F392794

General Info

Members Datasets Scaffolds Average Seq Length
295 136 590 96

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_1000988|Ga0466967_1000988_361_708
Length 115
Sequence VRKDDDAALRHRPRSLFCGVMSQTVELPRVGGPGTGSGGIWRVVVLNDDYNTFDHVAETLARFIPGVTLAEGYRFADRIHNTGCAIVWSGPREDAEDHWQQLDDAGLTMAPLEAG

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
3 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
4 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
15 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
16 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
17 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
18 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
19 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
20 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
21 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
22 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
23 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
24 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
36 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
37 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
38 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
39 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
53 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
54 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
55 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
56 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
57 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
58 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
59 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
60 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
61 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
62 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
63 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
64 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
65 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
66 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
67 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
68 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
69 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
70 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
71 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
72 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
73 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
74 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
75 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
76 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
77 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
78 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
79 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
80 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
81 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
82 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
83 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
84 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
85 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
86 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
87 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
88 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
89 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
90 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
91 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
92 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
93 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
94 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
95 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
96 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
97 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
98 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
99 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
100 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
101 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
102 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
103 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
104 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
105 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
106 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
107 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
108 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
109 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
110 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
111 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
112 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
113 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
114 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
115 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
116 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
117 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
118 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
119 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
120 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
121 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
122 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
123 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
124 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
125 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
126 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
127 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
128 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
129 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
130 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
131 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
132 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
133 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
134 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
135 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
136 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.03
Rhizosphere 85.08
Stem 0
Stem Tuber 0
Unclassified 12.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_1000988 3300045976 Bacteria 832
2 Ga0070692_10001399 3300005345 Bacteria 8734
3 Ga0070668_100473101 3300005347 Bacteria 1081
4 Ga0070659_100835928 3300005366 Bacteria 802
5 Ga0070709_10608908 3300005434 Bacteria 842
6 Ga0070714_100059515 3300005435 Bacteria 3276
7 Ga0070714_100080972 3300005435 Bacteria 2826
8 Ga0070714_100093803 3300005435 Bacteria 2633
9 Ga0070714_100512304 3300005435 Bacteria 1145
10 Ga0070714_100900775 3300005435 Bacteria 859
11 Ga0070714_101119651 3300005435 Bacteria 767
12 Ga0070714_101294065 3300005435 Bacteria 712
13 Ga0070714_101945741 3300005435 Unclassified 574
14 Ga0070713_100016399 3300005436 Bacteria 5570
15 Ga0070713_100024230 3300005436 Bacteria 4724
16 Ga0070713_100119633 3300005436 Bacteria 2308
17 Ga0070713_100420967 3300005436 Bacteria 1250
18 Ga0070713_100944026 3300005436 Bacteria 831
19 Ga0070713_102242923 3300005436 Unclassified 529
20 Ga0070710_10003276 3300005437 Bacteria 7678
