F392899

General Info

Members Datasets Scaffolds Average Seq Length
295 195 286 111

Family's Representative Sequence

Representative Sequence 3300053140|Ga0500573_0105812|Ga0500573_0105812_780_1124
Length 114
Sequence MTPTSSGAEAQLRKGVVEFAILALLKTEPMYGWQLSQELIERGGFIASIGTLYPVLSRLRAKGWVSTYDEASDAGPARRYYRLTASGTESLADFTSQWEVFSDSLTSLLKETAR

Samples

Sample ID Description Type Environment
1 2643221649 Leifsonia sp. Root4 Isolate Unclassified
2 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
3 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
4 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
5 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
6 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
7 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
8 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
9 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
10 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
11 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
12 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
13 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
14 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
15 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
16 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
112 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
117 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
118 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
123 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
124 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
125 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
126 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
127 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
128 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
129 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
136 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
137 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
138 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
139 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
140 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
141 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
142 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
143 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
144 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
145 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
146 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
147 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
148 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
149 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
150 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
151 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
152 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
153 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
154 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
155 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
156 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
157 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
158 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
159 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
160 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
161 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
162 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
163 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
164 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
169 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
170 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
171 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
172 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
173 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
174 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
175 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
176 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
179 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
180 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
181 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
182 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
183 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
184 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
185 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
186 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
187 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
188 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
189 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
190 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
191 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
