F392718

General Info

Members Datasets Scaffolds Average Seq Length
295 174 590 235

Family's Representative Sequence

Representative Sequence 3300031344|Ga0265316_10018408|Ga0265316_100184083
Length 264
Sequence MKHTIIGAERDEATEKVRGGAAGTTRAAAVFAGFPAEGLAFLRSLKRNNRREWFQPRKHIYDEKVRAPMVALVSALTTAMGRFAPDYVREPEAAVYRIYRDTRFSPDKTPYKTHVAAIFPRRGLDKHACAGLYFSVSAETIEIAGGVYMPTPDELRAIRLHLVEHHQELRRILRGRTLHTLMGELAGAELTRVPKGFDGEHPSADLVRCKQWLLDVALDPGLAGTPKLYEELVKRFRAMTPFVEFLNAPLVAGRHGGKAERFFD

Samples

Sample ID Description Type Environment
1 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
100 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
101 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
102 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
103 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
104 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
105 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
106 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
107 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
113 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
114 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
119 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
120 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
121 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
122 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
123 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
124 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
125 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
126 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
127 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
128 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
129 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
130 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
131 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
132 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
133 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
134 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
135 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
138 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
151 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
152 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
153 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
154 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
155 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
156 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
157 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
158 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
159 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
160 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
161 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
162 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
164 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
165 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
166 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
167 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
171 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
172 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
173 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
