F392672

General Info

Members Datasets Scaffolds Average Seq Length
295 169 265 565

Family's Representative Sequence

Representative Sequence 3300025913|Ga0207695_10000019|Ga0207695_10000019382
Length 602
Sequence LWGLTQYFTPAGRSYIFTYRINLHICTSAYLHIPKFMIHKKTRTYIPADLEMKWEALEPIFKELLDRPINSAEELEQWLRDGSELGAAIEEDFAWRYIRMTCDTTSEELLQKFQYFATEIEPKIAPYSNELNKKLVNSEWVDKLDRDKFFIYLRGVKKALELFREENIPLQTEIQVEQQKYQGISGAMSVEIDGKEFTLEQASVFLKDTNRVKRQEIWEKITARRLQNKDELNQLFDHLRKLRHQVALNAGFENFRDYMFQALGRFDYTPQDCYAFHEAIEKEVVPILRERAEERKKALDIGTLRPWDMDVDISGKPALKPFNGGNDLIEKSIQCFSNINRYLGERLEIMKDNGLFDVESRKGKAPGGYNYPLSETGAPFIFMNSANTFRDLTTMVHEGGHAVHTFLTADLELNDFKHCPSEVAELASMSMELISMDNWDVYFDNEDDLKRAKRDQLNDVLKTLPWVAVVDQFQHWIYTNPDHTDEDRYNAWIQIYEPFGAGFADWNGLEEAERNLWQKQLHIFEVPFYYIEYGMAQLGAIAVWKNYKENPEKGLQQYLDALKLGYTKTIKEIYETAGIKFDFSAAYVKELAEFVKGEIEKL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
3 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
4 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
5 2738541283 Pedobacter sp. OK701 Isolate Unclassified
6 2738541284 Pedobacter sp. YR016 Isolate Unclassified
7 2738541302 Pedobacter sp. CF074 Isolate Unclassified
8 2738543023 Pedobacter sp. OK628 Isolate Unclassified
9 2739367651 Pedobacter sp. OK291 Isolate Unclassified
10 2739367656 Pedobacter sp. CF523 Isolate Unclassified
11 2739367663 Pedobacter sp. YR510 Isolate Unclassified
12 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
13 2818991437 Pedobacter terrae 518 Isolate Unclassified
14 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
15 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
16 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
17 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
18 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
19 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
20 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
21 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
22 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
23 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
24 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
25 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
26 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
27 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
28 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
29 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
30 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
31 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
32 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
33 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
34 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
35 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
36 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
37 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
38 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
39 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
40 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
41 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
42 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
43 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
44 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
45 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
46 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
47 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
48 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
49 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
50 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
51 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
52 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
53 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
54 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
55 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
58 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
84 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
85 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
89 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
90 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