192 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
193 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
194 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
195 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.61
Metatranscriptomes 0.34
Isolates 3.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.25
Nodule 0.34
Rhizoplane 2.03
Rhizosphere 72.88
Stem 0
Stem Tuber 0
Unclassified 9.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1008580 3300001915 Bacteria 1921
2 JGI24740J21852_10009763 3300001979 Bacteria 3735
3 JGI24739J22299_10049746 3300001989 Bacteria 1358
4 JGI24737J22298_10037530 3300001990 Bacteria 1493
5 JGI24735J21928_10007523 3300002067 Bacteria 3550
6 JGI24735J21928_10018443 3300002067 Unclassified 2151
7 JGI24735J21928_10059889 3300002067 Bacteria 1094
8 JGI24738J21930_10086012 3300002075 Unclassified 661
9 Ga0055536_1008709 3300003781 Bacteria 4312
10 Ga0055530_10026397 3300003791 Bacteria 1607
11 Ga0055531_10000291 3300003794 Bacteria 50096
12 Ga0065165_1001694 3300005262 Bacteria 22214
13 Ga0070658_10038624 3300005327 Bacteria 3849
14 Ga0070658_10079799 3300005327 Bacteria 2688
15 Ga0070658_10250236 3300005327 Unclassified 1503
16 Ga0070658_10358579 3300005327 Bacteria 1248
17 Ga0070658_10619283 3300005327 Bacteria 938
18 Ga0070658_10629562 3300005327 Unclassified 930
19 Ga0070658_10699969 3300005327 Bacteria 879
20 Ga0070690_100967956 3300005330 Bacteria 669
21 Ga0070670_100274239 3300005331 Bacteria 1472
22 Ga0070682_100302988 3300005337 Bacteria 1173
23 Ga0070682_100669828 3300005337 Unclassified 828
24 Ga0070682_100923989 3300005337 Bacteria 719
25 Ga0070660_100040508 3300005339 Bacteria 3545
26 Ga0070660_100070826 3300005339 Bacteria 2721
27 Ga0070660_100296233 3300005339 Bacteria 1325
28 Ga0070660_100363576 3300005339 Bacteria 1193
29 Ga0070660_100943068 3300005339 Bacteria 728
30 Ga0070661_100463103 3300005344 Bacteria 1010
31 Ga0070661_100486023 3300005344 Bacteria 987
32 Ga0070669_100433829 3300005353 Bacteria 1080
33 Ga0070673_101871299 3300005364 Bacteria 569
34 Ga0070659_100050290 3300005366 Bacteria 3277
35 Ga0070659_100064948 3300005366 Bacteria 2890
36 Ga0070659_100286949 3300005366 Bacteria 1370
37 Ga0070667_101278109 3300005367 Bacteria 687
38 Ga0070713_100945196 3300005436 Bacteria 830
39 Ga0070713_101490816 3300005436 Bacteria 656
40 Ga0070700_101300996 3300005441 Bacteria 611
41 Ga0070663_100138343 3300005455 Bacteria 1856
42 Ga0070663_100251231 3300005455 Bacteria 1399
43 Ga0070663_100374212 3300005455 Bacteria 1158
44 Ga0070678_102198296 3300005456 Bacteria 523
45 Ga0070662_100069992 3300005457 Bacteria 2584
46 Ga0070681_10512975 3300005458 Bacteria 1112
47 Ga0070681_11221556 3300005458 Bacteria 674
48 Ga0068867_102335313 3300005459 Bacteria 508
49 Ga0070679_100273515 3300005530 Bacteria 1643
50 Ga0070679_100988355 3300005530 Bacteria 785
51 Ga0070679_101697354 3300005530 Bacteria 579
52 Ga0070684_100147152 3300005535 Bacteria 2133
53 Ga0068853_100142209 3300005539 Bacteria 2154
54 Ga0068853_101151082 3300005539 Bacteria 749
55 Ga0070672_100293127 3300005543 Bacteria 1378
56 Ga0070686_100000071 3300005544 Bacteria 76738
57 Ga0070696_100965869 3300005546 Bacteria 710
58 Ga0070665_100000011 3300005548 Bacteria 525539
59 Ga0070665_101634914 3300005548 Unclassified 652
60 Ga0068855_100186853 3300005563 Bacteria 2340
61 Ga0068855_100333288 3300005563 Bacteria 1675
62 Ga0068855_100926674 3300005563 Bacteria 919
63 Ga0070664_100648140 3300005564 Bacteria 981
64 Ga0068857_100327152 3300005577 Bacteria 1416
65 Ga0068857_101698123 3300005577 Bacteria 617
66 Ga0068857_102014749 3300005577 Bacteria 566
67 Ga0068854_100494970 3300005578 Bacteria 1028
68 Ga0068854_102082660 3300005578 Bacteria 524
69 Ga0068856_100685816 3300005614 Bacteria 1045
70 Ga0068852_100154207 3300005616 Bacteria 2138
71 Ga0068863_100090062 3300005841 Bacteria 2909
72 Ga0068862_101839332 3300005844 Bacteria 615
73 Ga0075365_11138347 3300006038 Bacteria 549
74 Ga0075364_10016020 3300006051 Bacteria 4656
75 Ga0075364_10488519 3300006051 Bacteria 842
76 Ga0075362_10458699 3300006177 Bacteria 648
77 Ga0075369_10001552 3300006186 Bacteria 7877
78 Ga0075366_10307048 3300006195 Bacteria 971
79 Ga0075370_10175410 3300006353 Bacteria 1261
80 Ga0075370_10324700 3300006353 Bacteria 917
81 Ga0068871_100576782 3300006358 Bacteria 1021
82 Ga0105240_11672775 3300009093 Bacteria 665
83 Ga0105245_10776289 3300009098 Bacteria 995
84 Ga0105243_10540264 3300009148 Bacteria 1112
85 Ga0105242_10850613 3300009176 Bacteria 908
86 Ga0105238_10147817 3300009551 Bacteria 2326
87 Ga0105238_10668922 3300009551 Bacteria 1049
88 Ga0105246_11625212 3300011119 Bacteria 611
89 Ga0157373_10050371 3300013100 Bacteria 2966
90 Ga0157373_11045507 3300013100 Bacteria 611
91 Ga0157371_10169783 3300013102 Bacteria 1558