21 Ga0070710_10568727 3300005437 Bacteria 785
22 Ga0070710_11124292 3300005437 Bacteria 578
23 Ga0070711_100207662 3300005439 Bacteria 1515
24 Ga0070711_100962645 3300005439 Unclassified 731
25 Ga0070711_101140590 3300005439 Unclassified 673
26 Ga0070711_101195270 3300005439 Unclassified 657
27 Ga0068867_100348046 3300005459 Bacteria 1236
28 Ga0070679_100906794 3300005530 Bacteria 825
29 Ga0070684_100423736 3300005535 Bacteria 1229
30 Ga0068856_100359777 3300005614 Bacteria 1474
31 Ga0068856_100529450 3300005614 Bacteria 1200
32 Ga0070702_100980176 3300005615 Bacteria 668
33 Ga0081538_10006891 3300005981 Bacteria 9890
34 Ga0070717_10014037 3300006028 Bacteria 6156
35 Ga0070717_10057414 3300006028 Bacteria 3217
36 Ga0070717_10070009 3300006028 Bacteria 2922
37 Ga0070717_10176089 3300006028 Bacteria 1862
38 Ga0070717_11058552 3300006028 Unclassified 739
39 Ga0075432_10173366 3300006058 Unclassified 840
40 Ga0070712_100032504 3300006175 Bacteria 3525
41 Ga0070712_101220964 3300006175 Unclassified 654
42 Ga0075431_100127095 3300006847 Bacteria 2630
43 Ga0075433_10130065 3300006852 Bacteria 2237
44 Ga0075434_102120546 3300006871 Unclassified 566
45 Ga0075429_100041041 3300006880 Bacteria 4030
46 Ga0075436_100331462 3300006914 Unclassified 1095
47 Ga0075435_100081936 3300007076 Bacteria 2651
48 Ga0105240_12178848 3300009093 Bacteria 575
49 Ga0111539_10024101 3300009094 Bacteria 7473
50 Ga0111539_10154718 3300009094 Bacteria 2683
51 Ga0111539_10530178 3300009094 Bacteria 1372
52 Ga0111539_11250486 3300009094 Bacteria 862
53 Ga0105245_10497853 3300009098 Bacteria 1234
54 Ga0114129_10008993 3300009147 Bacteria 14245
55 Ga0114129_10996828 3300009147 Bacteria 1055
56 Ga0105243_10443320 3300009148 Bacteria 1216
57 Ga0105242_10969987 3300009176 Bacteria 855
58 Ga0105238_10904591 3300009551 Bacteria 901
59 Ga0105249_10614319 3300009553 Bacteria 1143
60 Ga0105239_12064498 3300010375 Bacteria 662
61 Ga0157369_11558411 3300013105 Bacteria 672
62 Ga0213873_10141036 3300021358 Bacteria 720
63 Ga0213874_10028123 3300021377 Bacteria 1605
64 Ga0213874_10039563 3300021377 Bacteria 1405
65 Ga0213876_10009002 3300021384 Bacteria 5380
66 Ga0213876_10019373 3300021384 Bacteria 3595
67 Ga0213876_10097174 3300021384 Bacteria 1560
68 Ga0213876_10192515 3300021384 Bacteria 1084
69 Ga0213875_10000092 3300021388 Bacteria 104416
70 Ga0213875_10094106 3300021388 Bacteria 1397
71 Ga0213875_10105804 3300021388 Bacteria 1314
72 Ga0213875_10181137 3300021388 Bacteria 990
73 Ga0213875_10414601 3300021388 Bacteria 643
74 Ga0213875_10671873 3300021388 Unclassified 502
75 Ga0224712_10626561 3300022467 Bacteria 526
76 Ga0207692_10621722 3300025898 Bacteria 696
77 Ga0207699_10418440 3300025906 Bacteria 957
78 Ga0207693_10007718 3300025915 Bacteria 8834
79 Ga0207693_10010639 3300025915 Bacteria 7464
80 Ga0207693_10490242 3300025915 Unclassified 959
81 Ga0207663_10063497 3300025916 Bacteria 2352
82 Ga0207663_10293786 3300025916 Unclassified 1211
83 Ga0207657_10153821 3300025919 Bacteria 1872
84 Ga0207652_10565077 3300025921 Bacteria 1022
85 Ga0207700_10062012 3300025928 Bacteria 2838
86 Ga0207700_10146931 3300025928 Bacteria 1944
87 Ga0207700_10179320 3300025928 Bacteria 1773
88 Ga0207700_11068820 3300025928 Bacteria 722
89 Ga0207700_11164990 3300025928 Bacteria 688
90 Ga0207700_11373898 3300025928 Bacteria 628
91 Ga0207664_10003851 3300025929 Bacteria 10077
92 Ga0207664_10314112 3300025929 Bacteria 1381
93 Ga0207664_10565508 3300025929 Bacteria 1020
94 Ga0207664_10858738 3300025929 Bacteria 816
95 Ga0207664_11072595 3300025929 Bacteria 721