91 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
92 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
93 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
94 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
119 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
122 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
123 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
131 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
137 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
138 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
139 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
140 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
141 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
142 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
143 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
144 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
145 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
146 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
147 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
148 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
149 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
150 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
151 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
152 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
153 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
154 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
155 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
156 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
160 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
161 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
162 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
163 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
164 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
165 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
166 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
167 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
168 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
169 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.15
Metatranscriptomes 0
Isolates 10.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.19
Nodule 0
Rhizoplane 0.34
Rhizosphere 76.61
Stem 0
Stem Tuber 0
Unclassified 11.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3953852 2162886007 Bacteria 5397
2 JGI24737J22298_10000071 3300001990 Bacteria 29829
3 JGI24737J22298_10003798 3300001990 Bacteria 5313
4 JGI24735J21928_10000013 3300002067 Bacteria 208663
5 JGI25162J39368_1000107 3300002737 Bacteria 90782
6 JGI25162J39368_1000615 3300002737 Bacteria 25611
7 JGI25152J39213_1000195 3300002773 Bacteria 40804
8 JGI25150J39212_1000014 3300002774 Bacteria 170955
9 JGI25151J46595_10000042 3300003187 Bacteria 170955
10 JGI25165J46597_1000157 3300003214 Bacteria 108987
11 JGI25153J46596_10000009 3300003215 Bacteria 340925
12 rootH1_10011876 3300003316 Bacteria 14873
13 rootH1_10011876 3300003323 Bacteria 1226
14 rootH2_10005336 3300003320 Bacteria 90063
15 rootH2_10089997 3300003320 Bacteria 5681
16 rootH2_10195616 3300003320 Bacteria 1951
17 rootL2_10195714 3300003322 Bacteria 2044
18 rootH1_10005851 3300003323 Bacteria 85811
19 rootH1_10035652 3300003323 Bacteria 2680
20 rootH1_10041079 3300003316 Bacteria 2974
21 rootH1_10041079 3300003323 Bacteria 7321
22 rootH1_10168469 3300003323 Bacteria 5985
23 Ga0055536_1000019 3300003781 Bacteria 203087
24 Ga0055530_10000770 3300003791 Bacteria 26722
25 Ga0065714_10002412 3300005288 Bacteria 18872
26 Ga0065714_10003901 3300005288 Bacteria 12762
27 Ga0065714_10064866 3300005288 Bacteria 16626
28 Ga0065714_10065891 3300005288 Bacteria 8184
29 Ga0065714_10091993 3300005288 Bacteria 1882
30 Ga0065704_10000301 3300005289 Bacteria 42046
31 Ga0070658_10000028 3300005327 Bacteria 157278
32 Ga0070676_10000729 3300005328 Bacteria 16102
33 Ga0068868_100030041 3300005338 Bacteria 4166
34 Ga0070660_100056210 3300005339 Bacteria 3044
35 Ga0070671_100038468 3300005355 Bacteria 3971
36 Ga0070659_100000337 3300005366 Bacteria 36098
37 Ga0070659_100005000 3300005366 Bacteria 9499
