F392899
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 295 | 195 | 286 | 111 |
Family's Representative Sequence
| Representative Sequence | 3300053140|Ga0500573_0105812|Ga0500573_0105812_780_1124 |
| Length | 114 |
| Sequence | MTPTSSGAEAQLRKGVVEFAILALLKTEPMYGWQLSQELIERGGFIASIGTLYPVLSRLRAKGWVSTYDEASDAGPARRYYRLTASGTESLADFTSQWEVFSDSLTSLLKETAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221649 | Leifsonia sp. Root4 | Isolate | Unclassified |
| 2 | 2747842429 | Microbacterium sp. WCS2014-259 | Isolate | Unclassified |
| 3 | 2852646457 | Microbacterium sp. AK031 | Isolate | Rhizosphere |
| 4 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 5 | 2857723135 | Microbacterium sp. R-72356 | Isolate | Unclassified |
| 6 | 2870622029 | Conyzicola lurida DSM 105784 | Isolate | Unclassified |
| 7 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 8 | 2945968032 | Microbacterium murale W2I7 | Isolate | Rhizosphere |
| 9 | 2946033335 | Microbacterium sp. W4I4 | Isolate | Rhizosphere |
| 10 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 11 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 12 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 13 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 14 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 15 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 16 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 53 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 54 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 55 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 56 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 57 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 58 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 59 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 77 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 78 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 110 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 112 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 113 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 114 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 115 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 116 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 117 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 118 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 119 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 120 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 121 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 122 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 123 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 124 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 125 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 126 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 127 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 128 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 129 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 130 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 131 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 132 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 133 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 134 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 135 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 136 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 137 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 138 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 139 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 140 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 141 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 142 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 143 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 144 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 145 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 146 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 147 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 148 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 149 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 150 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 151 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 152 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 153 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 154 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 166 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 167 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 168 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 169 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 170 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 171 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 172 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 173 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 174 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 175 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 176 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 180 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 181 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 182 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 183 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 184 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 185 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 186 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 187 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 188 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 189 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 190 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 191 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 192 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 193 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 194 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 195 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.61 |
