F392780

General Info

Members Datasets Scaffolds Average Seq Length
295 141 590 183

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0230993|Ga0466969_0230993_154_762
Length 202
Sequence MGVTVLYGGAFDPPHLGHVAVADAARKRFGVERLVVLVGERPAHREVHASAEDRLALARAAFPHDDVRLDPYPRTIELLRAERFDDPVFVVGADQFRGFLDWSEPDEVLELTRLAVATRPGFGWSEQKAVLEALDRSDRILFFEIEPNPAASTDARARLVAGESLDDLVPTAVARLIEERGLYHPRAADTLQQKRSEDTSRP

Samples

Sample ID Description Type Environment
1 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
18 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
19 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
20 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
21 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
22 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
23 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
36 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
37 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
38 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
39 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
40 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
41 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
42 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
43 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
44 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
45 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
46 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
47 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
48 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
49 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
50 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
51 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
52 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
53 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
54 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
55 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
56 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
57 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
58 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
59 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
60 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
61 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
62 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
63 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
64 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
65 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
66 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
67 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
68 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
69 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
70 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
71 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
72 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
73 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
74 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
75 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
76 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
77 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
78 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
79 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
80 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
81 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
82 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
83 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
84 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
85 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
86 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
87 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
88 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
89 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
90 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
91 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
92 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
93 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
94 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
95 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
96 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
97 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
98 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
99 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
100 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
101 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
102 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
103 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
104 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
105 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
106 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
107 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
108 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
109 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
110 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
111 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
112 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
113 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
114 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
115 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
116 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
117 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
118 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
119 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
120 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
121 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
124 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
125 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
126 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
127 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
128 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
129 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
130 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
131 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
132 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
133 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
134 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
135 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
136 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
137 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
138 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
139 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
140 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
141 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.34
Nodule 0
Rhizoplane 8.81
Rhizosphere 90.51
Stem 0
Stem Tuber 0
Unclassified 8.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466969_0230993 3300044656 Bacteria 840
2 Ga0070683_100123227 3300005329 Bacteria 2449
3 Ga0070680_100014155 3300005336 Bacteria 6230
4 Ga0070671_100248180 3300005355 Bacteria 1512
5 Ga0070709_10007566 3300005434 Bacteria 5960
6 Ga0070709_10055478 3300005434 Bacteria 2502
7 Ga0070714_100032787 3300005435 Bacteria 4338
8 Ga0070714_100097606 3300005435 Bacteria 2583
9 Ga0070714_100473129 3300005435 Bacteria 1192