38 Ga0070662_100000014 3300005457 Bacteria 110124
39 Ga0070681_10046292 3300005458 Bacteria 4349
40 Ga0068867_100001403 3300005459 Bacteria 16639
41 Ga0070679_100049632 3300005530 Bacteria 4179
42 Ga0068853_100051343 3300005539 Bacteria 3549
43 Ga0070665_100000032 3300005548 Bacteria 333352
44 Ga0068855_100000049 3300005563 Bacteria 145321
45 Ga0068855_100000662 3300005563 Bacteria 42009
46 Ga0068855_100032903 3300005563 Bacteria 6190
47 Ga0068855_100044045 3300005563 Bacteria 5283
48 Ga0068854_100005184 3300005578 Bacteria 8217
49 Ga0068856_100000191 3300005614 Bacteria 64613
50 Ga0068856_100000960 3300005614 Bacteria 30788
51 Ga0068856_100025316 3300005614 Bacteria 5785
52 Ga0075366_10008301 3300006195 Bacteria 5769
53 Ga0068871_100000306 3300006358 Bacteria 34178
54 Ga0105240_10000010 3300009093 Bacteria 537830
55 Ga0105240_10018922 3300009093 Bacteria 9223
56 Ga0105241_10002362 3300009174 Bacteria 14177
57 Ga0105241_10007402 3300009174 Bacteria 8077
58 Ga0105241_10012557 3300009174 Bacteria 6213
59 Ga0105237_10000578 3300009545 Bacteria 51257
60 Ga0105237_10002429 3300009545 Bacteria 23143
61 Ga0105237_10003264 3300009545 Bacteria 19375
62 Ga0105237_10009567 3300009545 Bacteria 10376
63 Ga0105237_10017775 3300009545 Bacteria 7372
64 Ga0105237_10019775 3300009545 Bacteria 6952
65 Ga0105237_10020197 3300009545 Bacteria 6875
66 Ga0105237_10120140 3300009545 Bacteria 2622
67 Ga0105238_10009925 3300009551 Bacteria 9546
68 Ga0105238_10111000 3300009551 Bacteria 2722
69 Ga0105239_10000001 3300010375 Bacteria 617353
70 Ga0105239_10000007 3300010375 Bacteria 385297
71 Ga0105239_10000212 3300010375 Bacteria 85747
72 Ga0105239_10000352 3300010375 Bacteria 67522
73 Ga0105239_10007254 3300010375 Bacteria 12734
74 Ga0105239_10041432 3300010375 Bacteria 5047
75 Ga0105239_10124815 3300010375 Bacteria 2861
76 Ga0157373_10000245 3300013100 Bacteria 44563
77 Ga0157373_10002269 3300013100 Bacteria 14568
78 Ga0157373_10003171 3300013100 Bacteria 12427
79 Ga0157373_10003820 3300013100 Bacteria 11390
80 Ga0157373_10009785 3300013100 Bacteria 7071
81 Ga0157371_10000689 3300013102 Bacteria 39887
82 Ga0157371_10000851 3300013102 Bacteria 34883
83 Ga0157371_10002152 3300013102 Bacteria 19201
84 Ga0157371_10002946 3300013102 Bacteria 15852
85 Ga0157371_10005024 3300013102 Bacteria 11332
86 Ga0157371_10008985 3300013102 Bacteria 7902
87 Ga0157371_10048614 3300013102 Bacteria 3015
88 Ga0157370_10000197 3300013104 Bacteria 75846
89 Ga0157370_10001617 3300013104 Bacteria 27842
90 Ga0157370_10036373 3300013104 Bacteria 4778
91 Ga0157370_10057969 3300013104 Bacteria 3681
92 Ga0157370_10092814 3300013104 Bacteria 2833
93 Ga0157370_10116869 3300013104 Bacteria 2492
94 Ga0157369_10000031 3300013105 Bacteria 203214
95 Ga0157369_10014221 3300013105 Bacteria 8990
96 Ga0157369_10027921 3300013105 Bacteria 6250
97 Ga0157374_10002738 3300013296 Bacteria 14800
98 Ga0157374_10047930 3300013296 Bacteria 3963
99 Ga0157374_10060942 3300013296 Bacteria 3532
100 Ga0157378_10042996 3300013297 Bacteria 4011
101 Ga0163162_10000010 3300013306 Bacteria 302032
102 Ga0163162_10000093 3300013306 Bacteria 82738
103 Ga0163162_10023369 3300013306 Bacteria 6101
104 Ga0157372_10000073 3300013307 Bacteria 107356
105 Ga0157372_10000173 3300013307 Bacteria 71416
106 Ga0157372_10000614 3300013307 Bacteria 38907
107 Ga0157372_10002062 3300013307 Bacteria 21839
108 Ga0157372_10006682 3300013307 Bacteria 12269
109 Ga0157372_10023318 3300013307 Bacteria 6708
110 Ga0157372_10065035 3300013307 Bacteria 4094
111 Ga0157375_10124680 3300013308 Bacteria 2689
112 Ga0157375_10191610 3300013308 Bacteria 2199
113 Ga0157380_10000194 3300014326 Bacteria 35515
114 Ga0182008_10000024 3300014497 Bacteria 199978
115 Ga0182008_10000082 3300014497 Bacteria 74716
116 Ga0182008_10000157 3300014497 Bacteria 53598
117 Ga0182006_1000373 3300015261 Bacteria 37119
118 Ga0182006_1002189 3300015261 Bacteria 10835
119 Ga0182006_1003663 3300015261 Bacteria 7798
120 Ga0182007_10000002 3300015262 Bacteria 564661
121 Ga0182007_10008942 3300015262 Bacteria 4079
122 Ga0182007_10017443 3300015262 Bacteria 2622
123 Ga0183373_1004 3300015682 Bacteria 537398
124 Ga0163161_10000964 3300017792 Bacteria 22069
