F392705

General Info

Members Datasets Scaffolds Average Seq Length
295 145 590 154

Family's Representative Sequence

Representative Sequence 3300028380|Ga0268265_10021015|Ga0268265_100210152
Length 141
Sequence MSAVRILVDADACPVKDEIYKVAWRREVPVVVVSNQRIRVPDHPLIERVVVSDAFDAADDWIVVTGDILLADRCLKKGASMIGPNGKPFTPASIGGAIATRAIMADLRSGAGVTGGPAPFAKADRSRFLQALDDALVRLRS

Samples

Sample ID Description Type Environment
1 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
107 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
108 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
119 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
120 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
121 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
122 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
123 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
124 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
125 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
126 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
127 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
128 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
129 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
130 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
131 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
132 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
133 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
136 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
140 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
141 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
142 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
143 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
144 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
145 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.32
Metatranscriptomes 0.68
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.36
Nodule 0
Rhizoplane 2.71
Rhizosphere 94.92
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0268265_10021015 3300028380 Bacteria 4565
2 JGI24749J21850_1002259 3300002076 Bacteria 2713
3 Ga0065715_10162146 3300005293 Bacteria 1619
4 Ga0070658_10001655 3300005327 Bacteria 18789
5 Ga0070658_10013781 3300005327 Bacteria 6487
6 Ga0070658_10041542 3300005327 Bacteria 3711
7 Ga0070658_10043333 3300005327 Bacteria 3635
8 Ga0070658_10087545 3300005327 Bacteria 2563
9 Ga0070658_10149851 3300005327 Bacteria 1952
10 Ga0070658_10217953 3300005327 Bacteria 1613
11 Ga0070658_10229540 3300005327 Bacteria 1571
12 Ga0070658_10519424 3300005327 Bacteria 1029
13 Ga0070658_11436593 3300005327 Bacteria 598
14 Ga0070658_11912744 3300005327 Bacteria 512
15 Ga0070676_10391615 3300005328 Bacteria 965
16 Ga0070670_100113252 3300005331 Bacteria 2338
17 Ga0070670_100135274 3300005331 Bacteria 2130
18 Ga0070677_10000477 3300005333 Bacteria 13691
19 Ga0070677_10102152 3300005333 Bacteria 1266
20 Ga0070660_100001976 3300005339 Bacteria 14155
21 Ga0070660_100009124 3300005339 Bacteria 6961
22 Ga0070660_100011109 3300005339 Bacteria 6386