| Metatranscriptomes | 0.34 |
| Isolates | 3.05 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.25 |
| Nodule | 0.34 |
| Rhizoplane | 2.03 |
| Rhizosphere | 72.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.49 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1008580 | 3300001915 | Bacteria | 1921 |
| 2 | JGI24740J21852_10009763 | 3300001979 | Bacteria | 3735 |
| 3 | JGI24739J22299_10049746 | 3300001989 | Bacteria | 1358 |
| 4 | JGI24737J22298_10037530 | 3300001990 | Bacteria | 1493 |
| 5 | JGI24735J21928_10007523 | 3300002067 | Bacteria | 3550 |
| 6 | JGI24735J21928_10018443 | 3300002067 | Unclassified | 2151 |
| 7 | JGI24735J21928_10059889 | 3300002067 | Bacteria | 1094 |
| 8 | JGI24738J21930_10086012 | 3300002075 | Unclassified | 661 |
| 9 | Ga0055536_1008709 | 3300003781 | Bacteria | 4312 |
| 10 | Ga0055530_10026397 | 3300003791 | Bacteria | 1607 |
| 11 | Ga0055531_10000291 | 3300003794 | Bacteria | 50096 |
| 12 | Ga0065165_1001694 | 3300005262 | Bacteria | 22214 |
| 13 | Ga0070658_10038624 | 3300005327 | Bacteria | 3849 |
| 14 | Ga0070658_10079799 | 3300005327 | Bacteria | 2688 |
| 15 | Ga0070658_10250236 | 3300005327 | Unclassified | 1503 |
| 16 | Ga0070658_10358579 | 3300005327 | Bacteria | 1248 |
| 17 | Ga0070658_10619283 | 3300005327 | Bacteria | 938 |
| 18 | Ga0070658_10629562 | 3300005327 | Unclassified | 930 |
| 19 | Ga0070658_10699969 | 3300005327 | Bacteria | 879 |
| 20 | Ga0070690_100967956 | 3300005330 | Bacteria | 669 |
| 21 | Ga0070670_100274239 | 3300005331 | Bacteria | 1472 |
| 22 | Ga0070682_100302988 | 3300005337 | Bacteria | 1173 |
| 23 | Ga0070682_100669828 | 3300005337 | Unclassified | 828 |
| 24 | Ga0070682_100923989 | 3300005337 | Bacteria | 719 |
| 25 | Ga0070660_100040508 | 3300005339 | Bacteria | 3545 |
| 26 | Ga0070660_100070826 | 3300005339 | Bacteria | 2721 |
| 27 | Ga0070660_100296233 | 3300005339 | Bacteria | 1325 |
| 28 | Ga0070660_100363576 | 3300005339 | Bacteria | 1193 |
| 29 | Ga0070660_100943068 | 3300005339 | Bacteria | 728 |
| 30 | Ga0070661_100463103 | 3300005344 | Bacteria | 1010 |
| 31 | Ga0070661_100486023 | 3300005344 | Bacteria | 987 |
| 32 | Ga0070669_100433829 | 3300005353 | Bacteria | 1080 |
| 33 | Ga0070673_101871299 | 3300005364 | Bacteria | 569 |
| 34 | Ga0070659_100050290 | 3300005366 | Bacteria | 3277 |
| 35 | Ga0070659_100064948 | 3300005366 | Bacteria | 2890 |
| 36 | Ga0070659_100286949 | 3300005366 | Bacteria | 1370 |
| 37 | Ga0070667_101278109 | 3300005367 | Bacteria | 687 |
| 38 | Ga0070713_100945196 | 3300005436 | Bacteria | 830 |
| 39 | Ga0070713_101490816 | 3300005436 | Bacteria | 656 |
| 40 | Ga0070700_101300996 | 3300005441 | Bacteria | 611 |
| 41 | Ga0070663_100138343 | 3300005455 | Bacteria | 1856 |
| 42 | Ga0070663_100251231 | 3300005455 | Bacteria | 1399 |
| 43 | Ga0070663_100374212 | 3300005455 | Bacteria | 1158 |
| 44 | Ga0070678_102198296 | 3300005456 | Bacteria | 523 |
| 45 | Ga0070662_100069992 | 3300005457 | Bacteria | 2584 |
| 46 | Ga0070681_10512975 | 3300005458 | Bacteria | 1112 |
| 47 | Ga0070681_11221556 | 3300005458 | Bacteria | 674 |
| 48 | Ga0068867_102335313 | 3300005459 | Bacteria | 508 |
| 49 | Ga0070679_100273515 | 3300005530 | Bacteria | 1643 |
| 50 | Ga0070679_100988355 | 3300005530 | Bacteria | 785 |
| 51 | Ga0070679_101697354 | 3300005530 | Bacteria | 579 |
| 52 | Ga0070684_100147152 | 3300005535 | Bacteria | 2133 |
| 53 | Ga0068853_100142209 | 3300005539 | Bacteria | 2154 |
| 54 | Ga0068853_101151082 | 3300005539 | Bacteria | 749 |
| 55 | Ga0070672_100293127 | 3300005543 | Bacteria | 1378 |
| 56 | Ga0070686_100000071 | 3300005544 | Bacteria | 76738 |
| 57 | Ga0070696_100965869 | 3300005546 | Bacteria | 710 |
| 58 | Ga0070665_100000011 | 3300005548 | Bacteria | 525539 |
| 59 | Ga0070665_101634914 | 3300005548 | Unclassified | 652 |
| 60 | Ga0068855_100186853 | 3300005563 | Bacteria | 2340 |
| 61 | Ga0068855_100333288 | 3300005563 | Bacteria | 1675 |
| 62 | Ga0068855_100926674 | 3300005563 | Bacteria | 919 |
| 63 | Ga0070664_100648140 | 3300005564 | Bacteria | 981 |
| 64 | Ga0068857_100327152 | 3300005577 | Bacteria | 1416 |
| 65 | Ga0068857_101698123 | 3300005577 | Bacteria | 617 |
| 66 | Ga0068857_102014749 | 3300005577 | Bacteria | 566 |
| 67 | Ga0068854_100494970 | 3300005578 | Bacteria | 1028 |
| 68 | Ga0068854_102082660 | 3300005578 | Bacteria | 524 |
| 69 | Ga0068856_100685816 | 3300005614 | Bacteria | 1045 |
| 70 | Ga0068852_100154207 | 3300005616 | Bacteria | 2138 |
| 71 | Ga0068863_100090062 | 3300005841 | Bacteria | 2909 |
| 72 | Ga0068862_101839332 | 3300005844 | Bacteria | 615 |
| 73 | Ga0075365_11138347 | 3300006038 | Bacteria | 549 |
| 74 | Ga0075364_10016020 | 3300006051 | Bacteria | 4656 |
| 75 | Ga0075364_10488519 | 3300006051 | Bacteria | 842 |
| 76 | Ga0075362_10458699 | 3300006177 | Bacteria | 648 |
| 77 | Ga0075369_10001552 | 3300006186 | Bacteria | 7877 |
| 78 | Ga0075366_10307048 | 3300006195 | Bacteria | 971 |
| 79 | Ga0075370_10175410 | 3300006353 | Bacteria | 1261 |
| 80 | Ga0075370_10324700 | 3300006353 | Bacteria | 917 |
| 81 | Ga0068871_100576782 | 3300006358 | Bacteria | 1021 |
| 82 | Ga0105240_11672775 | 3300009093 | Bacteria | 665 |
| 83 | Ga0105245_10776289 | 3300009098 | Bacteria | 995 |
| 84 | Ga0105243_10540264 | 3300009148 | Bacteria | 1112 |
| 85 | Ga0105242_10850613 | 3300009176 | Bacteria | 908 |
| 86 | Ga0105238_10147817 | 3300009551 | Bacteria | 2326 |
| 87 | Ga0105238_10668922 | 3300009551 | Bacteria | 1049 |
| 88 | Ga0105246_11625212 | 3300011119 | Bacteria | 611 |