125 Ga0163161_10001255 3300017792 Bacteria 18992
126 Ga0163161_10001554 3300017792 Bacteria 16943
127 Ga0209563_103533 3300025230 Bacteria 3202
128 Ga0207427_100025 3300025231 Bacteria 433726
129 Ga0209437_100010 3300025233 Bacteria 838447
130 Ga0209437_100148 3300025233 Bacteria 158795
131 Ga0207425_1000023 3300025245 Bacteria 341339
132 Ga0209026_1000427 3300025250 Bacteria 35425
133 Ga0209026_1000430 3300025250 Bacteria 35017
134 Ga0209129_1000032 3300025258 Bacteria 341150
135 Ga0209233_1000017 3300025261 Bacteria 898076
136 Ga0209676_1000009 3300025292 Bacteria 981719
137 Ga0209025_1000047 3300025294 Bacteria 341150
138 Ga0209758_1000145 3300025297 Bacteria 170553
139 Ga0209050_1000094 3300025298 Bacteria 242893
140 Ga0207647_10000680 3300025904 Bacteria 26722
141 Ga0207647_10013369 3300025904 Bacteria 5693
142 Ga0207645_10000591 3300025907 Bacteria 30054
143 Ga0207705_10000045 3300025909 Bacteria 180625
144 Ga0207654_10001057 3300025911 Bacteria 14992
145 Ga0207695_10000019 3300025913 Bacteria 732137
146 Ga0207695_10039525 3300025913 Bacteria 5070
147 Ga0207695_10080283 3300025913 Bacteria 3303
148 Ga0207671_10002404 3300025914 Bacteria 20077
149 Ga0207671_10002702 3300025914 Bacteria 18606
150 Ga0207671_10003542 3300025914 Bacteria 15486
151 Ga0207671_10007187 3300025914 Bacteria 9704
152 Ga0207671_10030954 3300025914 Bacteria 3990
153 Ga0207657_10130325 3300025919 Bacteria 2061
154 Ga0207652_10006186 3300025921 Bacteria 9672
155 Ga0207694_10018923 3300025924 Bacteria 5206
156 Ga0207690_10003899 3300025932 Bacteria 8819
157 Ga0207706_10000057 3300025933 Bacteria 112805
158 Ga0207704_10000266 3300025938 Bacteria 25142
159 Ga0207667_10000015 3300025949 Bacteria 417534
160 Ga0207667_10002856 3300025949 Bacteria 21432
161 Ga0207667_10045810 3300025949 Bacteria 4631
162 Ga0207667_10178120 3300025949 Bacteria 2184
163 Ga0207677_10020543 3300026023 Bacteria 4012
164 Ga0207677_10029690 3300026023 Bacteria 3479
165 Ga0207639_10011707 3300026041 Bacteria 6100
166 Ga0207702_10003100 3300026078 Bacteria 15419
167 Ga0207702_10006957 3300026078 Bacteria 9686
168 Ga0207702_10014689 3300026078 Bacteria 6497
169 Ga0207702_10074516 3300026078 Bacteria 2930
170 Ga0207648_10014266 3300026089 Bacteria 7345
171 Ga0207683_10008342 3300026121 Bacteria 8861
172 Ga0207698_10045532 3300026142 Bacteria 3306
173 Ga0268266_10000030 3300028379 Bacteria 417120
174 Ga0307517_10036080 3300028786 Bacteria 5573
175 Ga0307515_10000376 3300028794 Bacteria 109190
176 Ga0307515_10005206 3300028794 Bacteria 26435
177 Ga0307515_10050570 3300028794 Bacteria 6220
178 Ga0265338_10028578 3300028800 Bacteria 5557
179 Ga0265338_10087533 3300028800 Bacteria 2588
180 Ga0316177_1152729 3300030731 Bacteria 7429
181 Ga0316176_1002041 3300030732 Bacteria 7401
182 Ga0316182_1350008 3300030745 Bacteria 1957
183 Ga0307408_100001616 3300031548 Bacteria 16678
184 Ga0307408_100007868 3300031548 Bacteria 7047
185 Ga0307408_100033705 3300031548 Bacteria 3580
186 Ga0307405_10000015 3300031731 Bacteria 206299
187 Ga0307407_10000027 3300031903 Bacteria 107307
188 Ga0307412_10000030 3300031911 Bacteria 208541
189 Ga0307416_100000002 3300032002 Bacteria 509907
190 Ga0307416_100051344 3300032002 Bacteria 3293
191 Ga0307414_10000262 3300032004 Bacteria 33057
192 Ga0307414_10003255 3300032004 Bacteria 8656
193 Ga0307414_10011036 3300032004 Bacteria 5280
194 Ga0307414_10011105 3300032004 Bacteria 5267
195 Ga0307414_10056894 3300032004 Bacteria 2746
196 Ga0307507_10000032 3300033179 Bacteria 194155
197 Ga0307510_10010205 3300033180 Bacteria 11166
198 Ga0395899_0000002 3300037312 Bacteria 1324310
199 Ga0395899_0000025 3300037312 Bacteria 350927
200 Ga0395899_0000887 3300037312 Bacteria 28407
201 Ga0395899_0022353 3300037312 Bacteria 4796
202 Ga0395900_0000143 3300037418 Bacteria 120234
203 Ga0395900_0003189 3300037418 Bacteria 17771
204 Ga0395900_0010532 3300037418 Bacteria 9458
205 Ga0395900_0137308 3300037418 Bacteria 2505
206 Ga0395905_0000011 3300037471 Bacteria 424563
207 Ga0395905_0000175 3300037471 Bacteria 104024
208 Ga0395905_0002359 3300037471 Bacteria 21041
209 Ga0395901_0000313 3300038443 Bacteria 59766
210 Ga0395901_0024555 3300038443 Bacteria 6189