23 Ga0070660_100021437 3300005339 Bacteria 4766
24 Ga0070660_100153186 3300005339 Bacteria 1854
25 Ga0070660_100605184 3300005339 Bacteria 916
26 Ga0070692_10055778 3300005345 Bacteria 2067
27 Ga0070668_100048758 3300005347 Bacteria 3258
28 Ga0070668_100192617 3300005347 Bacteria 1670
29 Ga0070669_100048732 3300005353 Bacteria 3092
30 Ga0070669_100056232 3300005353 Bacteria 2885
31 Ga0070669_100086756 3300005353 Bacteria 2339
32 Ga0070675_100181589 3300005354 Bacteria 1819
33 Ga0070671_100093862 3300005355 Bacteria 2514
34 Ga0070671_100139905 3300005355 Bacteria 2042
35 Ga0070674_100514767 3300005356 Bacteria 999
36 Ga0070673_100005919 3300005364 Bacteria 7899
37 Ga0070673_100134621 3300005364 Bacteria 2078
38 Ga0070673_100711190 3300005364 Bacteria 923
39 Ga0070659_101389100 3300005366 Bacteria 624
40 Ga0070667_100008876 3300005367 Bacteria 8320
41 Ga0070667_100031327 3300005367 Bacteria 4435
42 Ga0070667_100318956 3300005367 Bacteria 1402
43 Ga0070714_100114085 3300005435 Bacteria 2397
44 Ga0070701_10115962 3300005438 Bacteria 1503
45 Ga0070662_100010196 3300005457 Bacteria 6160
46 Ga0070662_100130138 3300005457 Bacteria 1939
47 Ga0070685_10368642 3300005466 Bacteria 986
48 Ga0070679_100039320 3300005530 Bacteria 4702
49 Ga0070672_100107615 3300005543 Bacteria 2269
50 Ga0070672_100992523 3300005543 Bacteria 744
51 Ga0070665_100000857 3300005548 Bacteria 39536
52 Ga0068855_100029059 3300005563 Bacteria 6611
53 Ga0070664_100048503 3300005564 Bacteria 3589
54 Ga0070664_100170304 3300005564 Bacteria 1932
55 Ga0070664_100350041 3300005564 Bacteria 1344
56 Ga0068857_100024662 3300005577 Bacteria 5296
57 Ga0068857_100192236 3300005577 Bacteria 1859
58 Ga0068854_100018501 3300005578 Bacteria 4679
59 Ga0068856_100072764 3300005614 Bacteria 3403
60 Ga0068852_100008802 3300005616 Bacteria 7469
61 Ga0068852_101343944 3300005616 Bacteria 736
62 Ga0068859_100000104 3300005617 Bacteria 78653
63 Ga0068859_100329095 3300005617 Bacteria 1622
64 Ga0068859_100616539 3300005617 Bacteria 1178
65 Ga0068864_100000118 3300005618 Bacteria 77800
66 Ga0068863_100000152 3300005841 Bacteria 72823
67 Ga0068863_100199634 3300005841 Bacteria 1924
68 Ga0068858_100000778 3300005842 Bacteria 33328
69 Ga0068860_100003124 3300005843 Bacteria 17106
70 Ga0068860_100003246 3300005843 Bacteria 16764
71 Ga0068860_100203157 3300005843 Bacteria 1921
72 Ga0068862_100003115 3300005844 Bacteria 14451
73 Ga0068862_100024325 3300005844 Bacteria 5082
74 Ga0068862_100130234 3300005844 Bacteria 2224
75 Ga0068862_100404486 3300005844 Bacteria 1278
76 Ga0075364_10064361 3300006051 Bacteria 2407
77 Ga0097621_100029923 3300006237 Bacteria 4305
78 Ga0097621_100819626 3300006237 Bacteria 863
79 Ga0068871_100023315 3300006358 Bacteria 4784
80 Ga0068865_100147228 3300006881 Bacteria 1783
81 Ga0075436_100888824 3300006914 Bacteria 666
82 Ga0097620_100000104 3300006931 Bacteria 78653
83 Ga0097620_100329111 3300006931 Bacteria 1622
84 Ga0097620_100616542 3300006931 Bacteria 1178
85 Ga0105250_10010180 3300009092 Bacteria 3925
86 Ga0111539_10862446 3300009094 Bacteria 1053