| 89 | Ga0157373_10050371 | 3300013100 | Bacteria | 2966 |
| 90 | Ga0157373_11045507 | 3300013100 | Bacteria | 611 |
| 91 | Ga0157371_10169783 | 3300013102 | Bacteria | 1558 |
| 92 | Ga0157371_10290702 | 3300013102 | Bacteria | 1182 |
| 93 | Ga0157371_10790050 | 3300013102 | Bacteria | 715 |
| 94 | Ga0157370_10659530 | 3300013104 | Bacteria | 956 |
| 95 | Ga0157370_11130779 | 3300013104 | Unclassified | 707 |
| 96 | Ga0157369_10706482 | 3300013105 | Bacteria | 1038 |
| 97 | Ga0157369_10725802 | 3300013105 | Bacteria | 1023 |
| 98 | Ga0157374_10663348 | 3300013296 | Bacteria | 1055 |
| 99 | Ga0157378_10050047 | 3300013297 | Bacteria | 3718 |
| 100 | Ga0157378_10064493 | 3300013297 | Bacteria | 3277 |
| 101 | Ga0157378_10431064 | 3300013297 | Bacteria | 1305 |
| 102 | Ga0163162_12204078 | 3300013306 | Bacteria | 632 |
| 103 | Ga0157372_10093647 | 3300013307 | Bacteria | 3419 |
| 104 | Ga0157372_10160850 | 3300013307 | Bacteria | 2595 |
| 105 | Ga0157372_10256413 | 3300013307 | Bacteria | 2030 |
| 106 | Ga0157372_10374016 | 3300013307 | Bacteria | 1660 |
| 107 | Ga0157372_10685277 | 3300013307 | Unclassified | 1193 |
| 108 | Ga0157372_11637800 | 3300013307 | Bacteria | 741 |
| 109 | Ga0157375_13401230 | 3300013308 | Bacteria | 530 |
| 110 | Ga0163163_10337597 | 3300014325 | Bacteria | 1562 |
| 111 | Ga0163163_11303242 | 3300014325 | Bacteria | 788 |
| 112 | Ga0157377_11292200 | 3300014745 | Bacteria | 570 |
| 113 | Ga0206356_10025658 | 3300020070 | Bacteria | 3677 |
| 114 | Ga0213876_10003843 | 3300021384 | Bacteria | 8512 |
| 115 | Ga0209676_1000282 | 3300025292 | Bacteria | 105777 |
| 116 | Ga0209050_1001335 | 3300025298 | Bacteria | 27398 |
| 117 | Ga0207426_1109898 | 3300025302 | Bacteria | 697 |
| 118 | Ga0209257_1002477 | 3300025304 | Bacteria | 18257 |
| 119 | Ga0207682_10391440 | 3300025893 | Bacteria | 657 |
| 120 | Ga0207647_10115239 | 3300025904 | Bacteria | 1587 |
| 121 | Ga0207647_10231026 | 3300025904 | Bacteria | 1064 |
| 122 | Ga0207705_10048091 | 3300025909 | Bacteria | 3068 |
| 123 | Ga0207705_10199908 | 3300025909 | Bacteria | 1514 |
| 124 | Ga0207705_10282589 | 3300025909 | Bacteria | 1271 |
| 125 | Ga0207705_10427279 | 3300025909 | Bacteria | 1026 |
| 126 | Ga0207705_10457183 | 3300025909 | Bacteria | 990 |
| 127 | Ga0207705_10746834 | 3300025909 | Bacteria | 760 |
| 128 | Ga0207705_11160894 | 3300025909 | Bacteria | 593 |
| 129 | Ga0207707_10416249 | 3300025912 | Bacteria | 1153 |
| 130 | Ga0207695_10308975 | 3300025913 | Bacteria | 1471 |
| 131 | Ga0207660_10061663 | 3300025917 | Bacteria | 2699 |
| 132 | Ga0207660_11191444 | 3300025917 | Bacteria | 620 |
| 133 | Ga0207662_10244398 | 3300025918 | Bacteria | 1176 |
| 134 | Ga0207657_10129440 | 3300025919 | Bacteria | 2070 |
| 135 | Ga0207657_10697079 | 3300025919 | Bacteria | 789 |
| 136 | Ga0207649_10162225 | 3300025920 | Bacteria | 1550 |
| 137 | Ga0207649_10195504 | 3300025920 | Bacteria | 1425 |
| 138 | Ga0207652_10052569 | 3300025921 | Bacteria | 3497 |
| 139 | Ga0207664_10290798 | 3300025929 | Bacteria | 1436 |
| 140 | Ga0207690_10023281 | 3300025932 | Bacteria | 3864 |
| 141 | Ga0207690_10073791 | 3300025932 | Bacteria | 2361 |
| 142 | Ga0207690_10144785 | 3300025932 | Bacteria | 1755 |
| 143 | Ga0207690_10765783 | 3300025932 | Unclassified | 796 |
| 144 | Ga0207706_10005173 | 3300025933 | Bacteria | 12176 |
| 145 | Ga0207706_11553004 | 3300025933 | Unclassified | 538 |
| 146 | Ga0207686_10005543 | 3300025934 | Bacteria | 6766 |
| 147 | Ga0207689_10268527 | 3300025942 | Bacteria | 1412 |
| 148 | Ga0207661_10132070 | 3300025944 | Bacteria | 2140 |
| 149 | Ga0207661_10538702 | 3300025944 | Bacteria | 1069 |
| 150 | Ga0207661_11003668 | 3300025944 | Bacteria | 769 |
| 151 | Ga0207661_12108828 | 3300025944 | Bacteria | 510 |
| 152 | Ga0207679_10116039 | 3300025945 | Bacteria | 2122 |
| 153 | Ga0207667_10117329 | 3300025949 | Bacteria | 2743 |
| 154 | Ga0207667_10340872 | 3300025949 | Bacteria | 1530 |
| 155 | Ga0207667_11011156 | 3300025949 | Bacteria | 818 |
| 156 | Ga0207640_11917677 | 3300025981 | Bacteria | 536 |
| 157 | Ga0207658_11697943 | 3300025986 | Bacteria | 577 |
| 158 | Ga0207703_11687115 | 3300026035 | Bacteria | 609 |
| 159 | Ga0207639_10095202 | 3300026041 | Bacteria | 2392 |
| 160 | Ga0207639_10734988 | 3300026041 | Bacteria | 917 |
| 161 | Ga0207639_10831851 | 3300026041 | Bacteria | 861 |
| 162 | Ga0207678_10025172 | 3300026067 | Bacteria | 5196 |
| 163 | Ga0207678_10149450 | 3300026067 | Bacteria | 1994 |
| 164 | Ga0207678_10171872 | 3300026067 | Bacteria | 1850 |
| 165 | Ga0207708_11595477 | 3300026075 | Bacteria | 573 |
| 166 | Ga0207641_10098653 | 3300026088 | Bacteria | 2569 |
| 167 | Ga0207674_10030183 | 3300026116 | Bacteria | 5702 |
| 168 | Ga0207698_10084136 | 3300026142 | Bacteria | 2578 |
| 169 | Ga0209281_1020130 | 3300027111 | Bacteria | 1308 |
| 170 | Ga0268266_10000063 | 3300028379 | Bacteria | 253339 |
| 171 | Ga0268266_11089599 | 3300028379 | Bacteria | 773 |
| 172 | Ga0265338_10237422 | 3300028800 | Bacteria | 1352 |
| 173 | Ga0316177_1114600 | 3300030731 | Bacteria | 1577 |
| 174 | Ga0307408_100846526 | 3300031548 | Unclassified | 833 |
| 175 | Ga0307514_10003692 | 3300031649 | Bacteria | 14475 |
| 176 | Ga0307413_10014005 | 3300031824 | Bacteria | 4056 |
| 177 | Ga0307410_10399927 | 3300031852 | Bacteria | 1109 |
| 178 | Ga0307407_11159696 | 3300031903 | Bacteria | 602 |
| 179 | Ga0307412_11285683 | 3300031911 | Bacteria | 658 |
| 180 | Ga0307409_100726941 | 3300031995 | Bacteria | 994 |
| 181 | Ga0307409_101440275 | 3300031995 | Bacteria | 716 |
| 182 | Ga0307414_10026615 | 3300032004 | Bacteria | 3725 |
| 183 | Ga0307414_10484013 | 3300032004 | Bacteria | 1092 |
| 184 | Ga0307414_11382214 | 3300032004 | Bacteria | 654 |
| 185 | Ga0307411_10826999 | 3300032005 | Unclassified | 817 |