211 Ga0439448_0001918 3300042005 Bacteria 5538
212 Ga0466966_0013641 3300044684 Bacteria 5376
213 Ga0466961_0024459 3300044693 Bacteria 3885
214 Ga0495592_0062454 3300046454 Bacteria 2735
215 Ga0495650_0000162 3300046471 Bacteria 148927
216 Ga0495650_0028223 3300046471 Bacteria 2581
217 Ga0495585_0000153 3300046492 Bacteria 74267
218 Ga0495585_0000853 3300046492 Bacteria 26111
219 Ga0495606_0000033 3300046507 Bacteria 247739
220 Ga0495606_0026096 3300046507 Bacteria 4168
221 Ga0495606_0026115 3300046507 Bacteria 4166
222 Ga0495610_0000768 3300046512 Bacteria 30249
223 Ga0495610_0002306 3300046512 Bacteria 16113
224 Ga0495610_0003961 3300046512 Bacteria 11206
225 Ga0495616_0003247 3300046513 Bacteria 10462
226 Ga0495616_0007001 3300046513 Bacteria 6785
227 Ga0495631_0010184 3300046518 Bacteria 4664
228 Ga0495637_0033953 3300046520 Bacteria 2237
229 Ga0495648_0003060 3300046524 Bacteria 14948
230 Ga0495609_0009817 3300046538 Bacteria 4615
231 Ga0495633_0000389 3300046558 Bacteria 46261
232 Ga0495633_0003181 3300046558 Bacteria 11095
233 Ga0495668_0000009 3300046616 Bacteria 492623
234 Ga0495625_0000131 3300046660 Bacteria 117738
235 Ga0495625_0000951 3300046660 Bacteria 38714
236 Ga0495625_0001562 3300046660 Bacteria 27264
237 Ga0495625_0015553 3300046660 Bacteria 6022
238 Ga0495625_0038852 3300046660 Bacteria 3479
239 Ga0495661_0000134 3300046665 Bacteria 87487
240 Ga0495661_0006762 3300046665 Bacteria 8039
241 Ga0495649_0000009 3300046694 Bacteria 451725
242 Ga0495660_0020433 3300046810 Bacteria 3796
243 Ga0495683_0016002 3300047323 Bacteria 3896
244 Ga0495687_010903 3300047443 Bacteria 4934
245 Ga0495687_021762 3300047443 Bacteria 3092
246 Ga0495684_0089869 3300047471 Bacteria 2327
247 Ga0495686_0000843 3300047472 Bacteria 39372
248 Ga0495686_0000973 3300047472 Bacteria 35208
249 Ga0495686_0038877 3300047472 Bacteria 3042
250 Ga0495686_0044149 3300047472 Bacteria 2822
251 Ga0496123_0004125 3300048926 Bacteria 15552
252 Ga0496125_0045368 3300048928 Bacteria 3700
253 Ga0495682_0004552 3300049460 Bacteria 5911
254 nmdc:mga0k408_1458_c1 3300050493 Bacteria 12758
255 nmdc:mga0k408_320_c1 3300050493 Bacteria 26097
256 nmdc:mga0k408_83714_c1 3300050493 Bacteria 1870
257 Ga0500635_0000819 3300053080 Bacteria 7670
258 Ga0500635_0005439 3300053080 Bacteria 3340
259 Ga0500647_0094795 3300053091 Bacteria 1428
260 Ga0500651_0000462 3300053093 Bacteria 21501
261 Ga0500608_001479 3300053122 Bacteria 8394
262 Ga0500618_000012 3300053125 Bacteria 185382
263 Ga0500618_015307 3300053125 Bacteria 1941
264 Ga0500622_0001589 3300053156 Bacteria 17882
265 Ga0500624_000118 3300053157 Bacteria 35980

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053091 Ga0500647_0094795 Ga0500647_0094795_31_1413 455
2 3300002737 JGI25162J39368_1000107 JGI25162J39368_100010752 547
3 3300005328 Ga0070676_10000729 Ga0070676_1000072912 547
4 3300005338 Ga0068868_100030041 Ga0068868_1000300413 547
5 3300005459 Ga0068867_100001403 Ga0068867_10000140315 547
6 3300006358 Ga0068871_100000306 Ga0068871_10000030626 547
7 3300009174 Ga0105241_10012557 Ga0105241_100125575 547
8 3300009545 Ga0105237_10009567 Ga0105237_100095674 547
9 3300009551 Ga0105238_10009925 Ga0105238_100099257 547
10 3300010375 Ga0105239_10000212 Ga0105239_1000021234 547
11 3300013296 Ga0157374_10060942 Ga0157374_100609423 547
12 3300025233 Ga0209437_100148 Ga0209437_10014890 547
13 3300025907 Ga0207645_10000591 Ga0207645_100005915 547
14 3300025924 Ga0207694_10018923 Ga0207694_100189232 547
15 3300025938 Ga0207704_10000266 Ga0207704_100002667 547
16 3300026023 Ga0207677_10020543 Ga0207677_100205433 547
17 3300026089 Ga0207648_10014266 Ga0207648_100142668 547
18 3300026121 Ga0207683_10008342 Ga0207683_100083427 547
19 3300026142 Ga0207698_10045532 Ga0207698_100455322 547
20 3300042005 Ga0439448_0001918 Ga0439448_0001918_2248_3948 547
21 3300046616 Ga0495668_0000009 Ga0495668_0000009_216151_217854 547
22 3300053080 Ga0500635_0005439 Ga0500635_0005439_196_1896 548
23 3300053122 Ga0500608_001479 Ga0500608_001479_3996_5696 549
24 3300001990 JGI24737J22298_10000071 JGI24737J22298_100000713 550
25 3300002067 JGI24735J21928_10000013 JGI24735J21928_10000013151 550