174 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.32
Metatranscriptomes 0.68
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.36
Rhizosphere 98.64
Stem 0
Stem Tuber 0
Unclassified 21.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265316_10018408 3300031344 Bacteria 6003
2 Ga0058863_10007832 3300004799 Unclassified 3068
3 Ga0058861_12041206 3300004800 Unclassified 2947
4 Ga0070658_10052893 3300005327 Bacteria 3295
5 Ga0070658_10185618 3300005327 Unclassified 1751
6 Ga0070683_100003090 3300005329 Bacteria 13403
7 Ga0070683_100022080 3300005329 Bacteria 5684
8 Ga0070683_100041204 3300005329 Bacteria 4247
9 Ga0070680_100073365 3300005336 Unclassified 2814
10 Ga0070680_100138842 3300005336 Unclassified 2037
11 Ga0070660_100005646 3300005339 Bacteria 8670
12 Ga0070660_100012269 3300005339 Bacteria 6115
13 Ga0070689_100354607 3300005340 Unclassified 1231
14 Ga0070691_10000650 3300005341 Bacteria 13440
15 Ga0070668_100049622 3300005347 Bacteria 3228
16 Ga0070668_100407632 3300005347 Unclassified 1162
17 Ga0070669_100428979 3300005353 Bacteria 1086
18 Ga0070675_100000374 3300005354 Bacteria 30262
19 Ga0070674_100131760 3300005356 Bacteria 1865
20 Ga0070688_100182341 3300005365 Bacteria 1457
21 Ga0070659_100048005 3300005366 Bacteria 3352
22 Ga0070714_100012288 3300005435 Bacteria 6831
23 Ga0070713_100245817 3300005436 Bacteria 1630
24 Ga0070711_100398335 3300005439 Bacteria 1117
25 Ga0070711_100565293 3300005439 Unclassified 945
26 Ga0070681_10001509 3300005458 Bacteria 20619
27 Ga0070681_10007857 3300005458 Bacteria 10433
28 Ga0070681_10304372 3300005458 Bacteria 1503
29 Ga0070681_10445626 3300005458 Unclassified 1207
30 Ga0070685_10026296 3300005466 Bacteria 3207
31 Ga0070706_100590786 3300005467 Bacteria 1032
32 Ga0070699_100027935 3300005518 Bacteria 4867
33 Ga0070679_100005785 3300005530 Bacteria 11471
34 Ga0070679_100108759 3300005530 Bacteria 2758
35 Ga0070679_100240613 3300005530 Unclassified 1767
36 Ga0070684_100000438 3300005535 Bacteria 28577
37 Ga0070684_100042197 3300005535 Bacteria 3937
38 Ga0070684_100598097 3300005535 Bacteria 1025
39 Ga0070697_100030874 3300005536 Bacteria 4306
40 Ga0068853_100055229 3300005539 Bacteria 3423
41 Ga0070695_100156097 3300005545 Bacteria 1597
42 Ga0070695_100169751 3300005545 Bacteria 1538
43 Ga0070693_100058092 3300005547 Bacteria 2238
44 Ga0070704_100027914 3300005549 Bacteria 3749
45 Ga0070704_100029068 3300005549 Bacteria 3685
46 Ga0068855_100002651 3300005563 Bacteria 22053
47 Ga0068855_100002722 3300005563 Bacteria 21786
48 Ga0068855_100336806 3300005563 Unclassified 1664
49 Ga0068857_100048200 3300005577 Bacteria 3783
50 Ga0068856_100006759 3300005614 Bacteria 11230
51 Ga0068856_100039231 3300005614 Bacteria 4649
52 Ga0068856_100315058 3300005614 Bacteria 1582
53 Ga0068852_100007445 3300005616 Bacteria 7990
54 Ga0068852_100437009 3300005616 Unclassified 1293
55 Ga0068859_100054677 3300005617 Unclassified 4016
56 Ga0068864_100410546 3300005618 Unclassified 1288
57 Ga0068861_100411580 3300005719 Bacteria 1203
58 Ga0068860_100233900 3300005843 Unclassified 1786
59 Ga0081455_10379374 3300005937 Bacteria 988
60 Ga0081539_10119262 3300005985 Bacteria 1313
61 Ga0070717_10011822 3300006028 Bacteria 6640
62 Ga0070717_10222078 3300006028 Unclassified 1661
63 Ga0097621_100113454 3300006237 Bacteria 2292
64 Ga0075433_10000108 3300006852 Bacteria 40852
65 Ga0075433_10029647 3300006852 Bacteria 4664
66 Ga0075433_10048839 3300006852 Bacteria 3680
67 Ga0075433_10094132 3300006852 Bacteria 2651
68 Ga0075433_10151133 3300006852 Bacteria 2066
69 Ga0075434_100004749 3300006871 Bacteria 12294
70 Ga0075434_100103251 3300006871 Bacteria 2859
71 Ga0075434_100286129 3300006871 Bacteria 1668
72 Ga0075434_100324380 3300006871 Unclassified 1560
73 Ga0097620_100054678 3300006931 Unclassified 4016
74 Ga0075435_100011299 3300007076 Bacteria 6561
75 Ga0075435_100022267 3300007076 Bacteria 4887
76 Ga0105240_10016249 3300009093 Bacteria 10086
77 Ga0105240_10043375 3300009093 Bacteria 5724
78 Ga0105240_10102044 3300009093 Bacteria 3487
79 Ga0105240_10876151 3300009093 Unclassified 967
80 Ga0111539_10115258 3300009094 Bacteria 3151
81 Ga0111539_10580870 3300009094 Unclassified 1305
82 Ga0105245_10012844 3300009098 Bacteria 7297
83 Ga0105245_10016803 3300009098 Bacteria 6389
84 Ga0105245_10281639 3300009098 Bacteria 1625
85 Ga0114129_10003632 3300009147 Bacteria 21704
86 Ga0114129_10007024 3300009147 Bacteria 16032
87 Ga0114129_10019206 3300009147 Bacteria 9738
88 Ga0114129_10042131 3300009147 Bacteria 6429
89 Ga0114129_10062152 3300009147 Bacteria 5218
90 Ga0114129_10106236 3300009147 Bacteria 3878
91 Ga0114129_10116490 3300009147 Bacteria 3682
92 Ga0114129_10137198 3300009147 Bacteria 3356
93 Ga0114129_10907696 3300009147 Bacteria 1116
94 Ga0114129_11366142 3300009147 Bacteria 875
95 Ga0105243_10050815 3300009148 Unclassified 3277
96 Ga0105241_10102204 3300009174 Bacteria 2280
97 Ga0105241_10375562 3300009174 Unclassified 1241
98 Ga0105242_10005655 3300009176 Bacteria 9652
99 Ga0105242_10324814 3300009176 Unclassified 1413
100 Ga0105248_10008816 3300009177 Bacteria 11077
101 Ga0105248_10424380 3300009177 Bacteria 1498
102 Ga0105248_10450822 3300009177 Bacteria 1450
103 Ga0105248_10468768 3300009177 Unclassified 1420
104 Ga0105237_10014726 3300009545 Bacteria 8163
105 Ga0105237_10020629 3300009545 Bacteria 6789
106 Ga0105237_10071375 3300009545 Bacteria 3467
107 Ga0105238_10003305 3300009551 Bacteria 16105
108 Ga0105238_10018515 3300009551 Bacteria 7088
109 Ga0105238_10289469 3300009551 Bacteria 1620
110 Ga0105238_10685101 3300009551 Unclassified 1037
111 Ga0105249_10046424 3300009553 Bacteria 3953
112 Ga0105239_10001226 3300010375 Bacteria 34944
113 Ga0105239_10012176 3300010375 Bacteria 9590
114 Ga0105246_10002858 3300011119 Bacteria 10451
115 Ga0105246_10037263 3300011119 Unclassified 3263
116 Ga0157373_10266504 3300013100 Unclassified 1212
117 Ga0157371_10292209 3300013102 Unclassified 1179
118 Ga0157370_10005508 3300013104 Bacteria 14189
119 Ga0157370_10025796 3300013104 Bacteria 5814
120 Ga0157370_10067707 3300013104 Bacteria 3375
121 Ga0157369_10007462 3300013105 Bacteria 12594
122 Ga0157369_10009069 3300013105 Bacteria 11386
123 Ga0157369_10122997 3300013105 Bacteria 2752
124 Ga0157369_10262629 3300013105 Bacteria 1800
125 Ga0157369_10311350 3300013105 Unclassified 1637
126 Ga0157374_10027983 3300013296 Bacteria 5090
127 Ga0157374_10034937 3300013296 Bacteria 4596
128 Ga0163162_10198251 3300013306 Unclassified 2136
129 Ga0157372_10031778 3300013307 Bacteria 5783
130 Ga0157372_10153429 3300013307 Unclassified 2659
131 Ga0157375_10017642 3300013308 Bacteria 6447
132 Ga0163163_10316396 3300014325 Bacteria 1614
133 Ga0157379_10124311 3300014968 Bacteria 2321
134 Ga0157376_10125152 3300014969 Bacteria 2285
135 Ga0157376_10207328 3300014969 Bacteria 1807
136 Ga0157376_10441269 3300014969 Bacteria 1268
137 Ga0207699_10430648 3300025906 Unclassified 943
138 Ga0207645_10361643 3300025907 Bacteria 972
139 Ga0207654_10151929 3300025911 Bacteria 1487
140 Ga0207707_10002353 3300025912 Bacteria 17030
141 Ga0207707_10004585 3300025912 Bacteria 12142
142 Ga0207695_10003356 3300025913 Bacteria 22617
143 Ga0207695_10003465 3300025913 Bacteria 22202
144 Ga0207695_10212366 3300025913 Bacteria 1845
145 Ga0207671_10014487 3300025914 Bacteria 6227
146 Ga0207671_10091612 3300025914 Unclassified 2291
147 Ga0207671_10158662 3300025914 Bacteria 1751
148 Ga0207663_10014455 3300025916 Bacteria 4321
149 Ga0207663_10499328 3300025916 Unclassified 945
150 Ga0207660_10326847 3300025917 Unclassified 1225
151 Ga0207662_10181283 3300025918 Bacteria 1355
152 Ga0207657_10002189 3300025919 Bacteria 21178
153 Ga0207657_10021210 3300025919 Bacteria 6120
154 Ga0207652_10002097 3300025921 Bacteria 17136
155 Ga0207652_10005239 3300025921 Bacteria 10541
156 Ga0207694_10001736 3300025924 Bacteria 18273
157 Ga0207694_10004446 3300025924 Bacteria 10958
158 Ga0207694_10420737 3300025924 Bacteria 1113
159 Ga0207687_10000181 3300025927 Bacteria 41696
160 Ga0207687_10010218 3300025927 Bacteria 6131
161 Ga0207687_10191089 3300025927 Bacteria 1594
162 Ga0207644_10503580 3300025931 Unclassified 999
163 Ga0207706_10407593 3300025933 Unclassified 1178
164 Ga0207686_10020506 3300025934 Unclassified 3778
165 Ga0207686_10170395 3300025934 Unclassified 1535
166 Ga0207669_10056400 3300025937 Bacteria 2386
167 Ga0207711_10012815 3300025941 Bacteria 6965
168 Ga0207711_10375295 3300025941 Unclassified 1319
169 Ga0207711_10730630 3300025941 Bacteria 923
170 Ga0207661_10030716 3300025944 Unclassified 4141
171 Ga0207661_10041191 3300025944 Bacteria 3635
172 Ga0207661_10077079 3300025944 Bacteria 2740
173 Ga0207667_10000483 3300025949 Bacteria 52728
174 Ga0207667_10001959 3300025949 Bacteria 25792
175 Ga0207667_10028794 3300025949 Bacteria 6031
176 Ga0207667_11102871 3300025949 Unclassified 777
177 Ga0207712_10005026 3300025961 Bacteria 8368
178 Ga0207703_10013985 3300026035 Bacteria 6257
179 Ga0207703_10204871 3300026035 Bacteria 1755
180 Ga0207703_10946261 3300026035 Unclassified 826
181 Ga0207639_10047685 3300026041 Unclassified 3239
182 Ga0207708_10092941 3300026075 Bacteria 2328
183 Ga0207702_10008023 3300026078 Bacteria 8938
184 Ga0207702_10196694 3300026078 Bacteria 1866
185 Ga0207702_10344512 3300026078 Unclassified 1424
186 Ga0207648_10105677 3300026089 Unclassified 2470
187 Ga0207674_10000097 3300026116 Bacteria 98549
188 Ga0207698_10008487 3300026142 Bacteria 6502
189 Ga0207698_10091055 3300026142 Bacteria 2496
190 Ga0268264_10306651 3300028381 Unclassified 1496
191 Ga0265340_10041175 3300031247 Bacteria 2272
192 Ga0265313_10002989 3300031595 Bacteria 14102
193 Ga0265314_10006965 3300031711 Bacteria 9890
194 Ga0265314_10237831 3300031711 Bacteria 1052
195 Ga0373954_0002222 3300035118 Bacteria 8067
196 Ga0373954_0021342 3300035118 Bacteria 2932
197 Ga0373943_0035910 3300035170 Bacteria 2372
198 Ga0373955_0028531 3300035172 Bacteria 2894