| 186 | Ga0307411_11964711 | 3300032005 | Bacteria | 545 |
| 187 | Ga0307415_101339893 | 3300032126 | Bacteria | 679 |
| 188 | Ga0373923_0009702 | 3300035111 | Bacteria | 3482 |
| 189 | Ga0373953_0173284 | 3300035117 | Bacteria | 929 |
| 190 | Ga0373954_0011576 | 3300035118 | Bacteria | 3912 |
| 191 | Ga0373956_0082430 | 3300035119 | Bacteria | 1477 |
| 192 | Ga0373957_0077268 | 3300035120 | Bacteria | 1309 |
| 193 | Ga0373955_0002880 | 3300035172 | Bacteria | 7544 |
| 194 | Ga0373933_0089238 | 3300035724 | Bacteria | 1900 |
| 195 | Ga0373933_1101384 | 3300035724 | Bacteria | 523 |
| 196 | Ga0373937_0017988 | 3300036401 | Bacteria | 6304 |
| 197 | Ga0395900_0903122 | 3300037418 | Bacteria | 807 |
| 198 | Ga0395900_1691397 | 3300037418 | Bacteria | 544 |
| 199 | Ga0395905_0003027 | 3300037471 | Bacteria | 18208 |
| 200 | Ga0395905_0536506 | 3300037471 | Bacteria | 1071 |
| 201 | Ga0395905_0822524 | 3300037471 | Bacteria | 832 |
| 202 | Ga0395901_0072396 | 3300038443 | Bacteria | 3593 |
| 203 | Ga0436365_0257345 | 3300039437 | Bacteria | 14502 |
| 204 | Ga0436365_0326668 | 3300039437 | Bacteria | 1077 |
| 205 | Ga0436363_0729632 | 3300039450 | Bacteria | 502 |
| 206 | Ga0436362_0514603 | 3300039453 | Bacteria | 666 |
| 207 | Ga0439436_0040786 | 3300041404 | Bacteria | 1330 |
| 208 | Ga0439438_101091 | 3300041405 | Bacteria | 699 |
| 209 | Ga0451789_1034719 | 3300041443 | Unclassified | 570 |
| 210 | Ga0451797_0370476 | 3300041453 | Unclassified | 622 |
| 211 | Ga0451797_0708961 | 3300041453 | Bacteria | 692 |
| 212 | Ga0451837_0111527 | 3300041494 | Bacteria | 762 |
| 213 | Ga0451841_1179381 | 3300041498 | Bacteria | 759 |
| 214 | Ga0439437_037171 | 3300042000 | Bacteria | 625 |
| 215 | Ga0439452_061057 | 3300042010 | Bacteria | 844 |
| 216 | Ga0450923_005367 | 3300042125 | Unclassified | 2065 |
| 217 | Ga0450892_010449 | 3300042130 | Bacteria | 813 |
| 218 | Ga0450894_036760 | 3300042131 | Bacteria | 696 |
| 219 | Ga0450889_040652 | 3300042144 | Bacteria | 561 |
| 220 | Ga0439434_0033802 | 3300042435 | Bacteria | 1560 |
| 221 | Ga0466972_0222638 | 3300044658 | Bacteria | 883 |
| 222 | Ga0466963_0023091 | 3300044694 | Bacteria | 3944 |
| 223 | Ga0466957_1348563 | 3300044842 | Unclassified | 518 |
| 224 | Ga0466960_0159235 | 3300044901 | Bacteria | 1211 |
| 225 | Ga0495627_018068 | 3300046453 | Bacteria | 2386 |
| 226 | Ga0495663_0189531 | 3300046525 | Bacteria | 715 |
| 227 | Ga0495642_0006165 | 3300046528 | Bacteria | 4602 |
| 228 | Ga0495668_0395301 | 3300046616 | Unclassified | 759 |
| 229 | Ga0495625_0009232 | 3300046660 | Bacteria | 8279 |
| 230 | Ga0495670_0579357 | 3300046691 | Unclassified | 611 |
| 231 | Ga0495649_0001783 | 3300046694 | Bacteria | 15865 |
| 232 | Ga0495636_0147682 | 3300047318 | Bacteria | 1053 |
| 233 | Ga0495681_0055414 | 3300047470 | Bacteria | 1849 |
| 234 | Ga0495686_0000600 | 3300047472 | Bacteria | 50240 |
| 235 | Ga0495602_0090620 | 3300048088 | Bacteria | 2539 |
| 236 | Ga0496101_0803302 | 3300048904 | Bacteria | 742 |
| 237 | Ga0496107_0547474 | 3300048910 | Bacteria | 857 |
| 238 | Ga0496114_0315462 | 3300048917 | Bacteria | 1381 |
| 239 | Ga0496117_0020589 | 3300048920 | Bacteria | 5372 |
| 240 | Ga0496118_0087773 | 3300048921 | Bacteria | 2155 |
| 241 | Ga0496119_0066218 | 3300048922 | Bacteria | 2136 |
| 242 | Ga0496122_0046726 | 3300048925 | Bacteria | 3349 |
| 243 | Ga0496122_0074460 | 3300048925 | Bacteria | 2402 |
| 244 | Ga0496122_0301897 | 3300048925 | Bacteria | 863 |
| 245 | Ga0496123_0302700 | 3300048926 | Bacteria | 762 |
| 246 | Ga0496124_0409490 | 3300048927 | Bacteria | 938 |
| 247 | Ga0496125_0008401 | 3300048928 | Bacteria | 10816 |
| 248 | Ga0496125_0013833 | 3300048928 | Bacteria | 7903 |
| 249 | Ga0496125_0016754 | 3300048928 | Bacteria | 7026 |
| 250 | Ga0496125_0147638 | 3300048928 | Bacteria | 1622 |
| 251 | Ga0496125_0691081 | 3300048928 | Bacteria | 543 |
| 252 | Ga0496126_0064704 | 3300048929 | Bacteria | 3275 |
| 253 | Ga0496126_0267489 | 3300048929 | Bacteria | 1420 |
| 254 | Ga0496126_0790501 | 3300048929 | Bacteria | 729 |
| 255 | Ga0501032_0162694 | 3300049569 | Bacteria | 1465 |
| 256 | Ga0501038_0154169 | 3300049574 | Bacteria | 1871 |
| 257 | Ga0501083_0611537 | 3300049744 | Bacteria | 709 |
| 258 | nmdc:mga00v17_3411_c1 | 3300050491 | Bacteria | 8211 |
| 259 | nmdc:mga00v17_73703_c1 | 3300050491 | Bacteria | 2120 |
| 260 | nmdc:mga0k408_852361_c1 | 3300050493 | Unclassified | 530 |
| 261 | nmdc:mga07m45_164192_c1 | 3300050496 | Bacteria | 1290 |
| 262 | nmdc:mga07m45_598288_c1 | 3300050496 | Bacteria | 637 |
| 263 | nmdc:mga0sz30_9642_c1 | 3300050516 | Bacteria | 3680 |
| 264 | Ga0500643_010520 | 3300053087 | Bacteria | 3434 |
| 265 | Ga0500583_0135666 | 3300053092 | Bacteria | 1222 |
| 266 | Ga0500651_0003564 | 3300053093 | Bacteria | 8527 |
| 267 | Ga0500650_0032361 | 3300053098 | Bacteria | 2382 |
| 268 | Ga0500556_0000027 | 3300053104 | Bacteria | 165855 |
| 269 | Ga0500557_055871 | 3300053105 | Bacteria | 1274 |
| 270 | Ga0500562_010256 | 3300053108 | Bacteria | 2373 |
| 271 | Ga0500642_0000003 | 3300053130 | Bacteria | 544899 |
| 272 | Ga0500559_0000159 | 3300053136 | Bacteria | 53218 |
| 273 | Ga0500559_0037402 | 3300053136 | Bacteria | 2104 |
| 274 | Ga0500559_0369821 | 3300053136 | Bacteria | 669 |
| 275 | Ga0500573_0004009 | 3300053140 | Bacteria | 7695 |
| 276 | Ga0500573_0019759 | 3300053140 | Bacteria | 3855 |
| 277 | Ga0500573_0105812 | 3300053140 | Bacteria | 1579 |
| 278 | Ga0500573_0144700 | 3300053140 | Bacteria | 1306 |
| 279 | Ga0500573_0153733 | 3300053140 | Bacteria | 1257 |
| 280 | Ga0500573_0308620 | 3300053140 | Bacteria | 787 |
| 281 | Ga0500573_0339435 | 3300053140 | Bacteria | 734 |
| 282 | Ga0500573_0368594 | 3300053140 | Bacteria | 691 |
| 283 | Ga0500577_0241101 | 3300053142 | Bacteria | 785 |