87 Ga0105247_10076410 3300009101 Bacteria 2103
88 Ga0105248_10000295 3300009177 Bacteria 59247
89 Ga0105248_10432310 3300009177 Bacteria 1483
90 Ga0105248_11049756 3300009177 Bacteria 921
91 Ga0105249_10068633 3300009553 Bacteria 3270
92 Ga0105249_10788428 3300009553 Bacteria 1014
93 Ga0157373_10017890 3300013100 Bacteria 5160
94 Ga0157371_10027012 3300013102 Bacteria 4166
95 Ga0157371_10150934 3300013102 Bacteria 1657
96 Ga0157371_10241658 3300013102 Bacteria 1299
97 Ga0157371_10437810 3300013102 Bacteria 960
98 Ga0157374_11399951 3300013296 Bacteria 722
99 Ga0163162_10337568 3300013306 Bacteria 1639
100 Ga0163162_10396504 3300013306 Bacteria 1513
101 Ga0157372_10054756 3300013307 Bacteria 4452
102 Ga0157372_11755281 3300013307 Bacteria 714
103 Ga0157375_10003555 3300013308 Bacteria 13527
104 Ga0163163_10000478 3300014325 Bacteria 36339
105 Ga0157380_10003858 3300014326 Bacteria 10332
106 Ga0157380_10239792 3300014326 Bacteria 1634
107 Ga0157380_10289704 3300014326 Bacteria 1503
108 Ga0157379_10067080 3300014968 Bacteria 3208
109 Ga0163161_10233117 3300017792 Bacteria 1429
110 Ga0163161_10461379 3300017792 Bacteria 1028
111 Ga0206354_10508452 3300020081 Bacteria 1738
112 Ga0206353_11783975 3300020082 Bacteria 7489
113 Ga0207666_1046986 3300025271 Bacteria 680
114 Ga0207697_10089966 3300025315 Bacteria 1300
115 Ga0207697_10173961 3300025315 Bacteria 942
116 Ga0207696_1011567 3300025711 Bacteria 3168
117 Ga0207682_10000482 3300025893 Bacteria 18460
118 Ga0207682_10050095 3300025893 Bacteria 1726
119 Ga0207710_10079882 3300025900 Bacteria 1515
120 Ga0207688_10203282 3300025901 Bacteria 1188
121 Ga0207680_10058336 3300025903 Bacteria 2339
122 Ga0207647_10019904 3300025904 Bacteria 4506
123 Ga0207647_10026697 3300025904 Bacteria 3774
124 Ga0207705_10000190 3300025909 Bacteria 62546
125 Ga0207705_10006018 3300025909 Bacteria 9025
126 Ga0207705_10023809 3300025909 Bacteria 4368
127 Ga0207705_10109534 3300025909 Bacteria 2039
128 Ga0207705_10113592 3300025909 Bacteria 2003
129 Ga0207705_10353220 3300025909 Bacteria 1133
130 Ga0207705_10427162 3300025909 Bacteria 1026
131 Ga0207705_10432157 3300025909 Bacteria 1020
132 Ga0207705_10483731 3300025909 Bacteria 961
133 Ga0207705_10584179 3300025909 Bacteria 869
134 Ga0207705_11287557 3300025909 Bacteria 559
135 Ga0207657_10003864 3300025919 Bacteria 15902
136 Ga0207657_10007525 3300025919 Bacteria 11162
137 Ga0207657_10052180 3300025919 Bacteria 3551
138 Ga0207657_10077003 3300025919 Bacteria 2812
139 Ga0207657_10232572 3300025919 Bacteria 1474
140 Ga0207657_10315206 3300025919 Bacteria 1237
141 Ga0207649_10017465 3300025920 Bacteria 4065
142 Ga0207681_10065215 3300025923 Bacteria 2517
143 Ga0207650_10013940 3300025925 Bacteria 5577
144 Ga0207650_10496086 3300025925 Bacteria 1020
145 Ga0207650_10668760 3300025925 Bacteria 876
146 Ga0207659_10031597 3300025926 Bacteria 3626
147 Ga0207659_10101034 3300025926 Bacteria 2174
148 Ga0207664_10036775 3300025929 Bacteria 3785
149 Ga0207664_10267266 3300025929 Bacteria 1497
150 Ga0207644_10099757 3300025931 Bacteria 2179
151 Ga0207644_10112340 3300025931 Bacteria 2062