92 Ga0157371_10290702 3300013102 Bacteria 1182
93 Ga0157371_10790050 3300013102 Bacteria 715
94 Ga0157370_10659530 3300013104 Bacteria 956
95 Ga0157370_11130779 3300013104 Unclassified 707
96 Ga0157369_10706482 3300013105 Bacteria 1038
97 Ga0157369_10725802 3300013105 Bacteria 1023
98 Ga0157374_10663348 3300013296 Bacteria 1055
99 Ga0157378_10050047 3300013297 Bacteria 3718
100 Ga0157378_10064493 3300013297 Bacteria 3277
101 Ga0157378_10431064 3300013297 Bacteria 1305
102 Ga0163162_12204078 3300013306 Bacteria 632
103 Ga0157372_10093647 3300013307 Bacteria 3419
104 Ga0157372_10160850 3300013307 Bacteria 2595
105 Ga0157372_10256413 3300013307 Bacteria 2030
106 Ga0157372_10374016 3300013307 Bacteria 1660
107 Ga0157372_10685277 3300013307 Unclassified 1193
108 Ga0157372_11637800 3300013307 Bacteria 741
109 Ga0157375_13401230 3300013308 Bacteria 530
110 Ga0163163_10337597 3300014325 Bacteria 1562
111 Ga0163163_11303242 3300014325 Bacteria 788
112 Ga0157377_11292200 3300014745 Bacteria 570
113 Ga0206356_10025658 3300020070 Bacteria 3677
114 Ga0213876_10003843 3300021384 Bacteria 8512
115 Ga0209676_1000282 3300025292 Bacteria 105777
116 Ga0209050_1001335 3300025298 Bacteria 27398
117 Ga0207426_1109898 3300025302 Bacteria 697
118 Ga0209257_1002477 3300025304 Bacteria 18257
119 Ga0207682_10391440 3300025893 Bacteria 657
120 Ga0207647_10115239 3300025904 Bacteria 1587
121 Ga0207647_10231026 3300025904 Bacteria 1064
122 Ga0207705_10048091 3300025909 Bacteria 3068
123 Ga0207705_10199908 3300025909 Bacteria 1514
124 Ga0207705_10282589 3300025909 Bacteria 1271
125 Ga0207705_10427279 3300025909 Bacteria 1026
126 Ga0207705_10457183 3300025909 Bacteria 990
127 Ga0207705_10746834 3300025909 Bacteria 760
128 Ga0207705_11160894 3300025909 Bacteria 593
129 Ga0207707_10416249 3300025912 Bacteria 1153
130 Ga0207695_10308975 3300025913 Bacteria 1471
131 Ga0207660_10061663 3300025917 Bacteria 2699
132 Ga0207660_11191444 3300025917 Bacteria 620
133 Ga0207662_10244398 3300025918 Bacteria 1176
134 Ga0207657_10129440 3300025919 Bacteria 2070
135 Ga0207657_10697079 3300025919 Bacteria 789
136 Ga0207649_10162225 3300025920 Bacteria 1550
137 Ga0207649_10195504 3300025920 Bacteria 1425
138 Ga0207652_10052569 3300025921 Bacteria 3497
139 Ga0207664_10290798 3300025929 Bacteria 1436
140 Ga0207690_10023281 3300025932 Bacteria 3864
141 Ga0207690_10073791 3300025932 Bacteria 2361
142 Ga0207690_10144785 3300025932 Bacteria 1755
143 Ga0207690_10765783 3300025932 Unclassified 796
144 Ga0207706_10005173 3300025933 Bacteria 12176
145 Ga0207706_11553004 3300025933 Unclassified 538
146 Ga0207686_10005543 3300025934 Bacteria 6766
147 Ga0207689_10268527 3300025942 Bacteria 1412
148 Ga0207661_10132070 3300025944 Bacteria 2140
149 Ga0207661_10538702 3300025944 Bacteria 1069
150 Ga0207661_11003668 3300025944 Bacteria 769
151 Ga0207661_12108828 3300025944 Bacteria 510
152 Ga0207679_10116039 3300025945 Bacteria 2122
153 Ga0207667_10117329 3300025949 Bacteria 2743
154 Ga0207667_10340872 3300025949 Bacteria 1530
155 Ga0207667_11011156 3300025949 Bacteria 818
156 Ga0207640_11917677 3300025981 Bacteria 536
157 Ga0207658_11697943 3300025986 Bacteria 577
158 Ga0207703_11687115 3300026035 Bacteria 609
159 Ga0207639_10095202 3300026041 Bacteria 2392
160 Ga0207639_10734988 3300026041 Bacteria 917
161 Ga0207639_10831851 3300026041 Bacteria 861
162 Ga0207678_10025172 3300026067 Bacteria 5196
163 Ga0207678_10149450 3300026067 Bacteria 1994
164 Ga0207678_10171872 3300026067 Bacteria 1850
165 Ga0207708_11595477 3300026075 Bacteria 573
166 Ga0207641_10098653 3300026088 Bacteria 2569
167 Ga0207674_10030183 3300026116 Bacteria 5702
168 Ga0207698_10084136 3300026142 Bacteria 2578
169 Ga0209281_1020130 3300027111 Bacteria 1308
170 Ga0268266_10000063 3300028379 Bacteria 253339
171 Ga0268266_11089599 3300028379 Bacteria 773
172 Ga0265338_10237422 3300028800 Bacteria 1352
173 Ga0316177_1114600 3300030731 Bacteria 1577
174 Ga0307408_100846526 3300031548 Unclassified 833
175 Ga0307514_10003692 3300031649 Bacteria 14475
176 Ga0307413_10014005 3300031824 Bacteria 4056
177 Ga0307410_10399927 3300031852 Bacteria 1109
178 Ga0307407_11159696 3300031903 Bacteria 602
179 Ga0307412_11285683 3300031911 Bacteria 658
180 Ga0307409_100726941 3300031995 Bacteria 994
181 Ga0307409_101440275 3300031995 Bacteria 716
182 Ga0307414_10026615 3300032004 Bacteria 3725
183 Ga0307414_10484013 3300032004 Bacteria 1092
184 Ga0307414_11382214 3300032004 Bacteria 654
185 Ga0307411_10826999 3300032005 Unclassified 817
186 Ga0307411_11964711 3300032005 Bacteria 545
187 Ga0307415_101339893 3300032126 Bacteria 679
188 Ga0373923_0009702 3300035111 Bacteria 3482
189 Ga0373953_0173284 3300035117 Bacteria 929
190 Ga0373954_0011576 3300035118 Bacteria 3912
191 Ga0373956_0082430 3300035119 Bacteria 1477
192 Ga0373957_0077268 3300035120 Bacteria 1309
193 Ga0373955_0002880 3300035172 Bacteria 7544
194 Ga0373933_0089238 3300035724 Bacteria 1900
195 Ga0373933_1101384 3300035724 Bacteria 523
196 Ga0373937_0017988 3300036401 Bacteria 6304
197 Ga0395900_0903122 3300037418 Bacteria 807
198 Ga0395900_1691397 3300037418 Bacteria 544
199 Ga0395905_0003027 3300037471 Bacteria 18208
200 Ga0395905_0536506 3300037471 Bacteria 1071
201 Ga0395905_0822524 3300037471 Bacteria 832
202 Ga0395901_0072396 3300038443 Bacteria 3593
203 Ga0436365_0257345 3300039437 Bacteria 14502
204 Ga0436365_0326668 3300039437 Bacteria 1077
205 Ga0436363_0729632 3300039450 Bacteria 502
206 Ga0436362_0514603 3300039453 Bacteria 666
207 Ga0439436_0040786 3300041404 Bacteria 1330
208 Ga0439438_101091 3300041405 Bacteria 699
209 Ga0451789_1034719 3300041443 Unclassified 570
210 Ga0451797_0370476 3300041453 Unclassified 622
211 Ga0451797_0708961 3300041453 Bacteria 692
212 Ga0451837_0111527 3300041494 Bacteria 762
213 Ga0451841_1179381 3300041498 Bacteria 759
214 Ga0439437_037171 3300042000 Bacteria 625
215 Ga0439452_061057 3300042010 Bacteria 844
216 Ga0450923_005367 3300042125 Unclassified 2065
217 Ga0450892_010449 3300042130 Bacteria 813
218 Ga0450894_036760 3300042131 Bacteria 696
219 Ga0450889_040652 3300042144 Bacteria 561
220 Ga0439434_0033802 3300042435 Bacteria 1560
221 Ga0466972_0222638 3300044658 Bacteria 883
222 Ga0466963_0023091 3300044694 Bacteria 3944
223 Ga0466957_1348563 3300044842 Unclassified 518
224 Ga0466960_0159235 3300044901 Bacteria 1211
225 Ga0495627_018068 3300046453 Bacteria 2386
226 Ga0495663_0189531 3300046525 Bacteria 715
227 Ga0495642_0006165 3300046528 Bacteria 4602
228 Ga0495668_0395301 3300046616 Unclassified 759
229 Ga0495625_0009232 3300046660 Bacteria 8279
230 Ga0495670_0579357 3300046691 Unclassified 611
231 Ga0495649_0001783 3300046694 Bacteria 15865
232 Ga0495636_0147682 3300047318 Bacteria 1053
233 Ga0495681_0055414 3300047470 Bacteria 1849
234 Ga0495686_0000600 3300047472 Bacteria 50240
235 Ga0495602_0090620 3300048088 Bacteria 2539
236 Ga0496101_0803302 3300048904 Bacteria 742
237 Ga0496107_0547474 3300048910 Bacteria 857
238 Ga0496114_0315462 3300048917 Bacteria 1381
239 Ga0496117_0020589 3300048920 Bacteria 5372
240 Ga0496118_0087773 3300048921 Bacteria 2155
241 Ga0496119_0066218 3300048922 Bacteria 2136
242 Ga0496122_0046726 3300048925 Bacteria 3349
243 Ga0496122_0074460 3300048925 Bacteria 2402
244 Ga0496122_0301897 3300048925 Bacteria 863
245 Ga0496123_0302700 3300048926 Bacteria 762
246 Ga0496124_0409490 3300048927 Bacteria 938
247 Ga0496125_0008401 3300048928 Bacteria 10816
248 Ga0496125_0013833 3300048928 Bacteria 7903
249 Ga0496125_0016754 3300048928 Bacteria 7026
250 Ga0496125_0147638 3300048928 Bacteria 1622
251 Ga0496125_0691081 3300048928 Bacteria 543
252 Ga0496126_0064704 3300048929 Bacteria 3275
253 Ga0496126_0267489 3300048929 Bacteria 1420
254 Ga0496126_0790501 3300048929 Bacteria 729
255 Ga0501032_0162694 3300049569 Bacteria 1465
256 Ga0501038_0154169 3300049574 Bacteria 1871
257 Ga0501083_0611537 3300049744 Bacteria 709
258 nmdc:mga00v17_3411_c1 3300050491 Bacteria 8211
259 nmdc:mga00v17_73703_c1 3300050491 Bacteria 2120
260 nmdc:mga0k408_852361_c1 3300050493 Unclassified 530
261 nmdc:mga07m45_164192_c1 3300050496 Bacteria 1290
262 nmdc:mga07m45_598288_c1 3300050496 Bacteria 637
263 nmdc:mga0sz30_9642_c1 3300050516 Bacteria 3680
264 Ga0500643_010520 3300053087 Bacteria 3434
265 Ga0500583_0135666 3300053092 Bacteria 1222
266 Ga0500651_0003564 3300053093 Bacteria 8527
267 Ga0500650_0032361 3300053098 Bacteria 2382
268 Ga0500556_0000027 3300053104 Bacteria 165855
269 Ga0500557_055871 3300053105 Bacteria 1274
270 Ga0500562_010256 3300053108 Bacteria 2373
271 Ga0500642_0000003 3300053130 Bacteria 544899
272 Ga0500559_0000159 3300053136 Bacteria 53218
273 Ga0500559_0037402 3300053136 Bacteria 2104
274 Ga0500559_0369821 3300053136 Bacteria 669
275 Ga0500573_0004009 3300053140 Bacteria 7695
276 Ga0500573_0019759 3300053140 Bacteria 3855
277 Ga0500573_0105812 3300053140 Bacteria 1579
278 Ga0500573_0144700 3300053140 Bacteria 1306
279 Ga0500573_0153733 3300053140 Bacteria 1257
280 Ga0500573_0308620 3300053140 Bacteria 787
281 Ga0500573_0339435 3300053140 Bacteria 734
282 Ga0500573_0368594 3300053140 Bacteria 691
283 Ga0500577_0241101 3300053142 Bacteria 785
284 Ga0500577_0320029 3300053142 Bacteria 677
285 Ga0500604_0153146 3300053151 Bacteria 783
286 Ga0500627_0300688 3300053158 Bacteria 700

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044658 Ga0466972_0222638 Ga0466972_0222638_580_873 93
2 3300006051 Ga0075364_10016020 Ga0075364_100160207 98
3 3300006353 Ga0075370_10324700 Ga0075370_103247002 98
4 3300031911 Ga0307412_11285683 Ga0307412_112856832 98
5 3300032004 Ga0307414_11382214 Ga0307414_113822142 98
6 3300049574 Ga0501038_0154169 Ga0501038_0154169_385_693 98
7 3300009093 Ga0105240_11672775 Ga0105240_116727751 99
8 3300013297 Ga0157378_10050047 Ga0157378_100500474 99
9 iso_pu_bacteria 2643221649 2644278253 102
10 iso_pu_bacteria 2747842429 2747952555 102
11 iso_pu_bacteria 2852646457 2852647606 102
12 iso_pu_bacteria 2857723135 2857725851 102
13 iso_pu_bacteria 2870622029 2870624543 102
14 iso_pu_bacteria 2945968032 2945968772 102
15 iso_pu_bacteria 2946033335 2946036555 102
16 3300003781 Ga0055536_1008709 Ga0055536_10087091 103
17 3300003791 Ga0055530_10026397 Ga0055530_100263971 103
18 3300003794 Ga0055531_10000291 Ga0055531_1000029124 103
19 3300025292 Ga0209676_1000282 Ga0209676_10002825 103
20 3300025298 Ga0209050_1001335 Ga0209050_100133528 103
21 3300025304 Ga0209257_1002477 Ga0209257_10024773 103
22 3300006051 Ga0075364_10488519 Ga0075364_104885191 105
23 iso_pu_bacteria 2857504554 2857507262 105
24 iso_pu_bacteria 2928531327 2928533354 105
25 3300005339 Ga0070660_100040508 Ga0070660_1000405083 106
26 3300005366 Ga0070659_100050290 Ga0070659_1000502902 106
27 3300005563 Ga0068855_100333288 Ga0068855_1003332882 106
28 3300013104 Ga0157370_10659530 Ga0157370_106595302 106
29 3300013306 Ga0163162_12204078 Ga0163162_122040782 106
30 3300025932 Ga0207690_10073791 Ga0207690_100737913 106
31 3300025949 Ga0207667_10340872 Ga0207667_103408722 106
32 3300031995 Ga0307409_101440275 Ga0307409_1014402751 106
33 3300032004 Ga0307414_10484013 Ga0307414_104840132 106
34 3300041443 Ga0451789_1034719 Ga0451789_1034719_219_554 106
35 3300041453 Ga0451797_0370476 Ga0451797_0370476_237_572 106
36 3300041453 Ga0451797_0708961 Ga0451797_0708961_67_399 106
37 3300041494 Ga0451837_0111527 Ga0451837_0111527_333_659 106
38 3300041498 Ga0451841_1179381 Ga0451841_1179381_114_446 106
39 3300044901 Ga0466960_0159235 Ga0466960_0159235_146_478 106
40 3300046691 Ga0495670_0579357 Ga0495670_0579357_53_388 106
41 3300048910 Ga0496107_0547474 Ga0496107_0547474_129_455 106
42 3300048920 Ga0496117_0020589 Ga0496117_0020589_377_703 106
43 3300048921 Ga0496118_0087773 Ga0496118_0087773_986_1312 106
44 3300048922 Ga0496119_0066218 Ga0496119_0066218_1204_1530 106
45 3300048925 Ga0496122_0046726 Ga0496122_0046726_1598_1924 106
46 3300048925 Ga0496122_0074460 Ga0496122_0074460_738_1064 106
47 3300048926 Ga0496123_0302700 Ga0496123_0302700_71_397 106
48 3300048927 Ga0496124_0409490 Ga0496124_0409490_412_738 106
49 3300048928 Ga0496125_0008401 Ga0496125_0008401_3206_3532 106
50 3300048928 Ga0496125_0013833 Ga0496125_0013833_3453_3779 106
51 3300048928 Ga0496125_0016754 Ga0496125_0016754_3090_3422 106
52 3300048928 Ga0496125_0691081 Ga0496125_0691081_184_516 106
53 3300048929 Ga0496126_0064704 Ga0496126_0064704_634_960 106
54 3300048929 Ga0496126_0267489 Ga0496126_0267489_123_449 106
55 3300049569 Ga0501032_0162694 Ga0501032_0162694_50_376 106
56 3300049744 Ga0501083_0611537 Ga0501083_0611537_205_540 106
57 3300050491 nmdc:mga00v17_3411_c1 nmdc:mga00v17_3411_c1_2135_2467 106
58 3300050491 nmdc:mga00v17_73703_c1 nmdc:mga00v17_73703_c1_1674_2000 106
59 3300050496 nmdc:mga07m45_598288_c1 nmdc:mga07m45_598288_c1_30_356 106
60 3300053136 Ga0500559_0037402 Ga0500559_0037402_900_1232 106
61 3300053136 Ga0500559_0369821 Ga0500559_0369821_90_422 106
62 3300053140 Ga0500573_0004009 Ga0500573_0004009_3123_3455 106
63 3300053140 Ga0500573_0019759 Ga0500573_0019759_2238_2573 106
64 3300053140 Ga0500573_0144700 Ga0500573_0144700_284_616 106
65 3300053140 Ga0500573_0153733 Ga0500573_0153733_380_712 106
66 3300053140 Ga0500573_0308620 Ga0500573_0308620_35_364 106
67 3300053142 Ga0500577_0320029 Ga0500577_0320029_302_637 106
68 3300006038 Ga0075365_11138347 Ga0075365_111383471 107
69 3300031649 Ga0307514_10003692 Ga0307514_100036929 107
70 3300053140 Ga0500573_0339435 Ga0500573_0339435_61_405 107
71 3300005330 Ga0070690_100967956 Ga0070690_1009679561 109
72 3300005344 Ga0070661_100463103 Ga0070661_1004631032 109
73 3300005364 Ga0070673_101871299 Ga0070673_1018712991 109
74 3300005441 Ga0070700_101300996 Ga0070700_1013009961 109
75 3300005456 Ga0070678_102198296 Ga0070678_1021982961 109
76 3300005458 Ga0070681_11221556 Ga0070681_112215562 109
77 3300005459 Ga0068867_102335313 Ga0068867_1023353131 109
78 3300005539 Ga0068853_100142209 Ga0068853_1001422093 109
79 3300005539 Ga0068853_101151082 Ga0068853_1011510821 109
80 3300005543 Ga0070672_100293127 Ga0070672_1002931272 109
81 3300005544 Ga0070686_100000071 Ga0070686_10000007148 109
82 3300005548 Ga0070665_100000011 Ga0070665_100000011179 109
83 3300005563 Ga0068855_100186853 Ga0068855_1001868533 109
84 3300005563 Ga0068855_100926674 Ga0068855_1009266741 109
85 3300005577 Ga0068857_102014749 Ga0068857_1020147491 109
86 3300005578 Ga0068854_102082660 Ga0068854_1020826602 109
87 3300005616 Ga0068852_100154207 Ga0068852_1001542072 109
88 3300005841 Ga0068863_100090062 Ga0068863_1000900623 109
89 3300005844 Ga0068862_101839332 Ga0068862_1018393321 109
90 3300006177 Ga0075362_10458699 Ga0075362_104586992 109
91 3300006186 Ga0075369_10001552 Ga0075369_100015529 109
92 3300006358 Ga0068871_100576782 Ga0068871_1005767822 109
93 3300009098 Ga0105245_10776289 Ga0105245_107762892 109
94 3300009148 Ga0105243_10540264 Ga0105243_105402642 109
95 3300009551 Ga0105238_10147817 Ga0105238_101478172 109
96 3300009551 Ga0105238_10668922 Ga0105238_106689222 109
97 3300011119 Ga0105246_11625212 Ga0105246_116252122 109
98 3300013105 Ga0157369_10706482 Ga0157369_107064822 109
99 3300013297 Ga0157378_10064493 Ga0157378_100644932 109
100 3300013297 Ga0157378_10431064 Ga0157378_104310642 109
101 3300013307 Ga0157372_10256413 Ga0157372_102564132 109
102 3300013308 Ga0157375_13401230 Ga0157375_134012301 109
103 3300014325 Ga0163163_11303242 Ga0163163_113032422 109
104 3300014745 Ga0157377_11292200 Ga0157377_112922002 109
105 3300020070 Ga0206356_10025658 Ga0206356_100256584 109
106 3300021384 Ga0213876_10003843 Ga0213876_100038433 109
107 3300025913 Ga0207695_10308975 Ga0207695_103089751 109
108 3300025918 Ga0207662_10244398 Ga0207662_102443982 109
109 3300025942 Ga0207689_10268527 Ga0207689_102685271 109
110 3300025944 Ga0207661_10538702 Ga0207661_105387021 109
111 3300025944 Ga0207661_11003668 Ga0207661_110036682 109
112 3300025944 Ga0207661_12108828 Ga0207661_121088281 109
113 3300025949 Ga0207667_10117329 Ga0207667_101173292 109
114 3300026035 Ga0207703_11687115 Ga0207703_116871151 109
115 3300026041 Ga0207639_10095202 Ga0207639_100952022 109
116 3300026041 Ga0207639_10734988 Ga0207639_107349882 109
117 3300026075 Ga0207708_11595477 Ga0207708_115954771 109
118 3300026088 Ga0207641_10098653 Ga0207641_100986533 109
119 3300026142 Ga0207698_10084136 Ga0207698_100841363 109
120 3300028379 Ga0268266_10000063 Ga0268266_10000063177 109
121 3300028800 Ga0265338_10237422 Ga0265338_102374222 109
122 3300035724 Ga0373933_0089238 Ga0373933_0089238_796_1125 109
123 3300039437 Ga0436365_0257345 Ga0436365_0257345_12843_13172 109
124 3300039437 Ga0436365_0326668 Ga0436365_0326668_250_579 109
125 3300039450 Ga0436363_0729632 Ga0436363_0729632_34_363 109
126 3300039453 Ga0436362_0514603 Ga0436362_0514603_157_486 109
127 3300046528 Ga0495642_0006165 Ga0495642_0006165_3556_3885 109
128 3300046694 Ga0495649_0001783 Ga0495649_0001783_3719_4048 109
129 3300048917 Ga0496114_0315462 Ga0496114_0315462_76_405 109
130 3300048925 Ga0496122_0301897 Ga0496122_0301897_446_775 109
131 3300050516 nmdc:mga0sz30_9642_c1 nmdc:mga0sz30_9642_c1_955_1284 109
132 3300053093 Ga0500651_0003564 Ga0500651_0003564_4161_4490 109
133 3300053136 Ga0500559_0000159 Ga0500559_0000159_8176_8517 109
134 3300053140 Ga0500573_0368594 Ga0500573_0368594_314_646 109
135 3300005367 Ga0070667_101278109 Ga0070667_1012781092 110
136 3300025986 Ga0207658_11697943 Ga0207658_116979431 110
137 3300053140 Ga0500573_0105812 Ga0500573_0105812_780_1124 110
138 3300053142 Ga0500577_0241101 Ga0500577_0241101_338_682 110
139 3300005337 Ga0070682_100669828 Ga0070682_1006698282 111
140 3300013307 Ga0157372_11637800 Ga0157372_116378002 111
141 3300025934 Ga0207686_10005543 Ga0207686_100055435 111
142 3300037471 Ga0395905_0003027 Ga0395905_0003027_2865_3200 111
143 3300037471 Ga0395905_0536506 Ga0395905_0536506_537_872 111
144 3300038443 Ga0395901_0072396 Ga0395901_0072396_3036_3371 111
145 3300005331 Ga0070670_100274239 Ga0070670_1002742392 112
146 3300005548 Ga0070665_101634914 Ga0070665_1016349141 112
147 3300005577 Ga0068857_100327152 Ga0068857_1003271521 112
148 3300006195 Ga0075366_10307048 Ga0075366_103070482 112
149 3300006353 Ga0075370_10175410 Ga0075370_101754102 112
150 3300014325 Ga0163163_10337597 Ga0163163_103375971 112
151 3300028379 Ga0268266_11089599 Ga0268266_110895992 112
152 3300031548 Ga0307408_100846526 Ga0307408_1008465262 112
153 3300031824 Ga0307413_10014005 Ga0307413_100140053 112
154 3300031852 Ga0307410_10399927 Ga0307410_103999272 112
155 3300031903 Ga0307407_11159696 Ga0307407_111596962 112
156 3300031995 Ga0307409_100726941 Ga0307409_1007269412 112
157 3300032004 Ga0307414_10026615 Ga0307414_100266154 112
158 3300032005 Ga0307411_10826999 Ga0307411_108269992 112
159 3300032126 Ga0307415_101339893 Ga0307415_1013398932 112
160 3300037418 Ga0395900_1691397 Ga0395900_1691397_28_366 112
161 3300037471 Ga0395905_0822524 Ga0395905_0822524_195_533 112
162 3300042010 Ga0439452_061057 Ga0439452_061057_436_774 112
163 3300042131 Ga0450894_036760 Ga0450894_036760_64_402 112
164 3300044842 Ga0466957_1348563 Ga0466957_1348563_109_462 112
165 3300046616 Ga0495668_0395301 Ga0495668_0395301_187_525 112
166 3300046660 Ga0495625_0009232 Ga0495625_0009232_646_984 112
167 3300050493 nmdc:mga0k408_852361_c1 nmdc:mga0k408_852361_c1_32_370 112
168 3300050496 nmdc:mga07m45_164192_c1 nmdc:mga07m45_164192_c1_562_900 112
169 3300053087 Ga0500643_010520 Ga0500643_010520_43_381 112
170 3300053092 Ga0500583_0135666 Ga0500583_0135666_770_1108 112
171 3300053098 Ga0500650_0032361 Ga0500650_0032361_2024_2362 112
172 3300053104 Ga0500556_0000027 Ga0500556_0000027_28956_29294 112
173 3300053105 Ga0500557_055871 Ga0500557_055871_769_1107 112
174 3300053130 Ga0500642_0000003 Ga0500642_0000003_399895_400233 112
175 3300001915 JGI24741J21665_1008580 JGI24741J21665_10085802 113
176 3300001979 JGI24740J21852_10009763 JGI24740J21852_100097632 113
177 3300001989 JGI24739J22299_10049746 JGI24739J22299_100497462 113
178 3300001990 JGI24737J22298_10037530 JGI24737J22298_100375302 113
179 3300002067 JGI24735J21928_10007523 JGI24735J21928_100075232 113
180 3300002067 JGI24735J21928_10018443 JGI24735J21928_100184431 113
181 3300002067 JGI24735J21928_10059889 JGI24735J21928_100598892 113
182 3300002075 JGI24738J21930_10086012 JGI24738J21930_100860121 113
183 3300005262 Ga0065165_1001694 Ga0065165_10016945 113
184 3300005327 Ga0070658_10038624 Ga0070658_100386242 113
185 3300005327 Ga0070658_10079799 Ga0070658_100797992 113
186 3300005327 Ga0070658_10250236 Ga0070658_102502361 113
187 3300005327 Ga0070658_10358579 Ga0070658_103585792 113
188 3300005327 Ga0070658_10619283 Ga0070658_106192831 113
189 3300005327 Ga0070658_10629562 Ga0070658_106295622 113
190 3300005327 Ga0070658_10699969 Ga0070658_106999692 113
191 3300005337 Ga0070682_100302988 Ga0070682_1003029881 113
192 3300005337 Ga0070682_100923989 Ga0070682_1009239891 113
193 3300005339 Ga0070660_100070826 Ga0070660_1000708262 113
194 3300005339 Ga0070660_100296233 Ga0070660_1002962331 113
195 3300005339 Ga0070660_100363576 Ga0070660_1003635761 113
196 3300005339 Ga0070660_100943068 Ga0070660_1009430682 113
197 3300005344 Ga0070661_100486023 Ga0070661_1004860232 113
198 3300005353 Ga0070669_100433829 Ga0070669_1004338293 113
199 3300005366 Ga0070659_100064948 Ga0070659_1000649482 113
200 3300005366 Ga0070659_100286949 Ga0070659_1002869492 113
201 3300005436 Ga0070713_100945196 Ga0070713_1009451961 113
202 3300005436 Ga0070713_101490816 Ga0070713_1014908161 113
203 3300005455 Ga0070663_100138343 Ga0070663_1001383432 113
204 3300005455 Ga0070663_100251231 Ga0070663_1002512312 113
205 3300005455 Ga0070663_100374212 Ga0070663_1003742122 113
206 3300005457 Ga0070662_100069992 Ga0070662_1000699924 113
207 3300005458 Ga0070681_10512975 Ga0070681_105129751 113
208 3300005530 Ga0070679_100273515 Ga0070679_1002735152 113
209 3300005530 Ga0070679_100988355 Ga0070679_1009883552 113
210 3300005530 Ga0070679_101697354 Ga0070679_1016973541 113
211 3300005535 Ga0070684_100147152 Ga0070684_1001471521 113
212 3300005546 Ga0070696_100965869 Ga0070696_1009658692 113
213 3300005564 Ga0070664_100648140 Ga0070664_1006481402 113
214 3300005577 Ga0068857_101698123 Ga0068857_1016981231 113
215 3300005578 Ga0068854_100494970 Ga0068854_1004949702 113
216 3300005614 Ga0068856_100685816 Ga0068856_1006858161 113
217 3300009176 Ga0105242_10850613 Ga0105242_108506132 113
218 3300013100 Ga0157373_10050371 Ga0157373_100503711 113
219 3300013100 Ga0157373_11045507 Ga0157373_110455071 113
220 3300013102 Ga0157371_10169783 Ga0157371_101697832 113
221 3300013102 Ga0157371_10290702 Ga0157371_102907021 113
222 3300013102 Ga0157371_10790050 Ga0157371_107900502 113
223 3300013104 Ga0157370_11130779 Ga0157370_111307792 113
224 3300013105 Ga0157369_10725802 Ga0157369_107258022 113
225 3300013296 Ga0157374_10663348 Ga0157374_106633482 113
226 3300013307 Ga0157372_10093647 Ga0157372_100936472 113
227 3300013307 Ga0157372_10160850 Ga0157372_101608502 113
228 3300013307 Ga0157372_10374016 Ga0157372_103740162 113
229 3300013307 Ga0157372_10685277 Ga0157372_106852772 113
230 3300025302 Ga0207426_1109898 Ga0207426_11098982 113
231 3300025893 Ga0207682_10391440 Ga0207682_103914401 113
232 3300025904 Ga0207647_10115239 Ga0207647_101152392 113
233 3300025904 Ga0207647_10231026 Ga0207647_102310262 113
234 3300025909 Ga0207705_10048091 Ga0207705_100480913 113
235 3300025909 Ga0207705_10199908 Ga0207705_101999082 113
236 3300025909 Ga0207705_10282589 Ga0207705_102825892 113
237 3300025909 Ga0207705_10427279 Ga0207705_104272792 113
238 3300025909 Ga0207705_10457183 Ga0207705_104571831 113
239 3300025909 Ga0207705_10746834 Ga0207705_107468342 113
240 3300025909 Ga0207705_11160894 Ga0207705_111608941 113
241 3300025912 Ga0207707_10416249 Ga0207707_104162491 113
242 3300025917 Ga0207660_10061663 Ga0207660_100616632 113
243 3300025917 Ga0207660_11191444 Ga0207660_111914441 113
244 3300025919 Ga0207657_10129440 Ga0207657_101294401 113