96 Ga0207664_11141981 3300025929 Unclassified 696
97 Ga0207664_11554873 3300025929 Bacteria 583
98 Ga0207664_11583146 3300025929 Unclassified 577
99 Ga0207709_11703575 3300025935 Bacteria 524
100 Ga0207661_10345792 3300025944 Bacteria 1341
101 Ga0207661_10704720 3300025944 Bacteria 929
102 Ga0207702_10792026 3300026078 Bacteria 937
103 Ga0207702_10902568 3300026078 Bacteria 875
104 Ga0207698_10770982 3300026142 Bacteria 962
105 Ga0207428_10114709 3300027907 Bacteria 2070
106 Ga0207428_10157275 3300027907 Bacteria 1728
107 Ga0207428_10304578 3300027907 Bacteria 1179
108 Ga0373953_0134083 3300035117 Bacteria 1057
109 Ga0373954_0365455 3300035118 Bacteria 713
110 Ga0373956_0523531 3300035119 Unclassified 566
111 Ga0373924_0088395 3300035410 Bacteria 1324
112 Ga0373933_0015065 3300035724 Bacteria 4310
113 Ga0373947_0518252 3300035725 Bacteria 811
114 Ga0373937_0035269 3300036401 Bacteria 4552
115 Ga0395900_1140898 3300037418 Bacteria 696
116 Ga0436364_0044072 3300037853 Bacteria 589
117 Ga0436364_0053237 3300037853 Bacteria 4648
118 Ga0436364_0054966 3300037853 Bacteria 28517
119 Ga0436364_0082896 3300037853 Bacteria 13727
120 Ga0436364_0517926 3300037853 Bacteria 1522
121 Ga0436364_0527355 3300037853 Bacteria 148076
122 Ga0436364_0649270 3300037853 Bacteria 538
123 Ga0436364_0774009 3300037853 Bacteria 1484
124 Ga0436364_0789438 3300037853 Bacteria 774
125 Ga0436364_1218140 3300037853 Bacteria 840
126 Ga0436364_1271682 3300037853 Bacteria 693
127 Ga0436364_1487797 3300037853 Bacteria 1367
128 Ga0436365_0193697 3300039437 Bacteria 2389
129 Ga0436365_0303456 3300039437 Bacteria 1010
130 Ga0436365_0598500 3300039437 Bacteria 2913
131 Ga0436365_0621520 3300039437 Bacteria 22917
132 Ga0436365_0655597 3300039437 Unclassified 753
133 Ga0436365_1088451 3300039437 Bacteria 12629
134 Ga0436365_1786903 3300039437 Bacteria 16416
135 Ga0436360_0755622 3300039438 Bacteria 635
136 Ga0436361_0309202 3300039447 Bacteria 527
137 Ga0436363_0293532 3300039450 Unclassified 985
138 Ga0436363_0709839 3300039450 Unclassified 945
139 Ga0436363_0737674 3300039450 Bacteria 677
140 Ga0436363_0943234 3300039450 Bacteria 8284
141 Ga0436363_1368058 3300039450 Bacteria 1472
142 Ga0436363_1411475 3300039450 Bacteria 1222
143 Ga0436363_1679712 3300039450 Bacteria 1881
144 Ga0436362_0123191 3300039453 Bacteria 4131
145 Ga0436362_0429489 3300039453 Bacteria 559
146 Ga0436362_0585050 3300039453 Bacteria 826
147 Ga0436362_0609420 3300039453 Unclassified 552
148 Ga0436362_0985433 3300039453 Bacteria 1257
149 Ga0436362_1157879 3300039453 Bacteria 1061
150 Ga0466969_0064790 3300044656 Bacteria 1768
151 Ga0466969_0161134 3300044656 Bacteria 1031
152 Ga0466969_0327900 3300044656 Bacteria 693
153 Ga0466965_0083542 3300044683 Bacteria 1617
154 Ga0466965_0268342 3300044683 Unclassified 919
155 Ga0466965_0444605 3300044683 Unclassified 721
156 Ga0466965_0580096 3300044683 Bacteria 635
157 Ga0466966_0012048 3300044684 Bacteria 5731
158 Ga0466966_0044345 3300044684 Bacteria 2847
159 Ga0466966_0081484 3300044684 Bacteria 2015
160 Ga0466966_0654285 3300044684 Bacteria 633
161 Ga0466961_0008101 3300044693 Bacteria 6694
162 Ga0466961_0009225 3300044693 Bacteria 6283
163 Ga0466961_0026756 3300044693 Bacteria 3708
164 Ga0466961_0036344 3300044693 Bacteria 3162
165 Ga0466963_0040742 3300044694 Bacteria 3045
166 Ga0466963_0105512 3300044694 Bacteria 1931
167 Ga0466963_0146984 3300044694 Bacteria 1636
168 Ga0466963_0774599 3300044694 Bacteria 677
169 Ga0466964_0525638 3300044706 Bacteria 639
170 Ga0466971_0037001 3300044719 Bacteria 2188
171 Ga0466971_0141479 3300044719 Bacteria 1120