152 Ga0207690_10016293 3300025932 Bacteria 4519
153 Ga0207706_10002856 3300025933 Bacteria 16769
154 Ga0207706_10005073 3300025933 Bacteria 12299
155 Ga0207670_10689148 3300025936 Bacteria 845
156 Ga0207669_10226565 3300025937 Bacteria 1376
157 Ga0207704_10054181 3300025938 Bacteria 2443
158 Ga0207691_10175276 3300025940 Bacteria 1876
159 Ga0207691_10261474 3300025940 Bacteria 1492
160 Ga0207711_10000153 3300025941 Bacteria 73814
161 Ga0207711_10336413 3300025941 Bacteria 1397
162 Ga0207679_10314395 3300025945 Bacteria 1354
163 Ga0207679_10956741 3300025945 Bacteria 784
164 Ga0207667_10009453 3300025949 Bacteria 11479
165 Ga0207651_10078990 3300025960 Bacteria 2362
166 Ga0207651_10629652 3300025960 Bacteria 940
167 Ga0207712_10046475 3300025961 Bacteria 3010
168 Ga0207668_10056341 3300025972 Bacteria 2737
169 Ga0207668_10083920 3300025972 Bacteria 2319
170 Ga0207640_10033510 3300025981 Bacteria 3197
171 Ga0207640_10288615 3300025981 Bacteria 1292
172 Ga0207658_10000453 3300025986 Bacteria 38410
173 Ga0207658_10029594 3300025986 Bacteria 3869
174 Ga0207658_10299716 3300025986 Bacteria 1384
175 Ga0207658_10524737 3300025986 Bacteria 1057
176 Ga0207658_11144756 3300025986 Bacteria 711
177 Ga0207677_10592567 3300026023 Bacteria 972
178 Ga0207703_10019967 3300026035 Bacteria 5236
179 Ga0207639_10365010 3300026041 Bacteria 1293
180 Ga0207678_11084892 3300026067 Bacteria 709
181 Ga0207702_10103849 3300026078 Bacteria 2514
182 Ga0207641_10000205 3300026088 Bacteria 78692
183 Ga0207641_10164681 3300026088 Bacteria 2018
184 Ga0207676_10000702 3300026095 Bacteria 26358
185 Ga0207674_10115248 3300026116 Bacteria 2659
186 Ga0207674_10122797 3300026116 Bacteria 2563
187 Ga0207698_10000770 3300026142 Bacteria 18648
188 Ga0207698_10933385 3300026142 Bacteria 876
189 Ga0268266_10000487 3300028379 Bacteria 56915
190 Ga0268266_10144101 3300028379 Bacteria 2140
191 Ga0268266_10959020 3300028379 Bacteria 827
192 Ga0268265_10002247 3300028380 Bacteria 14813
193 Ga0268265_10369240 3300028380 Bacteria 1316
194 Ga0268264_10002572 3300028381 Bacteria 15903
195 Ga0268264_10005610 3300028381 Bacteria 10631
196 Ga0307513_10146341 3300031456 Bacteria 2280
197 Ga0307513_10213772 3300031456 Bacteria 1757
198 Ga0307408_100109134 3300031548 Bacteria 2122
199 Ga0307405_10024753 3300031731 Bacteria 3435
200 Ga0307405_10033856 3300031731 Bacteria 3035
201 Ga0307405_10128808 3300031731 Bacteria 1745
202 Ga0307405_10787409 3300031731 Bacteria 795
203 Ga0307413_10015722 3300031824 Bacteria 3886
204 Ga0307413_10018237 3300031824 Bacteria 3676
205 Ga0307413_10020961 3300031824 Bacteria 3488
206 Ga0307413_10059933 3300031824 Bacteria 2341
207 Ga0307413_10195465 3300031824 Bacteria 1456
208 Ga0307413_10226069 3300031824 Bacteria 1370
209 Ga0307413_10555483 3300031824 Bacteria 932
210 Ga0307410_10018896 3300031852 Bacteria 4177
211 Ga0307410_10218269 3300031852 Bacteria 1465
212 Ga0307410_10447192 3300031852 Bacteria 1053
213 Ga0307410_10559195 3300031852 Bacteria 949
214 Ga0307406_10017412 3300031901 Bacteria 4182
215 Ga0307406_10050829 3300031901 Bacteria 2630