| 284 | Ga0500577_0320029 | 3300053142 | Bacteria | 677 |
| 285 | Ga0500604_0153146 | 3300053151 | Bacteria | 783 |
| 286 | Ga0500627_0300688 | 3300053158 | Bacteria | 700 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044658 | Ga0466972_0222638 | Ga0466972_0222638_580_873 | 93 |
| 2 | 3300006051 | Ga0075364_10016020 | Ga0075364_100160207 | 98 |
| 3 | 3300006353 | Ga0075370_10324700 | Ga0075370_103247002 | 98 |
| 4 | 3300031911 | Ga0307412_11285683 | Ga0307412_112856832 | 98 |
| 5 | 3300032004 | Ga0307414_11382214 | Ga0307414_113822142 | 98 |
| 6 | 3300049574 | Ga0501038_0154169 | Ga0501038_0154169_385_693 | 98 |
| 7 | 3300009093 | Ga0105240_11672775 | Ga0105240_116727751 | 99 |
| 8 | 3300013297 | Ga0157378_10050047 | Ga0157378_100500474 | 99 |
| 9 | iso_pu_bacteria | 2643221649 | 2644278253 | 102 |
| 10 | iso_pu_bacteria | 2747842429 | 2747952555 | 102 |
| 11 | iso_pu_bacteria | 2852646457 | 2852647606 | 102 |
| 12 | iso_pu_bacteria | 2857723135 | 2857725851 | 102 |
| 13 | iso_pu_bacteria | 2870622029 | 2870624543 | 102 |
| 14 | iso_pu_bacteria | 2945968032 | 2945968772 | 102 |
| 15 | iso_pu_bacteria | 2946033335 | 2946036555 | 102 |
| 16 | 3300003781 | Ga0055536_1008709 | Ga0055536_10087091 | 103 |
| 17 | 3300003791 | Ga0055530_10026397 | Ga0055530_100263971 | 103 |
| 18 | 3300003794 | Ga0055531_10000291 | Ga0055531_1000029124 | 103 |
| 19 | 3300025292 | Ga0209676_1000282 | Ga0209676_10002825 | 103 |
| 20 | 3300025298 | Ga0209050_1001335 | Ga0209050_100133528 | 103 |
| 21 | 3300025304 | Ga0209257_1002477 | Ga0209257_10024773 | 103 |
| 22 | 3300006051 | Ga0075364_10488519 | Ga0075364_104885191 | 105 |
| 23 | iso_pu_bacteria | 2857504554 | 2857507262 | 105 |
| 24 | iso_pu_bacteria | 2928531327 | 2928533354 | 105 |
| 25 | 3300005339 | Ga0070660_100040508 | Ga0070660_1000405083 | 106 |
| 26 | 3300005366 | Ga0070659_100050290 | Ga0070659_1000502902 | 106 |
| 27 | 3300005563 | Ga0068855_100333288 | Ga0068855_1003332882 | 106 |
| 28 | 3300013104 | Ga0157370_10659530 | Ga0157370_106595302 | 106 |
| 29 | 3300013306 | Ga0163162_12204078 | Ga0163162_122040782 | 106 |
| 30 | 3300025932 | Ga0207690_10073791 | Ga0207690_100737913 | 106 |
| 31 | 3300025949 | Ga0207667_10340872 | Ga0207667_103408722 | 106 |
| 32 | 3300031995 | Ga0307409_101440275 | Ga0307409_1014402751 | 106 |
| 33 | 3300032004 | Ga0307414_10484013 | Ga0307414_104840132 | 106 |
| 34 | 3300041443 | Ga0451789_1034719 | Ga0451789_1034719_219_554 | 106 |
| 35 | 3300041453 | Ga0451797_0370476 | Ga0451797_0370476_237_572 | 106 |
| 36 | 3300041453 | Ga0451797_0708961 | Ga0451797_0708961_67_399 | 106 |
| 37 | 3300041494 | Ga0451837_0111527 | Ga0451837_0111527_333_659 | 106 |
| 38 | 3300041498 | Ga0451841_1179381 | Ga0451841_1179381_114_446 | 106 |
| 39 | 3300044901 | Ga0466960_0159235 | Ga0466960_0159235_146_478 | 106 |
| 40 | 3300046691 | Ga0495670_0579357 | Ga0495670_0579357_53_388 | 106 |
| 41 | 3300048910 | Ga0496107_0547474 | Ga0496107_0547474_129_455 | 106 |
| 42 | 3300048920 | Ga0496117_0020589 | Ga0496117_0020589_377_703 | 106 |
| 43 | 3300048921 | Ga0496118_0087773 | Ga0496118_0087773_986_1312 | 106 |
| 44 | 3300048922 | Ga0496119_0066218 | Ga0496119_0066218_1204_1530 | 106 |
| 45 | 3300048925 | Ga0496122_0046726 | Ga0496122_0046726_1598_1924 | 106 |
| 46 | 3300048925 | Ga0496122_0074460 | Ga0496122_0074460_738_1064 | 106 |
| 47 | 3300048926 | Ga0496123_0302700 | Ga0496123_0302700_71_397 | 106 |
| 48 | 3300048927 | Ga0496124_0409490 | Ga0496124_0409490_412_738 | 106 |
| 49 | 3300048928 | Ga0496125_0008401 | Ga0496125_0008401_3206_3532 | 106 |
| 50 | 3300048928 | Ga0496125_0013833 | Ga0496125_0013833_3453_3779 | 106 |
| 51 | 3300048928 | Ga0496125_0016754 | Ga0496125_0016754_3090_3422 | 106 |
| 52 | 3300048928 | Ga0496125_0691081 | Ga0496125_0691081_184_516 | 106 |
| 53 | 3300048929 | Ga0496126_0064704 | Ga0496126_0064704_634_960 | 106 |
| 54 | 3300048929 | Ga0496126_0267489 | Ga0496126_0267489_123_449 | 106 |
| 55 | 3300049569 | Ga0501032_0162694 | Ga0501032_0162694_50_376 | 106 |
| 56 | 3300049744 | Ga0501083_0611537 | Ga0501083_0611537_205_540 | 106 |
| 57 | 3300050491 | nmdc:mga00v17_3411_c1 | nmdc:mga00v17_3411_c1_2135_2467 | 106 |
| 58 | 3300050491 | nmdc:mga00v17_73703_c1 | nmdc:mga00v17_73703_c1_1674_2000 | 106 |
| 59 | 3300050496 | nmdc:mga07m45_598288_c1 | nmdc:mga07m45_598288_c1_30_356 | 106 |
| 60 | 3300053136 | Ga0500559_0037402 | Ga0500559_0037402_900_1232 | 106 |
| 61 | 3300053136 | Ga0500559_0369821 | Ga0500559_0369821_90_422 | 106 |
| 62 | 3300053140 | Ga0500573_0004009 | Ga0500573_0004009_3123_3455 | 106 |
| 63 | 3300053140 | Ga0500573_0019759 | Ga0500573_0019759_2238_2573 | 106 |
| 64 | 3300053140 | Ga0500573_0144700 | Ga0500573_0144700_284_616 | 106 |
| 65 | 3300053140 | Ga0500573_0153733 | Ga0500573_0153733_380_712 | 106 |
| 66 | 3300053140 | Ga0500573_0308620 | Ga0500573_0308620_35_364 | 106 |
| 67 | 3300053142 | Ga0500577_0320029 | Ga0500577_0320029_302_637 | 106 |
| 68 | 3300006038 | Ga0075365_11138347 | Ga0075365_111383471 | 107 |
| 69 | 3300031649 | Ga0307514_10003692 | Ga0307514_100036929 | 107 |
| 70 | 3300053140 | Ga0500573_0339435 | Ga0500573_0339435_61_405 | 107 |
| 71 | 3300005330 | Ga0070690_100967956 | Ga0070690_1009679561 | 109 |
| 72 | 3300005344 | Ga0070661_100463103 | Ga0070661_1004631032 | 109 |
| 73 | 3300005364 | Ga0070673_101871299 | Ga0070673_1018712991 | 109 |
| 74 | 3300005441 | Ga0070700_101300996 | Ga0070700_1013009961 | 109 |
| 75 | 3300005456 | Ga0070678_102198296 | Ga0070678_1021982961 | 109 |
| 76 | 3300005458 | Ga0070681_11221556 | Ga0070681_112215562 | 109 |
| 77 | 3300005459 | Ga0068867_102335313 | Ga0068867_1023353131 | 109 |
| 78 | 3300005539 | Ga0068853_100142209 | Ga0068853_1001422093 | 109 |
| 79 | 3300005539 | Ga0068853_101151082 | Ga0068853_1011510821 | 109 |