172 Ga0466971_0495727 3300044719 Bacteria 602
173 Ga0466971_0509626 3300044719 Unclassified 594
174 Ga0466968_0003496 3300044735 Bacteria 5810
175 Ga0466968_0186696 3300044735 Bacteria 966
176 Ga0466968_0447109 3300044735 Bacteria 639
177 Ga0466968_0557484 3300044735 Bacteria 575
178 Ga0466970_0051015 3300044765 Unclassified 2207
179 Ga0466970_0051919 3300044765 Bacteria 2189
180 Ga0466970_0099395 3300044765 Bacteria 1584
181 Ga0466970_0597908 3300044765 Bacteria 640
182 Ga0466970_0735620 3300044765 Bacteria 576
183 Ga0466970_0750121 3300044765 Unclassified 570
184 Ga0466957_0019093 3300044842 Bacteria 4031
185 Ga0466957_0019627 3300044842 Bacteria 3976
186 Ga0466957_0068765 3300044842 Bacteria 2187
187 Ga0466957_0110497 3300044842 Unclassified 1743
188 Ga0466957_0701478 3300044842 Bacteria 714
189 Ga0466957_1342126 3300044842 Bacteria 520
190 Ga0466959_0005555 3300045049 Bacteria 8654
191 Ga0466959_0007235 3300045049 Bacteria 7774
192 Ga0466959_0017084 3300045049 Bacteria 5313
193 Ga0466959_0018206 3300045049 Bacteria 5156
194 Ga0466959_0061195 3300045049 Bacteria 2738
195 Ga0466959_0105419 3300045049 Bacteria 2016
196 Ga0466959_0215311 3300045049 Unclassified 1334
197 Ga0466959_0654435 3300045049 Bacteria 705
198 Ga0466959_1059098 3300045049 Unclassified 540
199 Ga0466958_0005321 3300045836 Bacteria 6909
200 Ga0466958_0008312 3300045836 Bacteria 5747
201 Ga0466958_0034514 3300045836 Bacteria 3018
202 Ga0466958_0062329 3300045836 Bacteria 2273
203 Ga0466958_0067298 3300045836 Bacteria 2188
204 Ga0466958_0139790 3300045836 Bacteria 1524
205 Ga0466958_0142140 3300045836 Unclassified 1511
206 Ga0466958_0451549 3300045836 Bacteria 832
207 Ga0466967_0125373 3300045976 Bacteria 2378
208 Ga0466967_0281339 3300045976 Bacteria 1596
209 Ga0466967_0495254 3300045976 Bacteria 1199
210 Ga0466967_0560490 3300045976 Unclassified 1125
211 Ga0466967_0607730 3300045976 Bacteria 1080
212 Ga0466967_0708313 3300045976 Bacteria 997
213 Ga0466967_1017072 3300045976 Bacteria 825
214 Ga0466967_1412527 3300045976 Bacteria 693
215 Ga0466967_1943943 3300045976 Bacteria 585
216 Ga0466967_2055657 3300045976 Bacteria 568
217 Ga0495592_0042258 3300046454 Bacteria 3414
218 Ga0495651_0051936 3300046462 Bacteria 3159
219 Ga0495653_0044443 3300046463 Bacteria 3447
220 Ga0495662_0110727 3300046476 Bacteria 1346
221 Ga0495664_0258609 3300046477 Bacteria 1053
222 Ga0495664_0396620 3300046477 Bacteria 829
223 Ga0495596_0135564 3300046500 Bacteria 956
224 Ga0495606_0669242 3300046507 Bacteria 500
225 Ga0495608_0005009 3300046511 Bacteria 9475
226 Ga0495618_0224361 3300046514 Bacteria 1184
227 Ga0495618_0856169 3300046514 Bacteria 527
228 Ga0495628_0026435 3300046516 Bacteria 4732
229 Ga0495630_0802965 3300046517 Bacteria 718
230 Ga0495631_0117679 3300046518 Bacteria 1143
231 Ga0495652_0045730 3300046529 Bacteria 3761
232 Ga0495652_0322277 3300046529 Bacteria 1116
233 Ga0495640_0341423 3300046533 Bacteria 925
234 Ga0495587_0027418 3300046536 Bacteria 3469
235 Ga0495645_0232393 3300046543 Bacteria 1235
236 Ga0495667_0012775 3300046559 Bacteria 5689
237 Ga0495667_0870259 3300046559 Unclassified 553
238 Ga0495667_1014811 3300046559 Unclassified 506
239 Ga0495635_0024761 3300046663 Bacteria 4183
240 Ga0495635_0171562 3300046663 Bacteria 1475
241 Ga0495657_0011171 3300046675 Bacteria 6726
242 Ga0495657_0100467 3300046675 Bacteria 1844
243 Ga0495599_0466982 3300046678 Bacteria 746
244 Ga0495623_0060322 3300046679 Bacteria 2380
245 Ga0495646_0044630 3300046680 Bacteria 2710
246 Ga0495613_0050139 3300046689 Bacteria 3079
247 Ga0495624_0634123 3300046690 Bacteria 636
248 Ga0495671_0520849 3300046692 Bacteria 567
249 Ga0495600_0009190 3300046809 Bacteria 6098
250 Ga0495581_0060667 3300047315 Bacteria 2186
251 Ga0495604_0030187 3300047317 Bacteria 4308
252 Ga0495604_0613061 3300047317 Bacteria 697
253 Ga0495674_0024641 3300047319 Bacteria 5523
254 Ga0495676_0923353 3300047321 Bacteria 559
255 Ga0495680_0012770 3300047322 Bacteria 7366
256 Ga0495675_0118400 3300047444 Bacteria 1650
257 Ga0495677_0219455 3300047445 Bacteria 741
258 Ga0495684_0008043 3300047471 Bacteria 8154
259 Ga0495684_1037011 3300047471 Bacteria 519
260 Ga0495593_0178102 3300047673 Bacteria 1071
261 Ga0495602_0015459 3300048088 Bacteria 7700
262 Ga0495602_0428612 3300048088 Bacteria 938
263 Ga0496102_1187946 3300048905 Bacteria 682
264 Ga0496104_0224049 3300048907 Bacteria 1793
265 Ga0496105_0329123 3300048908 Bacteria 1223
266 Ga0496113_1236584 3300048916 Unclassified 582
267 Ga0496114_1050255 3300048917 Unclassified 699
268 Ga0496115_1346998 3300048918 Unclassified 529
269 Ga0501081_0808196 3300049743 Bacteria 706
270 Ga0501081_0880089 3300049743 Bacteria 675
271 nmdc:mga05p37_14987_c1 3300050507 Bacteria 9306
272 nmdc:mga05p37_77680_c1 3300050507 Bacteria 4087
273 nmdc:mga09592_3535_c1 3300050508 Bacteria 12615
274 nmdc:mga0qj67_523462_c1 3300050509 Bacteria 952
275 nmdc:mga06r32_10753_c1 3300050510 Bacteria 8242
276 nmdc:mga08y16_20500_c1 3300050511 Bacteria 6978
277 nmdc:mga08y16_25385_c1 3300050511 Bacteria 6249
278 nmdc:mga08y16_345796_c1 3300050511 Bacteria 1528
279 nmdc:mga0n895_259473_c1 3300050512 Bacteria 1764
280 nmdc:mga0rr50_362147_c1 3300050513 Bacteria 1221
281 nmdc:mga0rr50_881567_c1 3300050513 Bacteria 763
282 nmdc:mga08x19_48605_c1 3300050514 Bacteria 2718
283 nmdc:mga0a205_91582_c1 3300050515 Bacteria 2938
284 Ga0495601_0060716 3300053077 Bacteria 2399
285 Ga0495612_0063938 3300053078 Bacteria 1527
286 Ga0495612_0576900 3300053078 Bacteria 519
287 Ga0495655_0033834 3300053083 Bacteria 1261
288 Ga0495595_0029215 3300053084 Bacteria 2466
289 Ga0495619_0004679 3300053085 Bacteria 8718
290 Ga0495619_0311742 3300053085 Bacteria 1090
291 Ga0495619_0757273 3300053085 Bacteria 658
292 Ga0466962_0012229 3300061719 Bacteria 4126
293 Ga0466962_0050967 3300061719 Unclassified 1979
294 Ga0466962_0091579 3300061719 Bacteria 1457
295 Ga0466962_0685684 3300061719 Bacteria 525
296 Ga0466967_1000988
297 Ga0070692_10001399
298 Ga0070668_100473101
299 Ga0070659_100835928
300 Ga0070709_10608908
301 Ga0070714_100059515
302 Ga0070714_100080972
303 Ga0070714_100093803
304 Ga0070714_100512304
305 Ga0070714_100900775
306 Ga0070714_101119651
307 Ga0070714_101294065
308 Ga0070714_101945741
309 Ga0070713_100016399
310 Ga0070713_100024230
311 Ga0070713_100119633
312 Ga0070713_100420967
313 Ga0070713_100944026
314 Ga0070713_102242923
315 Ga0070710_10003276
316 Ga0070710_10568727
317 Ga0070710_11124292
318 Ga0070711_100207662
319 Ga0070711_100962645
320 Ga0070711_101140590
321 Ga0070711_101195270
322 Ga0068867_100348046
323 Ga0070679_100906794
324 Ga0070684_100423736
325 Ga0068856_100359777
326 Ga0068856_100529450
327 Ga0070702_100980176
328 Ga0081538_10006891
329 Ga0070717_10014037
330 Ga0070717_10057414
331 Ga0070717_10070009
332 Ga0070717_10176089
333 Ga0070717_11058552
334 Ga0075432_10173366
335 Ga0070712_100032504
336 Ga0070712_101220964
337 Ga0075431_100127095
338 Ga0075433_10130065
339 Ga0075434_102120546
340 Ga0075429_100041041
341 Ga0075436_100331462
342 Ga0075435_100081936
343 Ga0105240_12178848
344 Ga0111539_10024101
345 Ga0111539_10154718
346 Ga0111539_10530178
347 Ga0111539_11250486
348 Ga0105245_10497853
349 Ga0114129_10008993
350 Ga0114129_10996828
351 Ga0105243_10443320
352 Ga0105242_10969987
353 Ga0105238_10904591
354 Ga0105249_10614319
355 Ga0105239_12064498
356 Ga0157369_11558411
357 Ga0213873_10141036
358 Ga0213874_10028123
359 Ga0213874_10039563
360 Ga0213876_10009002
361 Ga0213876_10019373
362 Ga0213876_10097174
363 Ga0213876_10192515
364 Ga0213875_10000092
365 Ga0213875_10094106
366 Ga0213875_10105804
367 Ga0213875_10181137
368 Ga0213875_10414601
369 Ga0213875_10671873
370 Ga0224712_10626561
371 Ga0207692_10621722
372 Ga0207699_10418440
373 Ga0207693_10007718
374 Ga0207693_10010639
375 Ga0207693_10490242
376 Ga0207663_10063497
377 Ga0207663_10293786
378 Ga0207657_10153821
379 Ga0207652_10565077
380 Ga0207700_10062012
381 Ga0207700_10146931
382 Ga0207700_10179320
383 Ga0207700_11068820
384 Ga0207700_11164990
385 Ga0207700_11373898
386 Ga0207664_10003851
387 Ga0207664_10314112
388 Ga0207664_10565508
389 Ga0207664_10858738
390 Ga0207664_11072595
391 Ga0207664_11141981
392 Ga0207664_11554873
393 Ga0207664_11583146
394 Ga0207709_11703575
395 Ga0207661_10345792
396 Ga0207661_10704720
397 Ga0207702_10792026
398 Ga0207702_10902568
399 Ga0207698_10770982
400 Ga0207428_10114709
401 Ga0207428_10157275
402 Ga0207428_10304578
403 Ga0373953_0134083
404 Ga0373954_0365455
405 Ga0373956_0523531
406 Ga0373924_0088395
407 Ga0373933_0015065
408 Ga0373947_0518252
409 Ga0373937_0035269
410 Ga0395900_1140898
411 Ga0436364_0044072
412 Ga0436364_0053237
413 Ga0436364_0054966
414 Ga0436364_0082896
415 Ga0436364_0517926
416 Ga0436364_0527355
417 Ga0436364_0649270
418 Ga0436364_0774009
419 Ga0436364_0789438
420 Ga0436364_1218140
421 Ga0436364_1271682
422 Ga0436364_1487797
423 Ga0436365_0193697
424 Ga0436365_0303456
425 Ga0436365_0598500
426 Ga0436365_0621520
427 Ga0436365_0655597
428 Ga0436365_1088451
429 Ga0436365_1786903
430 Ga0436360_0755622
431 Ga0436361_0309202
432 Ga0436363_0293532
433 Ga0436363_0709839
434 Ga0436363_0737674
435 Ga0436363_0943234
436 Ga0436363_1368058
437 Ga0436363_1411475
438 Ga0436363_1679712
439 Ga0436362_0123191
440 Ga0436362_0429489
441 Ga0436362_0585050
442 Ga0436362_0609420
443 Ga0436362_0985433
444 Ga0436362_1157879
445 Ga0466969_0064790
446 Ga0466969_0161134
447 Ga0466969_0327900
448 Ga0466965_0083542
449 Ga0466965_0268342
450 Ga0466965_0444605
451 Ga0466965_0580096
452 Ga0466966_0012048
453 Ga0466966_0044345
454 Ga0466966_0081484
455 Ga0466966_0654285
456 Ga0466961_0008101
457 Ga0466961_0009225
458 Ga0466961_0026756
459 Ga0466961_0036344
460 Ga0466963_0040742
461 Ga0466963_0105512
462 Ga0466963_0146984
463 Ga0466963_0774599
464 Ga0466964_0525638
465 Ga0466971_0037001
466 Ga0466971_0141479
467 Ga0466971_0495727
468 Ga0466971_0509626
469 Ga0466968_0003496
470 Ga0466968_0186696
471 Ga0466968_0447109
472 Ga0466968_0557484
473 Ga0466970_0051015
474 Ga0466970_0051919
475 Ga0466970_0099395
476 Ga0466970_0597908
477 Ga0466970_0735620
478 Ga0466970_0750121
479 Ga0466957_0019093
480 Ga0466957_0019627
481 Ga0466957_0068765
482 Ga0466957_0110497
483 Ga0466957_0701478
484 Ga0466957_1342126
485 Ga0466959_0005555
486 Ga0466959_0007235
487 Ga0466959_0017084
488 Ga0466959_0018206
489 Ga0466959_0061195
490 Ga0466959_0105419
491 Ga0466959_0215311
492 Ga0466959_0654435
493 Ga0466959_1059098
494 Ga0466958_0005321
495 Ga0466958_0008312
496 Ga0466958_0034514
497 Ga0466958_0062329
498 Ga0466958_0067298
499 Ga0466958_0139790
500 Ga0466958_0142140
501 Ga0466958_0451549
502 Ga0466967_0125373
503 Ga0466967_0281339
504 Ga0466967_0495254
505 Ga0466967_0560490
506 Ga0466967_0607730
507 Ga0466967_0708313
508 Ga0466967_1017072
509 Ga0466967_1412527
510 Ga0466967_1943943
511 Ga0466967_2055657
512 Ga0495592_0042258
513 Ga0495651_0051936
514 Ga0495653_0044443
515 Ga0495662_0110727
516 Ga0495664_0258609
517 Ga0495664_0396620
518 Ga0495596_0135564
519 Ga0495606_0669242
520 Ga0495608_0005009
521 Ga0495618_0224361
522 Ga0495618_0856169
523 Ga0495628_0026435
524 Ga0495630_0802965
525 Ga0495631_0117679
526 Ga0495652_0045730
527 Ga0495652_0322277
528 Ga0495640_0341423
529 Ga0495587_0027418
530 Ga0495645_0232393
531 Ga0495667_0012775
532 Ga0495667_0870259
533 Ga0495667_1014811
534 Ga0495635_0024761
535 Ga0495635_0171562
536 Ga0495657_0011171
537 Ga0495657_0100467
538 Ga0495599_0466982
539 Ga0495623_0060322
540 Ga0495646_0044630
541 Ga0495613_0050139
542 Ga0495624_0634123
543 Ga0495671_0520849
544 Ga0495600_0009190
545 Ga0495581_0060667
546 Ga0495604_0030187
547 Ga0495604_0613061
548 Ga0495674_0024641
549 Ga0495676_0923353
550 Ga0495680_0012770
551 Ga0495675_0118400
552 Ga0495677_0219455
553 Ga0495684_0008043
554 Ga0495684_1037011
555 Ga0495593_0178102
556 Ga0495602_0015459
557 Ga0495602_0428612
558 Ga0496102_1187946
559 Ga0496104_0224049
560 Ga0496105_0329123
561 Ga0496113_1236584
562 Ga0496114_1050255
563 Ga0496115_1346998
564 Ga0501081_0808196
565 Ga0501081_0880089
566 nmdc:mga05p37_14987_c1
567 nmdc:mga05p37_77680_c1
568 nmdc:mga09592_3535_c1
569 nmdc:mga0qj67_523462_c1
570 nmdc:mga06r32_10753_c1
571 nmdc:mga08y16_20500_c1
572 nmdc:mga08y16_25385_c1
573 nmdc:mga08y16_345796_c1
574 nmdc:mga0n895_259473_c1
575 nmdc:mga0rr50_362147_c1
576 nmdc:mga0rr50_881567_c1
577 nmdc:mga08x19_48605_c1
578 nmdc:mga0a205_91582_c1
579 Ga0495601_0060716
580 Ga0495612_0063938
581 Ga0495612_0576900
582 Ga0495655_0033834
583 Ga0495595_0029215
584 Ga0495619_0004679
585 Ga0495619_0311742
586 Ga0495619_0757273
587 Ga0466962_0012229
588 Ga0466962_0050967
589 Ga0466962_0091579
590 Ga0466962_0685684

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02617

ClpS

ATP-dependent Clp protease adaptor protein ClpS

38

114

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7d34-assembly1.cif.gz_B atclps1-peptide complex 0.9388 17 94
4o2x-assembly2.cif.gz_B structure of a malarial protein 0.9116 20 94
4yjx-assembly2.cif.gz_B the structure of agrobacterium tumefaciens clps2 bound to l-phenylalaninamide 0.9116 17 95
7d34-assembly1.cif.gz_B atclps1-peptide complex 0.9054 17 94
4o2x-assembly1.cif.gz_A structure of a malarial protein 0.901 19 95
ID Description Score Start End Superfamily
af_A0A0R0IJ84_76_154_3.30.1390.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS 0.9525 20 93 3.30.1390.10
af_Q8IEB2_84_184_3.30.1390.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS 0.941 18 94 3.30.1390.10
4ykaD00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS 0.9092 17 95 3.30.1390.10
af_A0A0R0IJ84_76_154_3.30.1390.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS 0.8726 20 93 3.30.1390.10
af_Q9VX91_228_322_3.30.1390.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS 0.8651 13 81 3.30.1390.10
ID Description Score Start End GO Terms
AF-A0A2W4VXJ9-F1-model_v4 Clp protease ClpS 0.9741 23 95 GO:0006508
GO:0008233
GO:0030163
AF-A0A4V2PXQ9-F1-model_v4 ATP-dependent Clp protease adaptor protein ClpS 0.9635 20 93 GO:0006508
GO:0008233
GO:0030163
AF-A0A7S2UTQ6-F1-model_v4 Adaptor protein ClpS core domain-containing protein 0.9625 18 94 GO:0006508
GO:0030163
AF-W7FA85-F1-model_v4 Adaptor protein ClpS core domain-containing protein 0.9548 21 94 GO:0006508
GO:0030163
AF-A0A538CPT5-F1-model_v4 Clp protease ClpS 0.9547 23 95 GO:0006508
GO:0008233
GO:0030163

Map