10 Ga0070714_100808346 3300005435 Bacteria 908
11 Ga0070713_100072300 3300005436 Bacteria 2917
12 Ga0070710_10003073 3300005437 Bacteria 7928
13 Ga0070711_100027239 3300005439 Bacteria 3751
14 Ga0070711_100034864 3300005439 Bacteria 3359
15 Ga0070708_100560147 3300005445 Bacteria 1078
16 Ga0070662_100268132 3300005457 Bacteria 1378
17 Ga0070681_10109797 3300005458 Bacteria 2698
18 Ga0070707_100000441 3300005468 Bacteria 41190
19 Ga0070684_100087271 3300005535 Bacteria 2770
20 Ga0070704_100395404 3300005549 Bacteria 1178
21 Ga0068856_100151972 3300005614 Bacteria 2324
22 Ga0070717_10003220 3300006028 Bacteria 11656
23 Ga0070717_10010124 3300006028 Bacteria 7099
24 Ga0070717_10011700 3300006028 Bacteria 6675
25 Ga0070717_10024940 3300006028 Bacteria 4751
26 Ga0070717_10661199 3300006028 Unclassified 949
27 Ga0070716_100016235 3300006173 Bacteria 3838
28 Ga0070716_100491077 3300006173 Unclassified 904
29 Ga0070712_100173857 3300006175 Bacteria 1673
30 Ga0105248_10174359 3300009177 Bacteria 2424
31 Ga0157374_10042431 3300013296 Bacteria 4196
32 Ga0157372_10310059 3300013307 Bacteria 1837
33 Ga0207692_10103035 3300025898 Bacteria 1570
34 Ga0207699_10047230 3300025906 Bacteria 2523
35 Ga0207699_10340115 3300025906 Bacteria 1057
36 Ga0207707_10400592 3300025912 Bacteria 1178
37 Ga0207693_10001187 3300025915 Bacteria 23272
38 Ga0207693_10510979 3300025915 Bacteria 938
39 Ga0207663_10163458 3300025916 Unclassified 1574
40 Ga0207663_10371584 3300025916 Bacteria 1087
41 Ga0207646_10001597 3300025922 Bacteria 27663
42 Ga0207700_10039590 3300025928 Bacteria 3433
43 Ga0207700_10249652 3300025928 Unclassified 1515
44 Ga0207700_11174955 3300025928 Bacteria 685
45 Ga0207664_10030336 3300025929 Bacteria 4129
46 Ga0207664_10163640 3300025929 Unclassified 1899
47 Ga0207644_10077799 3300025931 Bacteria 2444
48 Ga0207644_10138059 3300025931 Bacteria 1874
49 Ga0207665_10000058 3300025939 Bacteria 72882
50 Ga0207665_10225496 3300025939 Bacteria 1375
51 Ga0207661_10514262 3300025944 Bacteria 1095
52 Ga0207702_10559395 3300026078 Bacteria 1119
53 Ga0265336_10001336 3300028666 Bacteria 11471
54 Ga0265336_10081472 3300028666 Bacteria 965
55 Ga0265338_10013277 3300028800 Bacteria 9313
56 Ga0265338_10048408 3300028800 Bacteria 3867
57 Ga0265338_10088602 3300028800 Bacteria 2567
58 Ga0265324_10060095 3300029957 Bacteria 1299
59 Ga0265324_10130075 3300029957 Bacteria 855
60 Ga0265313_10020690 3300031595 Bacteria 3622
61 Ga0373926_0010372 3300035083 Bacteria 3122
62 Ga0373951_0049528 3300035091 Bacteria 1031
63 Ga0373923_0123488 3300035111 Unclassified 1159
64 Ga0373945_0025173 3300035116 Bacteria 2066
65 Ga0373953_0211425 3300035117 Unclassified 840
66 Ga0373954_0162256 3300035118 Bacteria 1094
67 Ga0373943_0001502 3300035170 Bacteria 10554
68 Ga0373946_0039559 3300035171 Bacteria 1926
69 Ga0373924_0049330 3300035410 Bacteria 1742
70 Ga0373935_0052920 3300035692 Bacteria 2582
71 Ga0373927_0006226 3300035695 Bacteria 8146
72 Ga0373933_0051481 3300035724 Bacteria 2462
73 Ga0373947_0000205 3300035725 Bacteria 32976
74 Ga0373937_0065618 3300036401 Bacteria 3342
75 Ga0373937_0105031 3300036401 Bacteria 2624
76 Ga0373925_0000604 3300037068 Bacteria 34210
77 Ga0395900_0956646 3300037418 Bacteria 778
78 Ga0395898_0050893 3300037466 Bacteria 4053
79 Ga0395905_0306936 3300037471 Bacteria 1475
80 Ga0436363_0399006 3300039450 Bacteria 1720
81 Ga0466969_0143090 3300044656 Unclassified 1105
82 Ga0466965_0034535 3300044683 Bacteria 2474
83 Ga0466966_0058312 3300044684 Bacteria 2440
84 Ga0466961_0001476 3300044693 Bacteria 14609
85 Ga0466961_0019243 3300044693 Bacteria 4395
86 Ga0466963_0002786 3300044694 Bacteria 9851
87 Ga0466963_0013056 3300044694 Bacteria 5093
88 Ga0466963_0015272 3300044694 Bacteria 4751
89 Ga0466963_0055512 3300044694 Bacteria 2634
90 Ga0466963_0321232 3300044694 Bacteria 1089
91 Ga0466964_0018460 3300044706 Bacteria 2677
92 Ga0466964_0042174 3300044706 Bacteria 1848
93 Ga0466964_0236206 3300044706 Unclassified 894
94 Ga0466971_0000871 3300044719 Bacteria 12335
95 Ga0466971_0054657 3300044719 Bacteria 1799
96 Ga0466971_0060010 3300044719 Bacteria 1719
97 Ga0466968_0003366 3300044735 Bacteria 5907
98 Ga0466968_0017885 3300044735 Bacteria 2839
99 Ga0466968_0020741 3300044735 Bacteria 2655
100 Ga0466968_0050401 3300044735 Bacteria 1776
101 Ga0466970_0090023 3300044765 Bacteria 1665
102 Ga0466957_0001119 3300044842 Bacteria 13890
103 Ga0466957_0011943 3300044842 Bacteria 5022
104 Ga0466957_0024591 3300044842 Bacteria 3565
105 Ga0466957_0040801 3300044842 Bacteria 2804
106 Ga0466957_0140015 3300044842 Bacteria 1558
107 Ga0466957_0145186 3300044842 Bacteria 1531
108 Ga0466957_0414400 3300044842 Bacteria 923
109 Ga0466957_0857454 3300044842 Bacteria 647
110 Ga0466959_0004661 3300045049 Bacteria 9228
111 Ga0466959_0061871 3300045049 Bacteria 2722
112 Ga0466959_0139756 3300045049 Bacteria 1712
113 Ga0466959_0221415 3300045049 Bacteria 1312
114 Ga0466958_0000039 3300045836 Bacteria 37591
115 Ga0466958_0002962 3300045836 Bacteria 8696
116 Ga0466958_0036631 3300045836 Bacteria 2937
117 Ga0466958_0074202 3300045836 Bacteria 2084
118 Ga0466958_0217041 3300045836 Unclassified 1220
119 Ga0466958_0304974 3300045836 Bacteria 1022
120 Ga0466967_0000389 3300045976 Bacteria 20536
121 Ga0466967_0007025 3300045976 Bacteria 8062
122 Ga0466967_0007400 3300045976 Bacteria 7916
123 Ga0466967_0016730 3300045976 Bacteria 5795
124 Ga0466967_0034154 3300045976 Bacteria 4313
125 Ga0466967_0118242 3300045976 Bacteria 2444
126 Ga0466967_0265316 3300045976 Bacteria 1643
127 Ga0466967_0318420 3300045976 Bacteria 1499
128 Ga0466967_0590705 3300045976 Bacteria 1095
129 Ga0495592_0000082 3300046454 Bacteria 83312
130 Ga0495592_0024710 3300046454 Bacteria 4567
131 Ga0495592_0235124 3300046454 Unclassified 1218
132 Ga0495592_0354580 3300046454 Bacteria 940
133 Ga0495603_0224694 3300046455 Unclassified 1083
134 Ga0495629_0026304 3300046459 Bacteria 4134
135 Ga0495629_0049174 3300046459 Bacteria 2956
136 Ga0495629_0076120 3300046459 Bacteria 2343
137 Ga0495629_0099910 3300046459 Bacteria 2025
138 Ga0495641_0002942 3300046461 Bacteria 13119
139 Ga0495641_0047930 3300046461 Bacteria 1960
140 Ga0495651_0000080 3300046462 Bacteria 70453
141 Ga0495653_0018407 3300046463 Bacteria 5672
142 Ga0495653_0021350 3300046463 Bacteria 5246
143 Ga0495653_0024492 3300046463 Bacteria 4863
144 Ga0495653_0029680 3300046463 Bacteria 4361
145 Ga0495653_0066967 3300046463 Bacteria 2699
146 Ga0495653_0193021 3300046463 Unclassified 1388
147 Ga0495653_0620934 3300046463 Bacteria 662
148 Ga0495582_0000542 3300046473 Bacteria 20867
149 Ga0495582_0034340 3300046473 Unclassified 2788
150 Ga0495582_0365391 3300046473 Bacteria 831
151 Ga0495605_0064878 3300046474 Bacteria 1738
152 Ga0495639_0000302 3300046475 Bacteria 24029
153 Ga0495639_0287222 3300046475 Bacteria 818
154 Ga0495662_0038510 3300046476 Bacteria 2310
155 Ga0495662_0097754 3300046476 Bacteria 1435
156 Ga0495664_0005929 3300046477 Bacteria 6729
157 Ga0495664_0012395 3300046477 Bacteria 4828
158 Ga0495664_0262405 3300046477 Bacteria 1044
159 Ga0495664_0395987 3300046477 Unclassified 829
160 Ga0495607_0012676 3300046501 Bacteria 5553
161 Ga0495608_0003987 3300046511 Bacteria 10598
162 Ga0495608_0019769 3300046511 Bacteria 4631
163 Ga0495608_0071863 3300046511 Unclassified 2257
164 Ga0495608_0121409 3300046511 Bacteria 1675
165 Ga0495618_0001062 3300046514 Bacteria 18742
166 Ga0495618_0044012 3300046514 Bacteria 2816
167 Ga0495618_0067121 3300046514 Bacteria 2280
168 Ga0495618_0175543 3300046514 Bacteria 1363
169 Ga0495618_0267412 3300046514 Bacteria 1069
170 Ga0495628_0000292 3300046516 Bacteria 45065
171 Ga0495630_0001051 3300046517 Bacteria 19023
172 Ga0495630_0287851 3300046517 Bacteria 1255
173 Ga0495666_0000436 3300046526 Bacteria 18500
174 Ga0495652_0000847 3300046529 Bacteria 35270
175 Ga0495652_0012788 3300046529 Bacteria 7560
176 Ga0495652_0035353 3300046529 Bacteria 4349
177 Ga0495652_0259180 3300046529 Bacteria 1284
178 Ga0495652_0658172 3300046529 Bacteria 709
179 Ga0495665_0000038 3300046531 Bacteria 51967
180 Ga0495640_0003773 3300046533 Bacteria 12155
181 Ga0495640_0019878 3300046533 Bacteria 4953
182 Ga0495640_0037633 3300046533 Bacteria 3411
183 Ga0495640_0224158 3300046533 Bacteria 1185
184 Ga0495586_0006750 3300046535 Bacteria 6128
185 Ga0495586_0195817 3300046535 Bacteria 1145
186 Ga0495587_0000060 3300046536 Bacteria 93780
187 Ga0495609_0082412 3300046538 Bacteria 1405
188 Ga0495645_0000038 3300046543 Bacteria 96124
189 Ga0495645_0216769 3300046543 Bacteria 1289
190 Ga0495645_0255266 3300046543 Bacteria 1163
191 Ga0495667_0001874 3300046559 Bacteria 13948
192 Ga0495667_0024470 3300046559 Bacteria 4066
193 Ga0495667_0269829 3300046559 Unclassified 1081
194 Ga0495634_0006485 3300046642 Bacteria 8887
195 Ga0495634_0141745 3300046642 Bacteria 1525
196 Ga0495634_0311819 3300046642 Unclassified 949
197 Ga0495635_0030722 3300046663 Bacteria 3732
198 Ga0495635_0057631 3300046663 Bacteria 2672
199 Ga0495635_0197217 3300046663 Bacteria 1366
200 Ga0495659_0049577 3300046664 Bacteria 1525
201 Ga0495661_0075693 3300046665 Bacteria 1956
202 Ga0495657_0043458 3300046675 Bacteria 3064
203 Ga0495657_0187163 3300046675 Bacteria 1267
204 Ga0495599_0000142 3300046678 Bacteria 46621
205 Ga0495623_0000210 3300046679 Bacteria 37384
206 Ga0495623_0050037 3300046679 Bacteria 2648
207 Ga0495646_0000729 3300046680 Bacteria 18267
208 Ga0495646_0057649 3300046680 Bacteria 2324
209 Ga0495646_0121930 3300046680 Bacteria 1474
210 Ga0495647_0000362 3300046681 Bacteria 12846
211 Ga0495647_0168532 3300046681 Bacteria 947
212 Ga0495658_0000950 3300046683 Bacteria 15450
213 Ga0495613_0003038 3300046689 Bacteria 12549
214 Ga0495613_0084359 3300046689 Bacteria 2306
215 Ga0495624_0003198 3300046690 Bacteria 12201
216 Ga0495624_0034245 3300046690 Bacteria 3286
217 Ga0495624_0392288 3300046690 Bacteria 834
218 Ga0495670_0187230 3300046691 Bacteria 1094
219 Ga0495600_0006009 3300046809 Bacteria 7349
220 Ga0495600_0194215 3300046809 Bacteria 1304
221 Ga0495581_0000231 3300047315 Bacteria 26359
222 Ga0495581_0054722 3300047315 Bacteria 2304
223 Ga0495604_0000043 3300047317 Bacteria 116335
224 Ga0495604_0087527 3300047317 Bacteria 2320
225 Ga0495604_0614635 3300047317 Bacteria 696
226 Ga0495674_0015221 3300047319 Bacteria 7195
227 Ga0495674_0057516 3300047319 Bacteria 3403
228 Ga0495674_0165783 3300047319 Bacteria 1846
229 Ga0495674_0234980 3300047319 Bacteria 1512
230 Ga0495674_0622098 3300047319 Bacteria 854
231 Ga0495674_0901895 3300047319 Bacteria 682
232 Ga0495676_0007522 3300047321 Bacteria 9986
233 Ga0495676_0120145 3300047321 Bacteria 1913
234 Ga0495676_0131950 3300047321 Bacteria 1802
235 Ga0495680_0007172 3300047322 Bacteria 10265
236 Ga0495680_0038086 3300047322 Bacteria 3846
237 Ga0495680_0088108 3300047322 Bacteria 2333
238 Ga0495680_0244373 3300047322 Bacteria 1274
239 Ga0495680_0369674 3300047322 Unclassified 995
240 Ga0495675_0000821 3300047444 Bacteria 19062
241 Ga0495684_0022705 3300047471 Bacteria 4825
242 Ga0495684_0160120 3300047471 Unclassified 1679
243 Ga0495684_0194556 3300047471 Bacteria 1497
244 Ga0495684_0196666 3300047471 Bacteria 1488
245 Ga0495593_0001951 3300047673 Bacteria 12308
246 Ga0495602_0007946 3300048088 Bacteria 11086
247 Ga0495602_0009850 3300048088 Bacteria 9917
248 Ga0495614_0002797 3300048089 Bacteria 7760
249 Ga0496100_0228004 3300048903 Unclassified 1369
250 Ga0496100_0363679 3300048903 Unclassified 1095
251 Ga0496101_0002780 3300048904 Bacteria 10726
252 Ga0496103_0174416 3300048906 Unclassified 1381
253 Ga0496104_0008311 3300048907 Bacteria 9217
254 Ga0496104_0035263 3300048907 Bacteria 4671
255 Ga0496104_0299471 3300048907 Bacteria 1520
256 Ga0496104_0611810 3300048907 Bacteria 999
257 Ga0496105_0004010 3300048908 Bacteria 11014
258 Ga0496105_0061074 3300048908 Bacteria 3109
259 Ga0496106_0003405 3300048909 Bacteria 11848
260 Ga0496106_0222429 3300048909 Bacteria 1506
261 Ga0496107_0082930 3300048910 Bacteria 2337
262 Ga0496108_0261021 3300048911 Bacteria 1507
263 Ga0496108_0395277 3300048911 Bacteria 1207
264 Ga0496109_0002211 3300048912 Bacteria 16137
265 Ga0496109_0486048 3300048912 Bacteria 1165
266 Ga0496110_0199140 3300048913 Bacteria 1819
267 Ga0496111_0015477 3300048914 Bacteria 5238
268 Ga0496111_0064549 3300048914 Bacteria 2656
269 Ga0496112_0166868 3300048915 Bacteria 2167
270 Ga0496113_0127019 3300048916 Bacteria 1998
271 Ga0496113_1016322 3300048916 Unclassified 652
272 Ga0496114_0022204 3300048917 Bacteria 5169
273 Ga0496115_0020131 3300048918 Bacteria 5143
274 Ga0496115_0269478 3300048918 Bacteria 1399
275 Ga0501067_0056846 3300049583 Bacteria 2167
276 Ga0501069_0017012 3300049585 Bacteria 3909
277 Ga0495601_0000178 3300053077 Bacteria 33686
278 Ga0495601_0002405 3300053077 Bacteria 10626
279 Ga0495601_0025430 3300053077 Bacteria 3650
280 Ga0495601_0118992 3300053077 Bacteria 1714
281 Ga0495601_0195934 3300053077 Bacteria 1320
282 Ga0495612_0000968 3300053078 Bacteria 11805
283 Ga0495612_0026977 3300053078 Bacteria 2309
284 Ga0495595_0012934 3300053084 Bacteria 3521
285 Ga0495595_0102637 3300053084 Bacteria 1381
286 Ga0495595_0256239 3300053084 Unclassified 876
287 Ga0495619_0005264 3300053085 Bacteria 8201
288 Ga0495619_0048879 3300053085 Bacteria 2787
289 Ga0495619_0182591 3300053085 Bacteria 1451
290 Ga0495619_0193712 3300053085 Bacteria 1407
291 Ga0495619_0204705 3300053085 Bacteria 1366
292 Ga0495619_0602637 3300053085 Bacteria 751
293 Ga0500566_0074325 3300053094 Bacteria 1903
294 Ga0466962_0000600 3300061719 Bacteria 15915
295 Ga0466962_0058971 3300061719 Bacteria 1832
296 Ga0466969_0230993
297 Ga0070683_100123227
298 Ga0070680_100014155
299 Ga0070671_100248180
300 Ga0070709_10007566
301 Ga0070709_10055478
302 Ga0070714_100032787
303 Ga0070714_100097606
304 Ga0070714_100473129
305 Ga0070714_100808346
306 Ga0070713_100072300
307 Ga0070710_10003073
308 Ga0070711_100027239
309 Ga0070711_100034864
310 Ga0070708_100560147
311 Ga0070662_100268132
312 Ga0070681_10109797
313 Ga0070707_100000441
314 Ga0070684_100087271
315 Ga0070704_100395404
316 Ga0068856_100151972
317 Ga0070717_10003220
318 Ga0070717_10010124
319 Ga0070717_10011700
320 Ga0070717_10024940
321 Ga0070717_10661199
322 Ga0070716_100016235
323 Ga0070716_100491077
324 Ga0070712_100173857
325 Ga0105248_10174359
326 Ga0157374_10042431
327 Ga0157372_10310059
328 Ga0207692_10103035
329 Ga0207699_10047230
330 Ga0207699_10340115
331 Ga0207707_10400592
332 Ga0207693_10001187
333 Ga0207693_10510979
334 Ga0207663_10163458
335 Ga0207663_10371584
336 Ga0207646_10001597
337 Ga0207700_10039590
338 Ga0207700_10249652
339 Ga0207700_11174955
340 Ga0207664_10030336
341 Ga0207664_10163640
342 Ga0207644_10077799
343 Ga0207644_10138059
344 Ga0207665_10000058
345 Ga0207665_10225496
346 Ga0207661_10514262
347 Ga0207702_10559395
348 Ga0265336_10001336
349 Ga0265336_10081472
350 Ga0265338_10013277
351 Ga0265338_10048408
352 Ga0265338_10088602
353 Ga0265324_10060095
354 Ga0265324_10130075
355 Ga0265313_10020690
356 Ga0373926_0010372
357 Ga0373951_0049528
358 Ga0373923_0123488
359 Ga0373945_0025173
360 Ga0373953_0211425
361 Ga0373954_0162256
362 Ga0373943_0001502
363 Ga0373946_0039559
364 Ga0373924_0049330
365 Ga0373935_0052920
366 Ga0373927_0006226
367 Ga0373933_0051481
368 Ga0373947_0000205
369 Ga0373937_0065618
370 Ga0373937_0105031
371 Ga0373925_0000604
372 Ga0395900_0956646
373 Ga0395898_0050893
374 Ga0395905_0306936
375 Ga0436363_0399006
376 Ga0466969_0143090
377 Ga0466965_0034535
378 Ga0466966_0058312
379 Ga0466961_0001476
380 Ga0466961_0019243
381 Ga0466963_0002786
382 Ga0466963_0013056
383 Ga0466963_0015272
384 Ga0466963_0055512
385 Ga0466963_0321232
386 Ga0466964_0018460
387 Ga0466964_0042174
388 Ga0466964_0236206
389 Ga0466971_0000871
390 Ga0466971_0054657
391 Ga0466971_0060010
392 Ga0466968_0003366
393 Ga0466968_0017885
394 Ga0466968_0020741
395 Ga0466968_0050401
396 Ga0466970_0090023
397 Ga0466957_0001119
398 Ga0466957_0011943
399 Ga0466957_0024591
400 Ga0466957_0040801
401 Ga0466957_0140015
402 Ga0466957_0145186
403 Ga0466957_0414400
404 Ga0466957_0857454
405 Ga0466959_0004661
406 Ga0466959_0061871
407 Ga0466959_0139756
408 Ga0466959_0221415
409 Ga0466958_0000039
410 Ga0466958_0002962
411 Ga0466958_0036631
412 Ga0466958_0074202
413 Ga0466958_0217041
414 Ga0466958_0304974
415 Ga0466967_0000389
416 Ga0466967_0007025
417 Ga0466967_0007400
418 Ga0466967_0016730
419 Ga0466967_0034154
420 Ga0466967_0118242
421 Ga0466967_0265316
422 Ga0466967_0318420
423 Ga0466967_0590705
424 Ga0495592_0000082
425 Ga0495592_0024710
426 Ga0495592_0235124
427 Ga0495592_0354580
428 Ga0495603_0224694
429 Ga0495629_0026304
430 Ga0495629_0049174
431 Ga0495629_0076120
432 Ga0495629_0099910
433 Ga0495641_0002942
434 Ga0495641_0047930
435 Ga0495651_0000080
436 Ga0495653_0018407
437 Ga0495653_0021350
438 Ga0495653_0024492
439 Ga0495653_0029680
440 Ga0495653_0066967
441 Ga0495653_0193021
442 Ga0495653_0620934
443 Ga0495582_0000542
444 Ga0495582_0034340
445 Ga0495582_0365391
446 Ga0495605_0064878
447 Ga0495639_0000302
448 Ga0495639_0287222
449 Ga0495662_0038510
450 Ga0495662_0097754
451 Ga0495664_0005929
452 Ga0495664_0012395
453 Ga0495664_0262405
454 Ga0495664_0395987
455 Ga0495607_0012676
456 Ga0495608_0003987
457 Ga0495608_0019769
458 Ga0495608_0071863
459 Ga0495608_0121409
460 Ga0495618_0001062
461 Ga0495618_0044012
462 Ga0495618_0067121
463 Ga0495618_0175543
464 Ga0495618_0267412
465 Ga0495628_0000292
466 Ga0495630_0001051
467 Ga0495630_0287851
468 Ga0495666_0000436
469 Ga0495652_0000847
470 Ga0495652_0012788
471 Ga0495652_0035353
472 Ga0495652_0259180
473 Ga0495652_0658172
474 Ga0495665_0000038
475 Ga0495640_0003773
476 Ga0495640_0019878
477 Ga0495640_0037633
478 Ga0495640_0224158
479 Ga0495586_0006750
480 Ga0495586_0195817
481 Ga0495587_0000060
482 Ga0495609_0082412
483 Ga0495645_0000038
484 Ga0495645_0216769
485 Ga0495645_0255266
486 Ga0495667_0001874
487 Ga0495667_0024470
488 Ga0495667_0269829
489 Ga0495634_0006485
490 Ga0495634_0141745
491 Ga0495634_0311819
492 Ga0495635_0030722
493 Ga0495635_0057631
494 Ga0495635_0197217
495 Ga0495659_0049577
496 Ga0495661_0075693
497 Ga0495657_0043458
498 Ga0495657_0187163
499 Ga0495599_0000142
500 Ga0495623_0000210
501 Ga0495623_0050037
502 Ga0495646_0000729
503 Ga0495646_0057649
504 Ga0495646_0121930
505 Ga0495647_0000362
506 Ga0495647_0168532
507 Ga0495658_0000950
508 Ga0495613_0003038
509 Ga0495613_0084359
510 Ga0495624_0003198
511 Ga0495624_0034245
512 Ga0495624_0392288