| 80 | 3300005543 | Ga0070672_100293127 | Ga0070672_1002931272 | 109 |
| 81 | 3300005544 | Ga0070686_100000071 | Ga0070686_10000007148 | 109 |
| 82 | 3300005548 | Ga0070665_100000011 | Ga0070665_100000011179 | 109 |
| 83 | 3300005563 | Ga0068855_100186853 | Ga0068855_1001868533 | 109 |
| 84 | 3300005563 | Ga0068855_100926674 | Ga0068855_1009266741 | 109 |
| 85 | 3300005577 | Ga0068857_102014749 | Ga0068857_1020147491 | 109 |
| 86 | 3300005578 | Ga0068854_102082660 | Ga0068854_1020826602 | 109 |
| 87 | 3300005616 | Ga0068852_100154207 | Ga0068852_1001542072 | 109 |
| 88 | 3300005841 | Ga0068863_100090062 | Ga0068863_1000900623 | 109 |
| 89 | 3300005844 | Ga0068862_101839332 | Ga0068862_1018393321 | 109 |
| 90 | 3300006177 | Ga0075362_10458699 | Ga0075362_104586992 | 109 |
| 91 | 3300006186 | Ga0075369_10001552 | Ga0075369_100015529 | 109 |
| 92 | 3300006358 | Ga0068871_100576782 | Ga0068871_1005767822 | 109 |
| 93 | 3300009098 | Ga0105245_10776289 | Ga0105245_107762892 | 109 |
| 94 | 3300009148 | Ga0105243_10540264 | Ga0105243_105402642 | 109 |
| 95 | 3300009551 | Ga0105238_10147817 | Ga0105238_101478172 | 109 |
| 96 | 3300009551 | Ga0105238_10668922 | Ga0105238_106689222 | 109 |
| 97 | 3300011119 | Ga0105246_11625212 | Ga0105246_116252122 | 109 |
| 98 | 3300013105 | Ga0157369_10706482 | Ga0157369_107064822 | 109 |
| 99 | 3300013297 | Ga0157378_10064493 | Ga0157378_100644932 | 109 |
| 100 | 3300013297 | Ga0157378_10431064 | Ga0157378_104310642 | 109 |
| 101 | 3300013307 | Ga0157372_10256413 | Ga0157372_102564132 | 109 |
| 102 | 3300013308 | Ga0157375_13401230 | Ga0157375_134012301 | 109 |
| 103 | 3300014325 | Ga0163163_11303242 | Ga0163163_113032422 | 109 |
| 104 | 3300014745 | Ga0157377_11292200 | Ga0157377_112922002 | 109 |
| 105 | 3300020070 | Ga0206356_10025658 | Ga0206356_100256584 | 109 |
| 106 | 3300021384 | Ga0213876_10003843 | Ga0213876_100038433 | 109 |
| 107 | 3300025913 | Ga0207695_10308975 | Ga0207695_103089751 | 109 |
| 108 | 3300025918 | Ga0207662_10244398 | Ga0207662_102443982 | 109 |
| 109 | 3300025942 | Ga0207689_10268527 | Ga0207689_102685271 | 109 |
| 110 | 3300025944 | Ga0207661_10538702 | Ga0207661_105387021 | 109 |
| 111 | 3300025944 | Ga0207661_11003668 | Ga0207661_110036682 | 109 |
| 112 | 3300025944 | Ga0207661_12108828 | Ga0207661_121088281 | 109 |
| 113 | 3300025949 | Ga0207667_10117329 | Ga0207667_101173292 | 109 |
| 114 | 3300026035 | Ga0207703_11687115 | Ga0207703_116871151 | 109 |
| 115 | 3300026041 | Ga0207639_10095202 | Ga0207639_100952022 | 109 |
| 116 | 3300026041 | Ga0207639_10734988 | Ga0207639_107349882 | 109 |
| 117 | 3300026075 | Ga0207708_11595477 | Ga0207708_115954771 | 109 |
| 118 | 3300026088 | Ga0207641_10098653 | Ga0207641_100986533 | 109 |
| 119 | 3300026142 | Ga0207698_10084136 | Ga0207698_100841363 | 109 |
| 120 | 3300028379 | Ga0268266_10000063 | Ga0268266_10000063177 | 109 |
| 121 | 3300028800 | Ga0265338_10237422 | Ga0265338_102374222 | 109 |
| 122 | 3300035724 | Ga0373933_0089238 | Ga0373933_0089238_796_1125 | 109 |
| 123 | 3300039437 | Ga0436365_0257345 | Ga0436365_0257345_12843_13172 | 109 |
| 124 | 3300039437 | Ga0436365_0326668 | Ga0436365_0326668_250_579 | 109 |
| 125 | 3300039450 | Ga0436363_0729632 | Ga0436363_0729632_34_363 | 109 |
| 126 | 3300039453 | Ga0436362_0514603 | Ga0436362_0514603_157_486 | 109 |
| 127 | 3300046528 | Ga0495642_0006165 | Ga0495642_0006165_3556_3885 | 109 |
| 128 | 3300046694 | Ga0495649_0001783 | Ga0495649_0001783_3719_4048 | 109 |
| 129 | 3300048917 | Ga0496114_0315462 | Ga0496114_0315462_76_405 | 109 |
| 130 | 3300048925 | Ga0496122_0301897 | Ga0496122_0301897_446_775 | 109 |
| 131 | 3300050516 | nmdc:mga0sz30_9642_c1 | nmdc:mga0sz30_9642_c1_955_1284 | 109 |
| 132 | 3300053093 | Ga0500651_0003564 | Ga0500651_0003564_4161_4490 | 109 |
| 133 | 3300053136 | Ga0500559_0000159 | Ga0500559_0000159_8176_8517 | 109 |
| 134 | 3300053140 | Ga0500573_0368594 | Ga0500573_0368594_314_646 | 109 |
| 135 | 3300005367 | Ga0070667_101278109 | Ga0070667_1012781092 | 110 |
| 136 | 3300025986 | Ga0207658_11697943 | Ga0207658_116979431 | 110 |
| 137 | 3300053140 | Ga0500573_0105812 | Ga0500573_0105812_780_1124 | 110 |
| 138 | 3300053142 | Ga0500577_0241101 | Ga0500577_0241101_338_682 | 110 |
| 139 | 3300005337 | Ga0070682_100669828 | Ga0070682_1006698282 | 111 |
| 140 | 3300013307 | Ga0157372_11637800 | Ga0157372_116378002 | 111 |
| 141 | 3300025934 | Ga0207686_10005543 | Ga0207686_100055435 | 111 |
| 142 | 3300037471 | Ga0395905_0003027 | Ga0395905_0003027_2865_3200 | 111 |
| 143 | 3300037471 | Ga0395905_0536506 | Ga0395905_0536506_537_872 | 111 |
| 144 | 3300038443 | Ga0395901_0072396 | Ga0395901_0072396_3036_3371 | 111 |
| 145 | 3300005331 | Ga0070670_100274239 | Ga0070670_1002742392 | 112 |
| 146 | 3300005548 | Ga0070665_101634914 | Ga0070665_1016349141 | 112 |
| 147 | 3300005577 | Ga0068857_100327152 | Ga0068857_1003271521 | 112 |
| 148 | 3300006195 | Ga0075366_10307048 | Ga0075366_103070482 | 112 |
| 149 | 3300006353 | Ga0075370_10175410 | Ga0075370_101754102 | 112 |
| 150 | 3300014325 | Ga0163163_10337597 | Ga0163163_103375971 | 112 |
| 151 | 3300028379 | Ga0268266_11089599 | Ga0268266_110895992 | 112 |
| 152 | 3300031548 | Ga0307408_100846526 | Ga0307408_1008465262 | 112 |
| 153 | 3300031824 | Ga0307413_10014005 | Ga0307413_100140053 | 112 |
| 154 | 3300031852 | Ga0307410_10399927 | Ga0307410_103999272 | 112 |
| 155 | 3300031903 | Ga0307407_11159696 | Ga0307407_111596962 | 112 |
| 156 | 3300031995 | Ga0307409_100726941 | Ga0307409_1007269412 | 112 |
| 157 | 3300032004 | Ga0307414_10026615 | Ga0307414_100266154 | 112 |
| 158 | 3300032005 | Ga0307411_10826999 | Ga0307411_108269992 | 112 |
| 159 | 3300032126 | Ga0307415_101339893 | Ga0307415_1013398932 | 112 |
| 160 | 3300037418 | Ga0395900_1691397 | Ga0395900_1691397_28_366 | 112 |