26 3300013307 Ga0157372_10006682 Ga0157372_100066826 550
27 3300003323 rootH1_10168469 rootH1_101684696 551
28 3300013306 Ga0163162_10000010 Ga0163162_10000010264 551
29 3300025250 Ga0209026_1000430 Ga0209026_100043013 551
30 3300003320 rootH2_10089997 rootH2_100899974 552
31 3300009545 Ga0105237_10017775 Ga0105237_100177756 552
32 3300028800 Ga0265338_10028578 Ga0265338_100285785 552
33 3300033179 Ga0307507_10000032 Ga0307507_10000032141 552
34 3300046558 Ga0495633_0000389 Ga0495633_0000389_11075_12778 552
35 3300046660 Ga0495625_0001562 Ga0495625_0001562_6737_8440 552
36 3300047443 Ga0495687_021762 Ga0495687_021762_734_2437 552
37 3300050493 nmdc:mga0k408_320_c1 nmdc:mga0k408_320_c1_14053_15756 552
38 3300026078 Ga0207702_10014689 Ga0207702_100146895 553
39 3300046512 Ga0495610_0003961 Ga0495610_0003961_1531_3234 553
40 3300046558 Ga0495633_0003181 Ga0495633_0003181_8237_9940 553
41 3300053157 Ga0500624_000118 Ga0500624_000118_21588_23291 554
42 3300028794 Ga0307515_10000376 Ga0307515_1000037695 556
43 3300028786 Ga0307517_10036080 Ga0307517_100360805 557
44 3300033180 Ga0307510_10010205 Ga0307510_100102051 557
45 3300046507 Ga0495606_0000033 Ga0495606_0000033_195335_197038 558
46 3300047472 Ga0495686_0044149 Ga0495686_0044149_946_2649 558
47 3300047472 Ga0495686_0000843 Ga0495686_0000843_17288_18988 559
48 3300013306 Ga0163162_10023369 Ga0163162_100233692 560
49 3300025913 Ga0207695_10080283 Ga0207695_100802833 560
50 3300046471 Ga0495650_0000162 Ga0495650_0000162_105676_107379 560
51 3300046513 Ga0495616_0003247 Ga0495616_0003247_4061_5764 560
52 3300046520 Ga0495637_0033953 Ga0495637_0033953_108_1811 560
53 3300046660 Ga0495625_0000131 Ga0495625_0000131_73095_74798 560
54 3300046665 Ga0495661_0006762 Ga0495661_0006762_2517_4220 560
55 3300046694 Ga0495649_0000009 Ga0495649_0000009_73085_74788 560
56 3300046810 Ga0495660_0020433 Ga0495660_0020433_1334_3037 560
57 3300053125 Ga0500618_015307 Ga0500618_015307_140_1843 560
58 3300046492 Ga0495585_0000153 Ga0495585_0000153_57011_58714 561
59 3300028794 Ga0307515_10005206 Ga0307515_100052069 562
60 3300046492 Ga0495585_0000853 Ga0495585_0000853_22404_24107 562
61 3300046524 Ga0495648_0003060 Ga0495648_0003060_2883_4586 562
62 3300046660 Ga0495625_0000951 Ga0495625_0000951_15746_17449 562
63 3300049460 Ga0495682_0004552 Ga0495682_0004552_881_2584 562
64 iso_pu_bacteria 2852623160 2852625043 562
65 iso_pu_bacteria 2884933994 2884934060 562
66 iso_pu_bacteria 2585427687 2586206288 563
67 iso_pu_bacteria 2599185184 2599480410 563
68 iso_pu_bacteria 2738541302 2738856163 563
69 iso_pu_bacteria 2818991437 2819546254 563
70 iso_pu_bacteria 2842722452 2842723917 563
71 iso_pu_bacteria 2842909656 2842912351 563
72 iso_pu_bacteria 2849281842 2849282784 563
73 iso_pu_bacteria 2904445276 2904446525 563
74 iso_pu_bacteria 2919437846 2919438285 563
75 iso_pu_bacteria 2928078545 2928083349 563
76 iso_pu_bacteria 2928147474 2928151389 563
77 iso_pu_bacteria 2932082852 2932087308 563
78 iso_pu_bacteria 2945997725 2945999337 563
79 iso_pu_bacteria 2739367651 2739588276 564
80 iso_pu_bacteria 2739367656 2739613951 564
81 iso_pu_bacteria 2739367663 2739648552 564
82 iso_pu_bacteria 2857627736 2857629306 564
83 iso_pu_bacteria 2954016120 2954021734 564
84 3300013308 Ga0157375_10191610 Ga0157375_101916102 565
85 3300046454 Ga0495592_0062454 Ga0495592_0062454_37_1761 565
86 3300047471 Ga0495684_0089869 Ga0495684_0089869_538_2262 565
87 iso_pu_bacteria 2842903701 2842908801 565
88 iso_pu_bacteria 2902048731 2902052262 565
89 3300001990 JGI24737J22298_10003798 JGI24737J22298_100037984 566
90 3300002737 JGI25162J39368_1000615 JGI25162J39368_100061515 566
91 3300003214 JGI25165J46597_1000157 JGI25165J46597_100015728 566
92 3300003320 rootH2_10005336 rootH2_1000533665 566
93 3300003323 rootH1_10005851 rootH1_1000585187 566
94 3300003323 rootH1_10041079 rootH1_100410793 566
95 3300005327 Ga0070658_10000028 Ga0070658_1000002870 566
96 3300005339 Ga0070660_100056210 Ga0070660_1000562102 566
97 3300005355 Ga0070671_100038468 Ga0070671_1000384683 566
98 3300005366 Ga0070659_100005000 Ga0070659_1000050002 566
99 3300005457 Ga0070662_100000014 Ga0070662_10000001455 566
100 3300005458 Ga0070681_10046292 Ga0070681_100462923 566