216 Ga0307406_10056941 3300031901 Bacteria 2506
217 Ga0307407_10098508 3300031903 Bacteria 1809
218 Ga0307407_10127861 3300031903 Bacteria 1621
219 Ga0307407_10287572 3300031903 Bacteria 1141
220 Ga0307407_10574134 3300031903 Bacteria 836
221 Ga0307412_10117472 3300031911 Bacteria 1910
222 Ga0307412_10975024 3300031911 Bacteria 747
223 Ga0307409_100081396 3300031995 Bacteria 2617
224 Ga0307409_100109243 3300031995 Bacteria 2315
225 Ga0307409_100110008 3300031995 Bacteria 2308
226 Ga0307409_100193441 3300031995 Bacteria 1813
227 Ga0307409_100272955 3300031995 Bacteria 1558
228 Ga0307409_101233314 3300031995 Bacteria 772
229 Ga0307409_101268985 3300031995 Bacteria 761
230 Ga0307409_101278269 3300031995 Bacteria 758
231 Ga0307416_100083458 3300032002 Bacteria 2711
232 Ga0307416_100275366 3300032002 Bacteria 1655
233 Ga0307416_100485469 3300032002 Bacteria 1296
234 Ga0307414_10009105 3300032004 Bacteria 5685
235 Ga0307414_10025595 3300032004 Bacteria 3783
236 Ga0307414_10144091 3300032004 Bacteria 1869
237 Ga0307414_10180434 3300032004 Bacteria 1697
238 Ga0307414_10247512 3300032004 Bacteria 1479
239 Ga0307414_10358417 3300032004 Bacteria 1254
240 Ga0307414_10824158 3300032004 Bacteria 847
241 Ga0307414_11416043 3300032004 Bacteria 646
242 Ga0307414_12243082 3300032004 Bacteria 510
243 Ga0307411_10000492 3300032005 Bacteria 13753
244 Ga0307411_10005402 3300032005 Bacteria 6272
245 Ga0307411_10085045 3300032005 Bacteria 2190
246 Ga0307411_10158721 3300032005 Bacteria 1690
247 Ga0307411_10189150 3300032005 Bacteria 1570
248 Ga0307411_10320488 3300032005 Bacteria 1251
249 Ga0307411_10421032 3300032005 Bacteria 1109
250 Ga0307411_10812662 3300032005 Bacteria 824
251 Ga0307411_10931032 3300032005 Bacteria 774
252 Ga0307415_100043600 3300032126 Bacteria 2994
253 Ga0307415_100167366 3300032126 Bacteria 1710
254 Ga0307415_100601302 3300032126 Bacteria 979
255 Ga0395899_0057861 3300037312 Bacteria 2860
256 Ga0395900_0038764 3300037418 Bacteria 4912
257 Ga0395900_0046333 3300037418 Bacteria 4476
258 Ga0395900_0113360 3300037418 Bacteria 2783
259 Ga0395900_0581853 3300037418 Bacteria 1061
260 Ga0395905_0009153 3300037471 Bacteria 9699
261 Ga0395905_0039808 3300037471 Bacteria 4411
262 Ga0395905_0041186 3300037471 Bacteria 4334
263 Ga0395901_0011497 3300038443 Bacteria 8970
264 Ga0395901_0114354 3300038443 Bacteria 2834
265 Ga0395901_0280095 3300038443 Bacteria 1732
266 Ga0439436_0112147 3300041404 Bacteria 761
267 Ga0451845_0477491 3300041501 Bacteria 617
268 Ga0439458_0005229 3300042157 Bacteria 2920
269 Ga0439464_0059329 3300042439 Bacteria 1118
270 Ga0466972_0061276 3300044658 Bacteria 1804
271 Ga0466964_0022530 3300044706 Bacteria 2445
272 Ga0466971_0350999 3300044719 Bacteria 714
273 Ga0466970_0105203 3300044765 Bacteria 1539
274 Ga0466960_0006177 3300044901 Bacteria 4794
275 Ga0495582_0435837 3300046473 Bacteria 756
276 Ga0495668_0012523 3300046616 Bacteria 5030
277 Ga0495668_0182582 3300046616 Bacteria 1149
278 Ga0495625_0278499 3300046660 Bacteria 1077
279 Ga0495669_0120131 3300046684 Bacteria 1231