| 161 | 3300037471 | Ga0395905_0822524 | Ga0395905_0822524_195_533 | 112 |
| 162 | 3300042010 | Ga0439452_061057 | Ga0439452_061057_436_774 | 112 |
| 163 | 3300042131 | Ga0450894_036760 | Ga0450894_036760_64_402 | 112 |
| 164 | 3300044842 | Ga0466957_1348563 | Ga0466957_1348563_109_462 | 112 |
| 165 | 3300046616 | Ga0495668_0395301 | Ga0495668_0395301_187_525 | 112 |
| 166 | 3300046660 | Ga0495625_0009232 | Ga0495625_0009232_646_984 | 112 |
| 167 | 3300050493 | nmdc:mga0k408_852361_c1 | nmdc:mga0k408_852361_c1_32_370 | 112 |
| 168 | 3300050496 | nmdc:mga07m45_164192_c1 | nmdc:mga07m45_164192_c1_562_900 | 112 |
| 169 | 3300053087 | Ga0500643_010520 | Ga0500643_010520_43_381 | 112 |
| 170 | 3300053092 | Ga0500583_0135666 | Ga0500583_0135666_770_1108 | 112 |
| 171 | 3300053098 | Ga0500650_0032361 | Ga0500650_0032361_2024_2362 | 112 |
| 172 | 3300053104 | Ga0500556_0000027 | Ga0500556_0000027_28956_29294 | 112 |
| 173 | 3300053105 | Ga0500557_055871 | Ga0500557_055871_769_1107 | 112 |
| 174 | 3300053130 | Ga0500642_0000003 | Ga0500642_0000003_399895_400233 | 112 |
| 175 | 3300001915 | JGI24741J21665_1008580 | JGI24741J21665_10085802 | 113 |
| 176 | 3300001979 | JGI24740J21852_10009763 | JGI24740J21852_100097632 | 113 |
| 177 | 3300001989 | JGI24739J22299_10049746 | JGI24739J22299_100497462 | 113 |
| 178 | 3300001990 | JGI24737J22298_10037530 | JGI24737J22298_100375302 | 113 |
| 179 | 3300002067 | JGI24735J21928_10007523 | JGI24735J21928_100075232 | 113 |
| 180 | 3300002067 | JGI24735J21928_10018443 | JGI24735J21928_100184431 | 113 |
| 181 | 3300002067 | JGI24735J21928_10059889 | JGI24735J21928_100598892 | 113 |
| 182 | 3300002075 | JGI24738J21930_10086012 | JGI24738J21930_100860121 | 113 |
| 183 | 3300005262 | Ga0065165_1001694 | Ga0065165_10016945 | 113 |
| 184 | 3300005327 | Ga0070658_10038624 | Ga0070658_100386242 | 113 |
| 185 | 3300005327 | Ga0070658_10079799 | Ga0070658_100797992 | 113 |
| 186 | 3300005327 | Ga0070658_10250236 | Ga0070658_102502361 | 113 |
| 187 | 3300005327 | Ga0070658_10358579 | Ga0070658_103585792 | 113 |
| 188 | 3300005327 | Ga0070658_10619283 | Ga0070658_106192831 | 113 |
| 189 | 3300005327 | Ga0070658_10629562 | Ga0070658_106295622 | 113 |
| 190 | 3300005327 | Ga0070658_10699969 | Ga0070658_106999692 | 113 |
| 191 | 3300005337 | Ga0070682_100302988 | Ga0070682_1003029881 | 113 |
| 192 | 3300005337 | Ga0070682_100923989 | Ga0070682_1009239891 | 113 |
| 193 | 3300005339 | Ga0070660_100070826 | Ga0070660_1000708262 | 113 |
| 194 | 3300005339 | Ga0070660_100296233 | Ga0070660_1002962331 | 113 |
| 195 | 3300005339 | Ga0070660_100363576 | Ga0070660_1003635761 | 113 |
| 196 | 3300005339 | Ga0070660_100943068 | Ga0070660_1009430682 | 113 |
| 197 | 3300005344 | Ga0070661_100486023 | Ga0070661_1004860232 | 113 |
| 198 | 3300005353 | Ga0070669_100433829 | Ga0070669_1004338293 | 113 |
| 199 | 3300005366 | Ga0070659_100064948 | Ga0070659_1000649482 | 113 |
| 200 | 3300005366 | Ga0070659_100286949 | Ga0070659_1002869492 | 113 |
| 201 | 3300005436 | Ga0070713_100945196 | Ga0070713_1009451961 | 113 |
| 202 | 3300005436 | Ga0070713_101490816 | Ga0070713_1014908161 | 113 |
| 203 | 3300005455 | Ga0070663_100138343 | Ga0070663_1001383432 | 113 |
| 204 | 3300005455 | Ga0070663_100251231 | Ga0070663_1002512312 | 113 |
| 205 | 3300005455 | Ga0070663_100374212 | Ga0070663_1003742122 | 113 |
| 206 | 3300005457 | Ga0070662_100069992 | Ga0070662_1000699924 | 113 |
| 207 | 3300005458 | Ga0070681_10512975 | Ga0070681_105129751 | 113 |
| 208 | 3300005530 | Ga0070679_100273515 | Ga0070679_1002735152 | 113 |
| 209 | 3300005530 | Ga0070679_100988355 | Ga0070679_1009883552 | 113 |
| 210 | 3300005530 | Ga0070679_101697354 | Ga0070679_1016973541 | 113 |
| 211 | 3300005535 | Ga0070684_100147152 | Ga0070684_1001471521 | 113 |
| 212 | 3300005546 | Ga0070696_100965869 | Ga0070696_1009658692 | 113 |
| 213 | 3300005564 | Ga0070664_100648140 | Ga0070664_1006481402 | 113 |
| 214 | 3300005577 | Ga0068857_101698123 | Ga0068857_1016981231 | 113 |
| 215 | 3300005578 | Ga0068854_100494970 | Ga0068854_1004949702 | 113 |
| 216 | 3300005614 | Ga0068856_100685816 | Ga0068856_1006858161 | 113 |
| 217 | 3300009176 | Ga0105242_10850613 | Ga0105242_108506132 | 113 |
| 218 | 3300013100 | Ga0157373_10050371 | Ga0157373_100503711 | 113 |
| 219 | 3300013100 | Ga0157373_11045507 | Ga0157373_110455071 | 113 |
| 220 | 3300013102 | Ga0157371_10169783 | Ga0157371_101697832 | 113 |
| 221 | 3300013102 | Ga0157371_10290702 | Ga0157371_102907021 | 113 |
| 222 | 3300013102 | Ga0157371_10790050 | Ga0157371_107900502 | 113 |
| 223 | 3300013104 | Ga0157370_11130779 | Ga0157370_111307792 | 113 |
| 224 | 3300013105 | Ga0157369_10725802 | Ga0157369_107258022 | 113 |
| 225 | 3300013296 | Ga0157374_10663348 | Ga0157374_106633482 | 113 |
| 226 | 3300013307 | Ga0157372_10093647 | Ga0157372_100936472 | 113 |
| 227 | 3300013307 | Ga0157372_10160850 | Ga0157372_101608502 | 113 |
| 228 | 3300013307 | Ga0157372_10374016 | Ga0157372_103740162 | 113 |
| 229 | 3300013307 | Ga0157372_10685277 | Ga0157372_106852772 | 113 |
| 230 | 3300025302 | Ga0207426_1109898 | Ga0207426_11098982 | 113 |
| 231 | 3300025893 | Ga0207682_10391440 | Ga0207682_103914401 | 113 |
| 232 | 3300025904 | Ga0207647_10115239 | Ga0207647_101152392 | 113 |
| 233 | 3300025904 | Ga0207647_10231026 | Ga0207647_102310262 | 113 |
| 234 | 3300025909 | Ga0207705_10048091 | Ga0207705_100480913 | 113 |
| 235 | 3300025909 | Ga0207705_10199908 | Ga0207705_101999082 | 113 |
| 236 | 3300025909 | Ga0207705_10282589 | Ga0207705_102825892 | 113 |
| 237 | 3300025909 | Ga0207705_10427279 | Ga0207705_104272792 | 113 |
| 238 | 3300025909 | Ga0207705_10457183 | Ga0207705_104571831 | 113 |
| 239 | 3300025909 | Ga0207705_10746834 | Ga0207705_107468342 | 113 |