513 Ga0495670_0187230
514 Ga0495600_0006009
515 Ga0495600_0194215
516 Ga0495581_0000231
517 Ga0495581_0054722
518 Ga0495604_0000043
519 Ga0495604_0087527
520 Ga0495604_0614635
521 Ga0495674_0015221
522 Ga0495674_0057516
523 Ga0495674_0165783
524 Ga0495674_0234980
525 Ga0495674_0622098
526 Ga0495674_0901895
527 Ga0495676_0007522
528 Ga0495676_0120145
529 Ga0495676_0131950
530 Ga0495680_0007172
531 Ga0495680_0038086
532 Ga0495680_0088108
533 Ga0495680_0244373
534 Ga0495680_0369674
535 Ga0495675_0000821
536 Ga0495684_0022705
537 Ga0495684_0160120
538 Ga0495684_0194556
539 Ga0495684_0196666
540 Ga0495593_0001951
541 Ga0495602_0007946
542 Ga0495602_0009850
543 Ga0495614_0002797
544 Ga0496100_0228004
545 Ga0496100_0363679
546 Ga0496101_0002780
547 Ga0496103_0174416
548 Ga0496104_0008311
549 Ga0496104_0035263
550 Ga0496104_0299471
551 Ga0496104_0611810
552 Ga0496105_0004010
553 Ga0496105_0061074
554 Ga0496106_0003405
555 Ga0496106_0222429
556 Ga0496107_0082930
557 Ga0496108_0261021
558 Ga0496108_0395277
559 Ga0496109_0002211
560 Ga0496109_0486048
561 Ga0496110_0199140
562 Ga0496111_0015477
563 Ga0496111_0064549
564 Ga0496112_0166868
565 Ga0496113_0127019
566 Ga0496113_1016322
567 Ga0496114_0022204
568 Ga0496115_0020131
569 Ga0496115_0269478
570 Ga0501067_0056846
571 Ga0501069_0017012
572 Ga0495601_0000178
573 Ga0495601_0002405
574 Ga0495601_0025430
575 Ga0495601_0118992
576 Ga0495601_0195934
577 Ga0495612_0000968
578 Ga0495612_0026977
579 Ga0495595_0012934
580 Ga0495595_0102637
581 Ga0495595_0256239
582 Ga0495619_0005264
583 Ga0495619_0048879
584 Ga0495619_0182591
585 Ga0495619_0193712
586 Ga0495619_0204705
587 Ga0495619_0602637
588 Ga0500566_0074325
589 Ga0466962_0000600
590 Ga0466962_0058971

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01467

CTP_transf_like

Cytidylyltransferase-like

6

158

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rpi-assembly2.cif.gz_B crystal structure of nicotinate mononucleotide adenylyltransferase from mycobacterium tuberculosis 0.8485 3 183
4rpi-assembly1.cif.gz_C crystal structure of nicotinate mononucleotide adenylyltransferase from mycobacterium tuberculosis 0.839 3 183
3mmx-assembly2.cif.gz_F bacillus anthracis nadd (banadd) in complex with compound 1_02_3 0.8386 1 184
1k4k-assembly1.cif.gz_A crystal structure of e. coli nicotinic acid mononucleotide adenylyltransferase 0.8371 1 184
5deo-assembly1.cif.gz_A mycobacterium abscessus nadd in complex with nicotinic acid adenine dinucleotide 0.835 2 183
ID Description Score Start End Superfamily
4wsoB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8309 2 185 3.40.50.620
af_Q9VC03_45_291_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8271 3 183 3.40.50.620
2h2aB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8252 1 185 3.40.50.620
af_Q9XXM2_4_220_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8239 1 184 3.40.50.620
4wsoB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8226 2 185 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A538CJK6-F1-model_v4 Probable nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) 0.9705 3 184 GO:0004515
GO:0005524
GO:0009435
AF-A0A537ZQX7-F1-model_v4 Probable nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) 0.9689 1 183 GO:0004515
GO:0005524
GO:0009435
AF-A0A538CJK6-F1-model_v4 Probable nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) 0.955 3 184 GO:0004515
GO:0005524
GO:0009435
AF-A0A537ZQX7-F1-model_v4 Probable nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) 0.9536 1 183 GO:0004515
GO:0005524
GO:0009435
AF-A0A7V8XDA4-F1-model_v4 Probable nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) 0.9498 1 184 GO:0004515
GO:0005524
GO:0009435

Map