280 Ga0495670_0083942 3300046691 Bacteria 1625
281 Ga0495677_0034949 3300047445 Bacteria 1834
282 Ga0495681_0254338 3300047470 Bacteria 692
283 Ga0496101_0125827 3300048904 Bacteria 1942
284 Ga0496107_0214651 3300048910 Bacteria 1431
285 Ga0496107_0958031 3300048910 Bacteria 622
286 Ga0496108_0393183 3300048911 Bacteria 1211
287 Ga0496109_0115175 3300048912 Bacteria 2501
288 Ga0496110_0501639 3300048913 Bacteria 1105
289 Ga0496112_0098608 3300048915 Bacteria 2892
290 Ga0496115_0121618 3300048918 Bacteria 2148
291 nmdc:mga0qj67_306624_c1 3300050509 Bacteria 1286
292 nmdc:mga08y16_1012906_c1 3300050511 Bacteria 810
293 Ga0500643_003004 3300053087 Bacteria 8354
294 Ga0500658_0000128 3300053134 Bacteria 35779
295 Ga0500559_0003827 3300053136 Bacteria 7283
296 Ga0268265_10021015
297 JGI24749J21850_1002259
298 Ga0065715_10162146
299 Ga0070658_10001655
300 Ga0070658_10013781
301 Ga0070658_10041542
302 Ga0070658_10043333
303 Ga0070658_10087545
304 Ga0070658_10149851
305 Ga0070658_10217953
306 Ga0070658_10229540
307 Ga0070658_10519424
308 Ga0070658_11436593
309 Ga0070658_11912744
310 Ga0070676_10391615
311 Ga0070670_100113252
312 Ga0070670_100135274
313 Ga0070677_10000477
314 Ga0070677_10102152
315 Ga0070660_100001976
316 Ga0070660_100009124
317 Ga0070660_100011109
318 Ga0070660_100021437
319 Ga0070660_100153186
320 Ga0070660_100605184
321 Ga0070692_10055778
322 Ga0070668_100048758
323 Ga0070668_100192617
324 Ga0070669_100048732
325 Ga0070669_100056232
326 Ga0070669_100086756
327 Ga0070675_100181589
328 Ga0070671_100093862
329 Ga0070671_100139905
330 Ga0070674_100514767
331 Ga0070673_100005919
332 Ga0070673_100134621
333 Ga0070673_100711190
334 Ga0070659_101389100
335 Ga0070667_100008876
336 Ga0070667_100031327
337 Ga0070667_100318956
338 Ga0070714_100114085
339 Ga0070701_10115962
340 Ga0070662_100010196
341 Ga0070662_100130138
342 Ga0070685_10368642
343 Ga0070679_100039320
344 Ga0070672_100107615
345 Ga0070672_100992523
346 Ga0070665_100000857
347 Ga0068855_100029059
348 Ga0070664_100048503
349 Ga0070664_100170304
350 Ga0070664_100350041
351 Ga0068857_100024662
352 Ga0068857_100192236
353 Ga0068854_100018501
354 Ga0068856_100072764
355 Ga0068852_100008802
356 Ga0068852_101343944
357 Ga0068859_100000104
358 Ga0068859_100329095
359 Ga0068859_100616539
360 Ga0068864_100000118
361 Ga0068863_100000152
362 Ga0068863_100199634
363 Ga0068858_100000778
364 Ga0068860_100003124
365 Ga0068860_100003246
366 Ga0068860_100203157
367 Ga0068862_100003115
368 Ga0068862_100024325
369 Ga0068862_100130234
370 Ga0068862_100404486
371 Ga0075364_10064361
372 Ga0097621_100029923
373 Ga0097621_100819626
374 Ga0068871_100023315
375 Ga0068865_100147228
376 Ga0075436_100888824
377 Ga0097620_100000104
378 Ga0097620_100329111
379 Ga0097620_100616542
380 Ga0105250_10010180
381 Ga0111539_10862446
382 Ga0105247_10076410
383 Ga0105248_10000295
384 Ga0105248_10432310
385 Ga0105248_11049756
386 Ga0105249_10068633
387 Ga0105249_10788428
388 Ga0157373_10017890
389 Ga0157371_10027012
390 Ga0157371_10150934
391 Ga0157371_10241658
392 Ga0157371_10437810
393 Ga0157374_11399951