| 240 | 3300025909 | Ga0207705_11160894 | Ga0207705_111608941 | 113 |
| 241 | 3300025912 | Ga0207707_10416249 | Ga0207707_104162491 | 113 |
| 242 | 3300025917 | Ga0207660_10061663 | Ga0207660_100616632 | 113 |
| 243 | 3300025917 | Ga0207660_11191444 | Ga0207660_111914441 | 113 |
| 244 | 3300025919 | Ga0207657_10129440 | Ga0207657_101294401 | 113 |
| 245 | 3300025919 | Ga0207657_10697079 | Ga0207657_106970792 | 113 |
| 246 | 3300025920 | Ga0207649_10162225 | Ga0207649_101622252 | 113 |
| 247 | 3300025920 | Ga0207649_10195504 | Ga0207649_101955042 | 113 |
| 248 | 3300025921 | Ga0207652_10052569 | Ga0207652_100525692 | 113 |
| 249 | 3300025929 | Ga0207664_10290798 | Ga0207664_102907981 | 113 |
| 250 | 3300025932 | Ga0207690_10023281 | Ga0207690_100232814 | 113 |
| 251 | 3300025932 | Ga0207690_10144785 | Ga0207690_101447852 | 113 |
| 252 | 3300025932 | Ga0207690_10765783 | Ga0207690_107657832 | 113 |
| 253 | 3300025933 | Ga0207706_10005173 | Ga0207706_1000517311 | 113 |
| 254 | 3300025933 | Ga0207706_11553004 | Ga0207706_115530041 | 113 |
| 255 | 3300025944 | Ga0207661_10132070 | Ga0207661_101320702 | 113 |
| 256 | 3300025945 | Ga0207679_10116039 | Ga0207679_101160392 | 113 |
| 257 | 3300025949 | Ga0207667_11011156 | Ga0207667_110111561 | 113 |
| 258 | 3300025981 | Ga0207640_11917677 | Ga0207640_119176771 | 113 |
| 259 | 3300026041 | Ga0207639_10831851 | Ga0207639_108318511 | 113 |
| 260 | 3300026067 | Ga0207678_10025172 | Ga0207678_100251722 | 113 |
| 261 | 3300026067 | Ga0207678_10149450 | Ga0207678_101494502 | 113 |
| 262 | 3300026067 | Ga0207678_10171872 | Ga0207678_101718722 | 113 |
| 263 | 3300026116 | Ga0207674_10030183 | Ga0207674_100301832 | 113 |
| 264 | 3300027111 | Ga0209281_1020130 | Ga0209281_10201302 | 113 |
| 265 | 3300030731 | Ga0316177_1114600 | Ga0316177_11146002 | 113 |
| 266 | 3300032005 | Ga0307411_11964711 | Ga0307411_119647112 | 113 |
| 267 | 3300035111 | Ga0373923_0009702 | Ga0373923_0009702_2970_3320 | 113 |
| 268 | 3300035117 | Ga0373953_0173284 | Ga0373953_0173284_546_896 | 113 |
| 269 | 3300035118 | Ga0373954_0011576 | Ga0373954_0011576_498_848 | 113 |
| 270 | 3300035119 | Ga0373956_0082430 | Ga0373956_0082430_778_1128 | 113 |
| 271 | 3300035120 | Ga0373957_0077268 | Ga0373957_0077268_19_369 | 113 |
| 272 | 3300035172 | Ga0373955_0002880 | Ga0373955_0002880_5762_6112 | 113 |
| 273 | 3300035724 | Ga0373933_1101384 | Ga0373933_1101384_159_509 | 113 |
| 274 | 3300036401 | Ga0373937_0017988 | Ga0373937_0017988_3852_4202 | 113 |
| 275 | 3300037418 | Ga0395900_0903122 | Ga0395900_0903122_84_425 | 113 |
| 276 | 3300041404 | Ga0439436_0040786 | Ga0439436_0040786_205_546 | 113 |
| 277 | 3300041405 | Ga0439438_101091 | Ga0439438_101091_207_548 | 113 |
| 278 | 3300042000 | Ga0439437_037171 | Ga0439437_037171_40_393 | 113 |
| 279 | 3300042125 | Ga0450923_005367 | Ga0450923_005367_475_816 | 113 |
| 280 | 3300042130 | Ga0450892_010449 | Ga0450892_010449_187_540 | 113 |
| 281 | 3300042144 | Ga0450889_040652 | Ga0450889_040652_209_550 | 113 |
| 282 | 3300042435 | Ga0439434_0033802 | Ga0439434_0033802_12_353 | 113 |
| 283 | 3300044694 | Ga0466963_0023091 | Ga0466963_0023091_2374_2715 | 113 |
| 284 | 3300046453 | Ga0495627_018068 | Ga0495627_018068_1093_1434 | 113 |
| 285 | 3300046525 | Ga0495663_0189531 | Ga0495663_0189531_41_382 | 113 |
| 286 | 3300047318 | Ga0495636_0147682 | Ga0495636_0147682_84_425 | 113 |
| 287 | 3300047470 | Ga0495681_0055414 | Ga0495681_0055414_1348_1689 | 113 |
| 288 | 3300047472 | Ga0495686_0000600 | Ga0495686_0000600_32894_33235 | 113 |
| 289 | 3300048088 | Ga0495602_0090620 | Ga0495602_0090620_701_1051 | 113 |
| 290 | 3300048904 | Ga0496101_0803302 | Ga0496101_0803302_103_444 | 113 |
| 291 | 3300048928 | Ga0496125_0147638 | Ga0496125_0147638_217_558 | 113 |
| 292 | 3300048929 | Ga0496126_0790501 | Ga0496126_0790501_133_474 | 113 |
| 293 | 3300053108 | Ga0500562_010256 | Ga0500562_010256_1329_1670 | 113 |
| 294 | 3300053151 | Ga0500604_0153146 | Ga0500604_0153146_44_385 | 113 |
| 295 | 3300053158 | Ga0500627_0300688 | Ga0500627_0300688_256_597 | 113 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ejo-assembly1.cif.gz_A-2 | crystal structure of padr family transcriptional regulator from eggerthella lenta dsm 2243 | 0.9482 | 5 | 112 |
| 5x11-assembly1.cif.gz_A | crystal structure of bacillus subtilis padr in complex with operator dna | 0.9365 | 19 | 95 |
| 5x11-assembly4.cif.gz_H | crystal structure of bacillus subtilis padr in complex with operator dna | 0.9313 | 19 | 95 |
| 5x11-assembly3.cif.gz_D | crystal structure of bacillus subtilis padr in complex with operator dna | 0.9293 | 19 | 95 |
| 5x11-assembly1.cif.gz_B | crystal structure of bacillus subtilis padr in complex with operator dna | 0.9292 | 19 | 95 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5x11A01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9298 | 19 | 95 | 1.10.10.10 |
| 5dymA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9252 | 19 | 108 | 1.10.10.10 |
| 4ejoA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9218 | 6 | 112 | 1.10.10.10 |
| 3ri2B00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9095 | 6 | 108 | 1.10.10.10 |
| af_Q57682_5_95_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9015 | 24 | 85 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A160IK66-F1-model_v4 | PadR family transcriptional regulator | 0.9886 | 6 | 108 |
|
| AF-A0A4Q7YQ82-F1-model_v4 | PadR family transcriptional regulator PadR | 0.9876 | 6 | 111 |
|
| AF-A0A519L127-F1-model_v4 | PadR family transcriptional regulator | 0.987 | 12 | 107 |
|
| AF-A0A2V9YD09-F1-model_v4 | PadR family transcriptional regulator | 0.9859 | 6 | 110 |
|
| AF-A0A846MV15-F1-model_v4 | DNA-binding PadR family transcriptional regulator | 0.9857 | 14 | 110 |
GO:0003677
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar