ga0500630_216807
531 Ga0501084_0041531
532 Ga0501084_0752450
533 Ga0501082_0212241
534 Ga0501082_1305819
535 Ga0530510_0022615
536 Ga0530510_0249431
537 Ga0530510_0668127
538 Ga0530510_0769877
539 2516084580
540 2501943513
541 2515498110
542 2515720363
543 2515759217
544 2516090956
545 2623585406
546 2643827760
547 2644035210
548 2644532472
549 2738867625
550 2772645317
551 2831939532
552 2832005799
553 2855675865
554 2855677204
555 2855687899
556 2856859322
557 2857291459
558 2858850238
559 2858872636
560 2858884740
561 2858893307
562 2858900357
563 2858902617
564 2866068824
565 2867306341
566 2867317148
567 2867322970
568 2867510569
569 2868092827
570 2869048756
571 2869064338
572 2869072202
573 2880494813
574 2880497501
575 2887485701
576 2902584372
577 2929226064
578 2929232729
579 2984579703
580 2990257309
581 2996228183
582 649812814
583 8001783105
584 8003833315
585 8003861258
586 8003872521
587 8054704180
588 8054732351
589 8054739314
590 8055418437

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13740

ACT_6

ACT domain

124

198

0.95

PF13740

ACT_6

ACT domain

37

110

0.85

PF01842

ACT

ACT domain

125

189

0.83

PF01842

ACT

ACT domain

40

101

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nrb-assembly1.cif.gz_B crystal structure of a formyltetrahydrofolate deformylase (puru, pp_1943) from pseudomonas putida kt2440 at 2.05 a resolution 0.8733 3 77
3n0v-assembly1.cif.gz_C crystal structure of a formyltetrahydrofolate deformylase (pp_0327) from pseudomonas putida kt2440 at 2.25 a resolution 0.8656 89 166
3n0v-assembly1.cif.gz_B crystal structure of a formyltetrahydrofolate deformylase (pp_0327) from pseudomonas putida kt2440 at 2.25 a resolution 0.865 89 166
3nrb-assembly1.cif.gz_C crystal structure of a formyltetrahydrofolate deformylase (puru, pp_1943) from pseudomonas putida kt2440 at 2.05 a resolution 0.861 3 76
3n0v-assembly1.cif.gz_D crystal structure of a formyltetrahydrofolate deformylase (pp_0327) from pseudomonas putida kt2440 at 2.25 a resolution 0.86 89 166
ID Description Score Start End Superfamily
af_I1M9H5_373_429_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9587 5 50 3.30.70.260
af_K7N190_5_82_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9556 5 50 3.90.550.10
af_O49285_36_92_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9259 5 52 3.30.70.260
af_A0A1D6F177_170_222_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.92 5 51 3.30.70.260
af_Q57693_77_143_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9129 5 64 3.30.70.260
ID Description Score Start End GO Terms
AF-A0A7X7SK47-F1-model_v4 UPF0237 protein GX537_03705 0.9231 2 77
AF-A0A0R2KSW5-F1-model_v4 UPF0237 protein IV53_GL000149 0.9221 90 168
AF-A0A2P8GRS0-F1-model_v4 Formyltetrahydrofolate deformylase (EC 3.5.1.10) (Formyl-FH(4) hydrolase) 0.9214 2 78 GO:0006189
GO:0006730
GO:0008864
AF-W4TYB8-F1-model_v4 deleted 0.9209 2 78
AF-A0A1B2IPT4-F1-model_v4 deleted 0.9151 90 164

Map