245 3300025919 Ga0207657_10697079 Ga0207657_106970792 113
246 3300025920 Ga0207649_10162225 Ga0207649_101622252 113
247 3300025920 Ga0207649_10195504 Ga0207649_101955042 113
248 3300025921 Ga0207652_10052569 Ga0207652_100525692 113
249 3300025929 Ga0207664_10290798 Ga0207664_102907981 113
250 3300025932 Ga0207690_10023281 Ga0207690_100232814 113
251 3300025932 Ga0207690_10144785 Ga0207690_101447852 113
252 3300025932 Ga0207690_10765783 Ga0207690_107657832 113
253 3300025933 Ga0207706_10005173 Ga0207706_1000517311 113
254 3300025933 Ga0207706_11553004 Ga0207706_115530041 113
255 3300025944 Ga0207661_10132070 Ga0207661_101320702 113
256 3300025945 Ga0207679_10116039 Ga0207679_101160392 113
257 3300025949 Ga0207667_11011156 Ga0207667_110111561 113
258 3300025981 Ga0207640_11917677 Ga0207640_119176771 113
259 3300026041 Ga0207639_10831851 Ga0207639_108318511 113
260 3300026067 Ga0207678_10025172 Ga0207678_100251722 113
261 3300026067 Ga0207678_10149450 Ga0207678_101494502 113
262 3300026067 Ga0207678_10171872 Ga0207678_101718722 113
263 3300026116 Ga0207674_10030183 Ga0207674_100301832 113
264 3300027111 Ga0209281_1020130 Ga0209281_10201302 113
265 3300030731 Ga0316177_1114600 Ga0316177_11146002 113
266 3300032005 Ga0307411_11964711 Ga0307411_119647112 113
267 3300035111 Ga0373923_0009702 Ga0373923_0009702_2970_3320 113
268 3300035117 Ga0373953_0173284 Ga0373953_0173284_546_896 113
269 3300035118 Ga0373954_0011576 Ga0373954_0011576_498_848 113
270 3300035119 Ga0373956_0082430 Ga0373956_0082430_778_1128 113
271 3300035120 Ga0373957_0077268 Ga0373957_0077268_19_369 113
272 3300035172 Ga0373955_0002880 Ga0373955_0002880_5762_6112 113
273 3300035724 Ga0373933_1101384 Ga0373933_1101384_159_509 113
274 3300036401 Ga0373937_0017988 Ga0373937_0017988_3852_4202 113
275 3300037418 Ga0395900_0903122 Ga0395900_0903122_84_425 113
276 3300041404 Ga0439436_0040786 Ga0439436_0040786_205_546 113
277 3300041405 Ga0439438_101091 Ga0439438_101091_207_548 113
278 3300042000 Ga0439437_037171 Ga0439437_037171_40_393 113
279 3300042125 Ga0450923_005367 Ga0450923_005367_475_816 113
280 3300042130 Ga0450892_010449 Ga0450892_010449_187_540 113
281 3300042144 Ga0450889_040652 Ga0450889_040652_209_550 113
282 3300042435 Ga0439434_0033802 Ga0439434_0033802_12_353 113
283 3300044694 Ga0466963_0023091 Ga0466963_0023091_2374_2715 113
284 3300046453 Ga0495627_018068 Ga0495627_018068_1093_1434 113
285 3300046525 Ga0495663_0189531 Ga0495663_0189531_41_382 113
286 3300047318 Ga0495636_0147682 Ga0495636_0147682_84_425 113
287 3300047470 Ga0495681_0055414 Ga0495681_0055414_1348_1689 113
288 3300047472 Ga0495686_0000600 Ga0495686_0000600_32894_33235 113
289 3300048088 Ga0495602_0090620 Ga0495602_0090620_701_1051 113
290 3300048904 Ga0496101_0803302 Ga0496101_0803302_103_444 113
291 3300048928 Ga0496125_0147638 Ga0496125_0147638_217_558 113
292 3300048929 Ga0496126_0790501 Ga0496126_0790501_133_474 113
293 3300053108 Ga0500562_010256 Ga0500562_010256_1329_1670 113
294 3300053151 Ga0500604_0153146 Ga0500604_0153146_44_385 113
295 3300053158 Ga0500627_0300688 Ga0500627_0300688_256_597 113

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

21

93

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ejo-assembly1.cif.gz_A-2 crystal structure of padr family transcriptional regulator from eggerthella lenta dsm 2243 0.9482 5 112
5x11-assembly1.cif.gz_A crystal structure of bacillus subtilis padr in complex with operator dna 0.9365 19 95
5x11-assembly4.cif.gz_H crystal structure of bacillus subtilis padr in complex with operator dna 0.9313 19 95
5x11-assembly3.cif.gz_D crystal structure of bacillus subtilis padr in complex with operator dna 0.9293 19 95
5x11-assembly1.cif.gz_B crystal structure of bacillus subtilis padr in complex with operator dna 0.9292 19 95
ID Description Score Start End Superfamily
5x11A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9298 19 95 1.10.10.10
5dymA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9252 19 108 1.10.10.10
4ejoA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9218 6 112 1.10.10.10
3ri2B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9095 6 108 1.10.10.10
af_Q57682_5_95_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9015 24 85 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A160IK66-F1-model_v4 PadR family transcriptional regulator 0.9886 6 108
AF-A0A4Q7YQ82-F1-model_v4 PadR family transcriptional regulator PadR 0.9876 6 111
AF-A0A519L127-F1-model_v4 PadR family transcriptional regulator 0.987 12 107
AF-A0A2V9YD09-F1-model_v4 PadR family transcriptional regulator 0.9859 6 110
AF-A0A846MV15-F1-model_v4 DNA-binding PadR family transcriptional regulator 0.9857 14 110 GO:0003677

Feature Viewer

pLDDT pTM Quality
94.5 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map