394 Ga0163162_10337568
395 Ga0163162_10396504
396 Ga0157372_10054756
397 Ga0157372_11755281
398 Ga0157375_10003555
399 Ga0163163_10000478
400 Ga0157380_10003858
401 Ga0157380_10239792
402 Ga0157380_10289704
403 Ga0157379_10067080
404 Ga0163161_10233117
405 Ga0163161_10461379
406 Ga0206354_10508452
407 Ga0206353_11783975
408 Ga0207666_1046986
409 Ga0207697_10089966
410 Ga0207697_10173961
411 Ga0207696_1011567
412 Ga0207682_10000482
413 Ga0207682_10050095
414 Ga0207710_10079882
415 Ga0207688_10203282
416 Ga0207680_10058336
417 Ga0207647_10019904
418 Ga0207647_10026697
419 Ga0207705_10000190
420 Ga0207705_10006018
421 Ga0207705_10023809
422 Ga0207705_10109534
423 Ga0207705_10113592
424 Ga0207705_10353220
425 Ga0207705_10427162
426 Ga0207705_10432157
427 Ga0207705_10483731
428 Ga0207705_10584179
429 Ga0207705_11287557
430 Ga0207657_10003864
431 Ga0207657_10007525
432 Ga0207657_10052180
433 Ga0207657_10077003
434 Ga0207657_10232572
435 Ga0207657_10315206
436 Ga0207649_10017465
437 Ga0207681_10065215
438 Ga0207650_10013940
439 Ga0207650_10496086
440 Ga0207650_10668760
441 Ga0207659_10031597
442 Ga0207659_10101034
443 Ga0207664_10036775
444 Ga0207664_10267266
445 Ga0207644_10099757
446 Ga0207644_10112340
447 Ga0207690_10016293
448 Ga0207706_10002856
449 Ga0207706_10005073
450 Ga0207670_10689148
451 Ga0207669_10226565
452 Ga0207704_10054181
453 Ga0207691_10175276
454 Ga0207691_10261474
455 Ga0207711_10000153
456 Ga0207711_10336413
457 Ga0207679_10314395
458 Ga0207679_10956741
459 Ga0207667_10009453
460 Ga0207651_10078990
461 Ga0207651_10629652
462 Ga0207712_10046475
463 Ga0207668_10056341
464 Ga0207668_10083920
465 Ga0207640_10033510
466 Ga0207640_10288615
467 Ga0207658_10000453
468 Ga0207658_10029594
469 Ga0207658_10299716
470 Ga0207658_10524737
471 Ga0207658_11144756
472 Ga0207677_10592567
473 Ga0207703_10019967
474 Ga0207639_10365010
475 Ga0207678_11084892
476 Ga0207702_10103849
477 Ga0207641_10000205
478 Ga0207641_10164681
479 Ga0207676_10000702
480 Ga0207674_10115248
481 Ga0207674_10122797
482 Ga0207698_10000770
483 Ga0207698_10933385
484 Ga0268266_10000487
485 Ga0268266_10144101
486 Ga0268266_10959020
487 Ga0268265_10002247
488 Ga0268265_10369240
489 Ga0268264_10002572
490 Ga0268264_10005610
491 Ga0307513_10146341
492 Ga0307513_10213772
493 Ga0307408_100109134
494 Ga0307405_10024753
495 Ga0307405_10033856
496 Ga0307405_10128808
497 Ga0307405_10787409
498 Ga0307413_10015722
499 Ga0307413_10018237
500 Ga0307413_10020961
501 Ga0307413_10059933
502 Ga0307413_10195465
503 Ga0307413_10226069
504 Ga0307413_10555483
505 Ga0307410_10018896
506 Ga0307410_10218269
507 Ga0307410_10447192
508 Ga0307410_10559195
509 Ga0307406_10017412
510 Ga0307406_10050829
511 Ga0307406_10056941
512 Ga0307407_10098508
513 Ga0307407_10127861
514 Ga0307407_10287572
515 Ga0307407_10574134
516 Ga0307412_10117472
517 Ga0307412_10975024
518 Ga0307409_100081396
519 Ga0307409_100109243
520 Ga0307409_100110008
521 Ga0307409_100193441
522 Ga0307409_100272955
523 Ga0307409_101233314
524 Ga0307409_101268985
525 Ga0307409_101278269
526 Ga0307416_100083458
527 Ga0307416_100275366
528 Ga0307416_100485469
529 Ga0307414_10009105
530 Ga0307414_10025595
531 Ga0307414_10144091
532 Ga0307414_10180434
533 Ga0307414_10247512
534 Ga0307414_10358417
535 Ga0307414_10824158
536 Ga0307414_11416043
537 Ga0307414_12243082
538 Ga0307411_10000492
539 Ga0307411_10005402
540 Ga0307411_10085045
541 Ga0307411_10158721
542 Ga0307411_10189150
543 Ga0307411_10320488
544 Ga0307411_10421032
545 Ga0307411_10812662
546 Ga0307411_10931032
547 Ga0307415_100043600
548 Ga0307415_100167366
549 Ga0307415_100601302
550 Ga0395899_0057861
551 Ga0395900_0038764
552 Ga0395900_0046333
553 Ga0395900_0113360
554 Ga0395900_0581853
555 Ga0395905_0009153
556 Ga0395905_0039808
557 Ga0395905_0041186
558 Ga0395901_0011497
559 Ga0395901_0114354
560 Ga0395901_0280095
561 Ga0439436_0112147
562 Ga0451845_0477491
563 Ga0439458_0005229
564 Ga0439464_0059329
565 Ga0466972_0061276
566 Ga0466964_0022530
567 Ga0466971_0350999
568 Ga0466970_0105203
569 Ga0466960_0006177
570 Ga0495582_0435837
571 Ga0495668_0012523
572 Ga0495668_0182582
573 Ga0495625_0278499
574 Ga0495669_0120131
575 Ga0495670_0083942
576 Ga0495677_0034949
577 Ga0495681_0254338
578 Ga0496101_0125827
579 Ga0496107_0214651
580 Ga0496107_0958031
581 Ga0496108_0393183
582 Ga0496109_0115175
583 Ga0496110_0501639
584 Ga0496112_0098608
585 Ga0496115_0121618
586 nmdc:mga0qj67_306624_c1
587 nmdc:mga08y16_1012906_c1
588 Ga0500643_003004
589 Ga0500658_0000128
590 Ga0500559_0003827

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02639

DUF188

Uncharacterized BCR, YaiI/YqxD family COG1671

18

138

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gpa-assembly1.cif.gz_A structural mechanism for glycogen phosphorylase control by phosphorylation and amp 0.6322 4 104
1noi-assembly1.cif.gz_A complex of glycogen phosphorylase with a transition state analogue nojirimycin tetrazole and phosphate in the t and r states 0.6256 2 104
2zyz-assembly1.cif.gz_D pyrobaculum aerophilum splicing endonuclease 0.6128 89 127
3e3l-assembly1.cif.gz_B the r-state glycogen phosphorylase 0.6126 2 104
2qll-assembly1.cif.gz_A-2 human liver glycogen phosphorylase- gl complex 0.6126 1 104
ID Description Score Start End Superfamily
af_P0A8D3_17_146_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8612 18 159 3.40.50.1010
af_P0A8D3_17_146_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8427 18 159 3.40.50.1010
af_Q2G0B6_16_147_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8399 41 160 3.40.50.1010
af_Q2G0B6_16_147_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7647 41 160 3.40.50.1010
af_Q2FXM2_67_177_3.40.1390.20 Alpha Beta;3-Layer(aba) Sandwich;Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1;HprK N-terminal domain-like 0.7228 72 116 3.40.1390.20
ID Description Score Start End GO Terms
AF-A0A4Q3CAL7-F1-model_v4 YaiI/YqxD family protein 0.9679 3 119
AF-A0A3B8TSM9-F1-model_v4 deleted 0.9652 42 112
AF-A0A327JNI2-F1-model_v4 deleted 0.9651 3 97
AF-A0A7Z9K412-F1-model_v4 YaiI/YqxD family protein 0.959 1 116
AF-A0A3M1CD55-F1-model_v4 YaiI/YqxD family protein 0.958 5 106

Map