199 Ga0373955_0403876 3300035172 Bacteria 830
200 Ga0373927_0003025 3300035695 Bacteria 12200
201 Ga0373933_0011224 3300035724 Bacteria 4931
202 Ga0373933_0104757 3300035724 Unclassified 1759
203 Ga0373947_0069482 3300035725 Bacteria 2156
204 Ga0373937_0033571 3300036401 Bacteria 4661
205 Ga0373937_0063047 3300036401 Bacteria 3408
206 Ga0373937_0478227 3300036401 Bacteria 1183
207 Ga0373937_0866276 3300036401 Bacteria 852
208 Ga0373925_0013512 3300037068 Bacteria 5910
209 Ga0373925_0198995 3300037068 Unclassified 1593
210 Ga0373925_0264368 3300037068 Bacteria 1383
211 Ga0395898_0081618 3300037466 Bacteria 3117
212 Ga0395898_0601009 3300037466 Bacteria 1043
213 Ga0395901_0142723 3300038443 Bacteria 2517
214 Ga0395901_0194965 3300038443 Bacteria 2124
215 Ga0466963_0000240 3300044694 Bacteria 23809
216 Ga0466957_0001243 3300044842 Bacteria 13290
217 Ga0466957_0225496 3300044842 Unclassified 1239
218 Ga0466958_0349558 3300045836 Bacteria 952
219 Ga0466967_0001243 3300045976 Bacteria 14408
220 Ga0495592_0247834 3300046454 Unclassified 1179
221 Ga0495629_0697321 3300046459 Bacteria 674
222 Ga0495651_0045958 3300046462 Bacteria 3381
223 Ga0495580_0074942 3300046472 Bacteria 2362
224 Ga0495582_0001911 3300046473 Bacteria 11714
225 Ga0495639_0375780 3300046475 Unclassified 716
226 Ga0495664_0026485 3300046477 Bacteria 3377
227 Ga0495594_0137699 3300046499 Bacteria 1384
228 Ga0495594_0303711 3300046499 Bacteria 909
229 Ga0495652_0014217 3300046529 Bacteria 7150
230 Ga0495586_0177815 3300046535 Bacteria 1203
231 Ga0495587_0020225 3300046536 Unclassified 4111
232 Ga0495667_0195660 3300046559 Unclassified 1295
233 Ga0495635_0350063 3300046663 Bacteria 985
234 Ga0495599_0006479 3300046678 Bacteria 7066
235 Ga0495599_0415296 3300046678 Unclassified 800
236 Ga0495623_0118022 3300046679 Unclassified 1601
237 Ga0495658_0040328 3300046683 Unclassified 2595
238 Ga0495604_0052542 3300047317 Bacteria 3155
239 Ga0495684_0058610 3300047471 Bacteria 2933
240 Ga0495602_0001814 3300048088 Bacteria 21326
241 Ga0496107_0392640 3300048910 Unclassified 1032
242 Ga0496112_0203237 3300048915 Bacteria 1940
243 Ga0496112_0414300 3300048915 Unclassified 1286
244 Ga0496115_0272869 3300048918 Bacteria 1389
245 Ga0501031_0001707 3300049568 Bacteria 13793
246 Ga0501032_0009803 3300049569 Bacteria 6928
247 Ga0501033_0001726 3300049570 Bacteria 19121
248 Ga0501034_0020561 3300049571 Bacteria 6741
249 Ga0501036_0035745 3300049572 Unclassified 4203
250 Ga0501037_0003557 3300049573 Bacteria 11305
251 Ga0501038_0001062 3300049574 Bacteria 24804
252 Ga0501039_0005526 3300049575 Bacteria 9565
253 Ga0501043_0021516 3300049579 Bacteria 5057
254 Ga0501046_0007785 3300049580 Bacteria 9399
255 Ga0501047_0016995 3300049581 Bacteria 6955
256 Ga0501048_0010493 3300049582 Bacteria 6915
257 Ga0501067_0011361 3300049583 Unclassified 4930
258 Ga0501068_0001610 3300049584 Bacteria 12022
259 Ga0501069_0104633 3300049585 Unclassified 1608
260 Ga0501070_0010444 3300049586 Bacteria 7848
261 Ga0501072_0001570 3300049588 Bacteria 17054
262 Ga0501073_0014942 3300049589 Bacteria 5632
263 Ga0501074_0014421 3300049590 Bacteria 5750
264 Ga0501076_0072036 3300049592 Bacteria 2765
265 Ga0501077_0001791 3300049593 Bacteria 12990
266 Ga0501079_0002461 3300049741 Bacteria 13445
267 Ga0501080_0001660 3300049742 Bacteria 18940
268 Ga0501083_0036138 3300049744 Unclassified 3370
269 Ga0501035_0022136 3300049822 Bacteria 5837
270 Ga0501044_0024992 3300049823 Bacteria 6333
271 nmdc:mga05p37_1104924_c1 3300050507 Bacteria 830
272 nmdc:mga05p37_19067_c1 3300050507 Bacteria 8296
273 nmdc:mga05p37_22928_c1 3300050507 Bacteria 7572
274 nmdc:mga05p37_348759_c1 3300050507 Bacteria 1743
275 nmdc:mga05p37_39504_c1 3300050507 Bacteria 5794
276 nmdc:mga05p37_44450_c1 3300050507 Bacteria 5465
277 nmdc:mga05p37_646753_c1 3300050507 Bacteria 1185
278 nmdc:mga05p37_90936_c1 3300050507 Bacteria 3761
279 nmdc:mga09592_93196_c1 3300050508 Bacteria 2575
280 nmdc:mga0qj67_629978_c1 3300050509 Bacteria 856
281 nmdc:mga06r32_961355_c1 3300050510 Bacteria 808
282 nmdc:mga08y16_149420_c1 3300050511 Bacteria 2429
283 nmdc:mga08y16_220028_c1 3300050511 Bacteria 1966
284 nmdc:mga0n895_173500_c1 3300050512 Bacteria 2188
285 nmdc:mga0n895_2029_c1 3300050512 Bacteria 15577
286 nmdc:mga0n895_418266_c1 3300050512 Bacteria 1355
287 nmdc:mga0n895_656419_c1 3300050512 Bacteria 1047
288 nmdc:mga08x19_10823_c1 3300050514 Bacteria 5485
289 nmdc:mga0a205_165937_c1 3300050515 Bacteria 2104
290 nmdc:mga0a205_2134_c1 3300050515 Bacteria 17370
291 nmdc:mga0a205_79800_c1 3300050515 Bacteria 3162
292 nmdc:mga0a205_876_c1 3300050515 Bacteria 24673
293 Ga0495601_0243966 3300053077 Archaea 1173
294 Ga0501084_0001252 3300054114 Bacteria 19987
295 Ga0501082_0001592 3300060353 Bacteria 20009
296 Ga0265316_10018408
297 Ga0058863_10007832
298 Ga0058861_12041206
299 Ga0070658_10052893
300 Ga0070658_10185618
301 Ga0070683_100003090
302 Ga0070683_100022080
303 Ga0070683_100041204
304 Ga0070680_100073365
305 Ga0070680_100138842
306 Ga0070660_100005646
307 Ga0070660_100012269
308 Ga0070689_100354607
309 Ga0070691_10000650
310 Ga0070668_100049622
311 Ga0070668_100407632
312 Ga0070669_100428979
313 Ga0070675_100000374
314 Ga0070674_100131760
315 Ga0070688_100182341
316 Ga0070659_100048005
317 Ga0070714_100012288
318 Ga0070713_100245817
319 Ga0070711_100398335
320 Ga0070711_100565293
321 Ga0070681_10001509
322 Ga0070681_10007857
323 Ga0070681_10304372
324 Ga0070681_10445626
325 Ga0070685_10026296
326 Ga0070706_100590786
327 Ga0070699_100027935
328 Ga0070679_100005785
329 Ga0070679_100108759
330 Ga0070679_100240613
331 Ga0070684_100000438
332 Ga0070684_100042197
333 Ga0070684_100598097
334 Ga0070697_100030874
335 Ga0068853_100055229
336 Ga0070695_100156097
337 Ga0070695_100169751
338 Ga0070693_100058092
339 Ga0070704_100027914
340 Ga0070704_100029068
341 Ga0068855_100002651
342 Ga0068855_100002722
343 Ga0068855_100336806
344 Ga0068857_100048200
345 Ga0068856_100006759
346 Ga0068856_100039231
347 Ga0068856_100315058
348 Ga0068852_100007445
349 Ga0068852_100437009
350 Ga0068859_100054677
351 Ga0068864_100410546
352 Ga0068861_100411580
353 Ga0068860_100233900
354 Ga0081455_10379374
355 Ga0081539_10119262
356 Ga0070717_10011822
357 Ga0070717_10222078
358 Ga0097621_100113454
359 Ga0075433_10000108
360 Ga0075433_10029647
361 Ga0075433_10048839
362 Ga0075433_10094132
363 Ga0075433_10151133
364 Ga0075434_100004749
365 Ga0075434_100103251
366 Ga0075434_100286129
367 Ga0075434_100324380
368 Ga0097620_100054678
369 Ga0075435_100011299
370 Ga0075435_100022267
371 Ga0105240_10016249
372 Ga0105240_10043375
373 Ga0105240_10102044
374 Ga0105240_10876151
375 Ga0111539_10115258
376 Ga0111539_10580870
377 Ga0105245_10012844
378 Ga0105245_10016803
379 Ga0105245_10281639
380 Ga0114129_10003632
381 Ga0114129_10007024
382 Ga0114129_10019206
383 Ga0114129_10042131
384 Ga0114129_10062152
385 Ga0114129_10106236
386 Ga0114129_10116490
387 Ga0114129_10137198
388 Ga0114129_10907696
389 Ga0114129_11366142
390 Ga0105243_10050815
391 Ga0105241_10102204
392 Ga0105241_10375562
393 Ga0105242_10005655
394 Ga0105242_10324814
395 Ga0105248_10008816
396 Ga0105248_10424380
397 Ga0105248_10450822
398 Ga0105248_10468768
399 Ga0105237_10014726
400 Ga0105237_10020629
401 Ga0105237_10071375
402 Ga0105238_10003305
403 Ga0105238_10018515
404 Ga0105238_10289469
405 Ga0105238_10685101
406 Ga0105249_10046424
407 Ga0105239_10001226
408 Ga0105239_10012176
409 Ga0105246_10002858
410 Ga0105246_10037263
411 Ga0157373_10266504
412 Ga0157371_10292209
413 Ga0157370_10005508
414 Ga0157370_10025796
415 Ga0157370_10067707
416 Ga0157369_10007462
417 Ga0157369_10009069
418 Ga0157369_10122997
419 Ga0157369_10262629
420 Ga0157369_10311350
421 Ga0157374_10027983
422 Ga0157374_10034937
423 Ga0163162_10198251
424 Ga0157372_10031778
425 Ga0157372_10153429
426 Ga0157375_10017642
427 Ga0163163_10316396
428 Ga0157379_10124311
429 Ga0157376_10125152
430 Ga0157376_10207328
431 Ga0157376_10441269
432 Ga0207699_10430648
433 Ga0207645_10361643
434 Ga0207654_10151929
435 Ga0207707_10002353
436 Ga0207707_10004585
437 Ga0207695_10003356
438 Ga0207695_10003465
439 Ga0207695_10212366
440 Ga0207671_10014487
441 Ga0207671_10091612
442 Ga0207671_10158662
443 Ga0207663_10014455
444 Ga0207663_10499328
445 Ga0207660_10326847
446 Ga0207662_10181283
447 Ga0207657_10002189
448 Ga0207657_10021210
449 Ga0207652_10002097
450 Ga0207652_10005239
451 Ga0207694_10001736
452 Ga0207694_10004446
453 Ga0207694_10420737
454 Ga0207687_10000181
455 Ga0207687_10010218
456 Ga0207687_10191089
457 Ga0207644_10503580
458 Ga0207706_10407593
459 Ga0207686_10020506
460 Ga0207686_10170395
461 Ga0207669_10056400
462 Ga0207711_10012815
463 Ga0207711_10375295
464 Ga0207711_10730630
465 Ga0207661_10030716
466 Ga0207661_10041191
467 Ga0207661_10077079
468 Ga0207667_10000483
469 Ga0207667_10001959
470 Ga0207667_10028794
471 Ga0207667_11102871
472 Ga0207712_10005026
473 Ga0207703_10013985
474 Ga0207703_10204871
475 Ga0207703_10946261
476 Ga0207639_10047685
477 Ga0207708_10092941
478 Ga0207702_10008023
479 Ga0207702_10196694
480 Ga0207702_10344512
481 Ga0207648_10105677
482 Ga0207674_10000097
483 Ga0207698_10008487
484 Ga0207698_10091055
485 Ga0268264_10306651
486 Ga0265340_10041175
487 Ga0265313_10002989
488 Ga0265314_10006965
489 Ga0265314_10237831
490 Ga0373954_0002222
491 Ga0373954_0021342
492 Ga0373943_0035910
493 Ga0373955_0028531
494 Ga0373955_0403876
495 Ga0373927_0003025
496 Ga0373933_0011224
497 Ga0373933_0104757
498 Ga0373947_0069482
499 Ga0373937_0033571
500 Ga0373937_0063047
501 Ga0373937_0478227
502 Ga0373937_0866276
503 Ga0373925_0013512
504 Ga0373925_0198995
505 Ga0373925_0264368
506 Ga0395898_0081618
507 Ga0395898_0601009
508 Ga0395901_0142723
509 Ga0395901_0194965
510 Ga0466963_0000240
511 Ga0466957_0001243
512 Ga0466957_0225496
513 Ga0466958_0349558
514 Ga0466967_0001243
515 Ga0495592_0247834
516 Ga0495629_0697321
517 Ga0495651_0045958
518 Ga0495580_0074942
519 Ga0495582_0001911
520 Ga0495639_0375780
521 Ga0495664_0026485
522 Ga0495594_0137699
523 Ga0495594_0303711
524 Ga0495652_0014217
525 Ga0495586_0177815
526 Ga0495587_0020225
527 Ga0495667_0195660
528 Ga0495635_0350063
529 Ga0495599_0006479
530 Ga0495599_0415296
531 Ga0495623_0118022
532 Ga0495658_0040328
533 Ga0495604_0052542
534 Ga0495684_0058610
535 Ga0495602_0001814
536 Ga0496107_0392640
537 Ga0496112_0203237
538 Ga0496112_0414300
539 Ga0496115_0272869
540 Ga0501031_0001707
541 Ga0501032_0009803
542 Ga0501033_0001726
543 Ga0501034_0020561
544 Ga0501036_0035745
545 Ga0501037_0003557
546 Ga0501038_0001062
547 Ga0501039_0005526
548 Ga0501043_0021516
549 Ga0501046_0007785
550 Ga0501047_0016995
551 Ga0501048_0010493
552 Ga0501067_0011361
553 Ga0501068_0001610
554 Ga0501069_0104633
555 Ga0501070_0010444
556 Ga0501072_0001570
557 Ga0501073_0014942
558 Ga0501074_0014421
559 Ga0501076_0072036
560 Ga0501077_0001791
561 Ga0501079_0002461
562 Ga0501080_0001660
563 Ga0501083_0036138
564 Ga0501035_0022136
565 Ga0501044_0024992
566 nmdc:mga05p37_1104924_c1
567 nmdc:mga05p37_19067_c1
568 nmdc:mga05p37_22928_c1
569 nmdc:mga05p37_348759_c1
570 nmdc:mga05p37_39504_c1
571 nmdc:mga05p37_44450_c1
572 nmdc:mga05p37_646753_c1
573 nmdc:mga05p37_90936_c1
574 nmdc:mga09592_93196_c1
575 nmdc:mga0qj67_629978_c1
576 nmdc:mga06r32_961355_c1
577 nmdc:mga08y16_149420_c1
578 nmdc:mga08y16_220028_c1
579 nmdc:mga0n895_173500_c1
580 nmdc:mga0n895_2029_c1
581 nmdc:mga0n895_418266_c1
582 nmdc:mga0n895_656419_c1
583 nmdc:mga08x19_10823_c1
584 nmdc:mga0a205_165937_c1
585 nmdc:mga0a205_2134_c1
586 nmdc:mga0a205_79800_c1
587 nmdc:mga0a205_876_c1
588 Ga0495601_0243966
589 Ga0501084_0001252
590 Ga0501082_0001592

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09365

DUF2461

Conserved hypothetical protein (DUF2461)

37

245

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rs0-assembly1.cif.gz_A golgi alpha-mannosidase ii in complex with (2s,3s,4r,5r)-1-(2-(benzyloxy)ethyl)-2-(hydroxymethyl)piperidine-3,4,5-triol 0.6792 83 120
6rrh-assembly1.cif.gz_A golgi alpha-mannosidase ii 0.6786 83 120
6zw0-assembly1.cif.gz_B connectase mj0548 from methanocaldococcus jannaschii in complex with an mtra-derived peptide 0.6753 88 119
8fyg-assembly2.cif.gz_B crystal structure of hyaluronate lyase a from cutibacterium acnes 0.5952 88 120
8fyg-assembly1.cif.gz_A crystal structure of hyaluronate lyase a from cutibacterium acnes 0.5944 88 120
ID Description Score Start End Superfamily
af_Q57968_1_179_3.60.20.10 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.6736 88 119 3.60.20.10
af_Q59TM0_564_734_2.40.160.120 Mainly Beta;Beta Barrel;Porin; 0.6645 88 120 2.40.160.120
2a8eA00 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Protein of unknown function DUF1054 0.6186 32 219 3.30.930.20
af_I1KIC6_57_377_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.618 88 127 3.80.10.10
af_Q9SCX8_41_336_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.6099 104 119 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A5F0FIW0-F1-model_v4 deleted 0.9569 90 225
AF-A0A2V8IXW5-F1-model_v4 DUF2461 domain-containing protein 0.9568 6 227
AF-A0A6N8WMV5-F1-model_v4 DUF2461 domain-containing protein 0.9564 6 225
AF-A0A7V8XZ77-F1-model_v4 DUF2461 domain-containing protein 0.9563 8 223
AF-A0A2V9JI21-F1-model_v4 TIGR02453 family protein 0.9553 1 226

Map