101 3300005530 Ga0070679_100049632 Ga0070679_1000496322 566
102 3300005563 Ga0068855_100000662 Ga0068855_10000066210 566
103 3300005563 Ga0068855_100032903 Ga0068855_1000329035 566
104 3300005563 Ga0068855_100044045 Ga0068855_1000440455 566
105 3300005614 Ga0068856_100000960 Ga0068856_10000096032 566
106 3300005614 Ga0068856_100025316 Ga0068856_1000253164 566
107 3300006195 Ga0075366_10008301 Ga0075366_100083014 566
108 3300009093 Ga0105240_10000010 Ga0105240_1000001069 566
109 3300009093 Ga0105240_10018922 Ga0105240_100189226 566
110 3300009174 Ga0105241_10002362 Ga0105241_1000236210 566
111 3300009174 Ga0105241_10007402 Ga0105241_100074028 566
112 3300009545 Ga0105237_10002429 Ga0105237_1000242915 566
113 3300009545 Ga0105237_10003264 Ga0105237_100032645 566
114 3300009545 Ga0105237_10019775 Ga0105237_100197754 566
115 3300009545 Ga0105237_10020197 Ga0105237_100201974 566
116 3300009545 Ga0105237_10120140 Ga0105237_101201402 566
117 3300010375 Ga0105239_10000001 Ga0105239_10000001294 566
118 3300010375 Ga0105239_10000007 Ga0105239_10000007160 566
119 3300010375 Ga0105239_10000352 Ga0105239_1000035230 566
120 3300010375 Ga0105239_10007254 Ga0105239_1000725412 566
121 3300010375 Ga0105239_10041432 Ga0105239_100414322 566
122 3300010375 Ga0105239_10124815 Ga0105239_101248152 566
123 3300013100 Ga0157373_10003820 Ga0157373_100038203 566
124 3300013102 Ga0157371_10002946 Ga0157371_1000294617 566
125 3300013104 Ga0157370_10036373 Ga0157370_100363731 566
126 3300013296 Ga0157374_10002738 Ga0157374_1000273813 566
127 3300013296 Ga0157374_10047930 Ga0157374_100479304 566
128 3300013297 Ga0157378_10042996 Ga0157378_100429964 566
129 3300013307 Ga0157372_10000173 Ga0157372_1000017333 566
130 3300013307 Ga0157372_10023318 Ga0157372_100233182 566
131 3300013307 Ga0157372_10065035 Ga0157372_100650352 566
132 3300025230 Ga0209563_103533 Ga0209563_1035332 566
133 3300025231 Ga0207427_100025 Ga0207427_100025114 566
134 3300025233 Ga0209437_100010 Ga0209437_100010376 566
135 3300025261 Ga0209233_1000017 Ga0209233_1000017389 566
136 3300025904 Ga0207647_10000680 Ga0207647_1000068016 566
137 3300025904 Ga0207647_10013369 Ga0207647_100133693 566
138 3300025909 Ga0207705_10000045 Ga0207705_1000004570 566
139 3300025911 Ga0207654_10001057 Ga0207654_1000105714 566
140 3300025913 Ga0207695_10039525 Ga0207695_100395255 566
141 3300025914 Ga0207671_10003542 Ga0207671_100035425 566
142 3300025914 Ga0207671_10007187 Ga0207671_100071872 566
143 3300025914 Ga0207671_10030954 Ga0207671_100309542 566
144 3300025919 Ga0207657_10130325 Ga0207657_101303251 566
145 3300025921 Ga0207652_10006186 Ga0207652_100061863 566
146 3300025933 Ga0207706_10000057 Ga0207706_1000005781 566
147 3300025949 Ga0207667_10002856 Ga0207667_100028567 566
148 3300025949 Ga0207667_10045810 Ga0207667_100458104 566
149 3300025949 Ga0207667_10178120 Ga0207667_101781202 566
150 3300026023 Ga0207677_10029690 Ga0207677_100296901 566
151 3300026078 Ga0207702_10006957 Ga0207702_100069575 566
152 3300026078 Ga0207702_10074516 Ga0207702_100745162 566
153 3300037312 Ga0395899_0000002 Ga0395899_0000002_552416_554116 566
154 3300037312 Ga0395899_0000887 Ga0395899_0000887_11227_12927 566
155 3300037312 Ga0395899_0022353 Ga0395899_0022353_2617_4317 566
156 3300037418 Ga0395900_0000143 Ga0395900_0000143_12395_14095 566
157 3300037418 Ga0395900_0010532 Ga0395900_0010532_5577_7277 566
158 3300037471 Ga0395905_0000011 Ga0395905_0000011_229845_231569 566
159 3300037471 Ga0395905_0000175 Ga0395905_0000175_18586_20286 566
160 3300037471 Ga0395905_0002359 Ga0395905_0002359_2154_3854 566
161 3300038443 Ga0395901_0000313 Ga0395901_0000313_15470_17170 566
162 3300038443 Ga0395901_0024555 Ga0395901_0024555_2144_3844 566
163 3300046471 Ga0495650_0028223 Ga0495650_0028223_13_1713 566
164 3300046507 Ga0495606_0026115 Ga0495606_0026115_581_2281 566
165 3300046518 Ga0495631_0010184 Ga0495631_0010184_1943_3643 566
166 3300046665 Ga0495661_0000134 Ga0495661_0000134_64650_66350 566
167 3300047323 Ga0495683_0016002 Ga0495683_0016002_737_2437 566
168 3300047443 Ga0495687_010903 Ga0495687_010903_47_1747 566
169 3300047472 Ga0495686_0000973 Ga0495686_0000973_5517_7217 566
170 3300047472 Ga0495686_0038877 Ga0495686_0038877_684_2384 566
171 3300050493 nmdc:mga0k408_1458_c1 nmdc:mga0k408_1458_c1_7545_9245 566
172 3300050493 nmdc:mga0k408_83714_c1 nmdc:mga0k408_83714_c1_49_1749 566
173 3300053125 Ga0500618_000012 Ga0500618_000012_100139_101839 566
174 3300053156 Ga0500622_0001589 Ga0500622_0001589_826_2526 566
175 iso_pu_bacteria 2910245624 2910248517 566
176 iso_pu_bacteria 2977232053 2977236048 566
177 3300003316 rootH1_10011876 rootH1_1001187611 567
178 3300003322 rootL2_10195714 rootL2_101957141 567
179 3300005288 Ga0065714_10064866 Ga0065714_100648668 567
180 3300005366 Ga0070659_100000337 Ga0070659_10000033720 567
181 3300005539 Ga0068853_100051343 Ga0068853_1000513432 567
182 3300005578 Ga0068854_100005184 Ga0068854_1000051842 567
183 3300005614 Ga0068856_100000191 Ga0068856_10000019118 567
184 3300009551 Ga0105238_10111000 Ga0105238_101110002 567
185 3300013102 Ga0157371_10000851 Ga0157371_1000085125 567
186 3300013102 Ga0157371_10005024 Ga0157371_100050247 567
187 3300013102 Ga0157371_10048614 Ga0157371_100486142 567
188 3300013104 Ga0157370_10057969 Ga0157370_100579693 567
189 3300013104 Ga0157370_10092814 Ga0157370_100928143 567
190 3300013104 Ga0157370_10116869 Ga0157370_101168692 567
191 3300013105 Ga0157369_10014221 Ga0157369_100142218 567
192 3300013306 Ga0163162_10000093 Ga0163162_1000009338 567
193 3300013307 Ga0157372_10000073 Ga0157372_1000007316 567
194 3300013307 Ga0157372_10000614 Ga0157372_1000061415 567
195 3300014326 Ga0157380_10000194 Ga0157380_1000019414 567
196 3300014497 Ga0182008_10000157 Ga0182008_1000015741 567
197 3300015261 Ga0182006_1002189 Ga0182006_10021896 567
198 3300025914 Ga0207671_10002702 Ga0207671_100027026 567
199 3300025932 Ga0207690_10003899 Ga0207690_100038993 567
200 3300026078 Ga0207702_10003100 Ga0207702_1000310014 567
201 3300028800 Ga0265338_10087533 Ga0265338_100875332 567
202 3300031731 Ga0307405_10000015 Ga0307405_1000001599 567
203 3300031903 Ga0307407_10000027 Ga0307407_1000002732 567
204 3300032002 Ga0307416_100000002 Ga0307416_10000000258 567
205 3300032004 Ga0307414_10003255 Ga0307414_100032558 567
206 3300032004 Ga0307414_10011105 Ga0307414_100111055 567
207 3300037312 Ga0395899_0000025 Ga0395899_0000025_214204_215943 567
208 3300037418 Ga0395900_0003189 Ga0395900_0003189_15775_17478 567
209 3300037418 Ga0395900_0137308 Ga0395900_0137308_202_1941 567
210 3300044684 Ga0466966_0013641 Ga0466966_0013641_1850_3553 567
211 3300044693 Ga0466961_0024459 Ga0466961_0024459_810_2513 567
212 3300046512 Ga0495610_0000768 Ga0495610_0000768_14308_16011 567
213 3300046512 Ga0495610_0002306 Ga0495610_0002306_7043_8746 567
214 3300046513 Ga0495616_0007001 Ga0495616_0007001_4560_6263 567
215 3300046660 Ga0495625_0015553 Ga0495625_0015553_4112_5815 567
216 3300046660 Ga0495625_0038852 Ga0495625_0038852_15_1718 567
217 3300053080 Ga0500635_0000819 Ga0500635_0000819_71_1774 567
218 iso_pu_bacteria 2522125168 2522552519 567
219 iso_pu_bacteria 2738541283 2738755424 567
220 iso_pu_bacteria 2738541284 2738763521 567
221 iso_pu_bacteria 2738543023 2739303257 567
222 iso_pu_bacteria 2775506987 2776615041 567
223 iso_pu_bacteria 2852627209 2852629502 567
224 iso_pu_bacteria 2919186247 2919190275 567
225 iso_pu_bacteria 2939664404 2939668556 567
226 3300003781 Ga0055536_1000019 Ga0055536_1000019117 568
227 3300003791 Ga0055530_10000770 Ga0055530_1000077023 568
228 3300013104 Ga0157370_10001617 Ga0157370_1000161710 568
229 3300013105 Ga0157369_10000031 Ga0157369_1000003139 568
230 3300015262 Ga0182007_10000002 Ga0182007_1000000270 568
231 3300015682 Ga0183373_1004 Ga0183373_1004404 568
232 3300017792 Ga0163161_10001255 Ga0163161_1000125511 568
233 3300017792 Ga0163161_10001554 Ga0163161_1000155411 568
234 3300025292 Ga0209676_1000009 Ga0209676_100000966 568
235 3300025298 Ga0209050_1000094 Ga0209050_100009466 568
236 3300031548 Ga0307408_100001616 Ga0307408_1000016165 568
237 3300031548 Ga0307408_100007868 Ga0307408_1000078684 568
238 3300031548 Ga0307408_100033705 Ga0307408_1000337051 568
239 3300032002 Ga0307416_100051344 Ga0307416_1000513442 568
240 3300046507 Ga0495606_0026096 Ga0495606_0026096_711_2417 568
241 3300005548 Ga0070665_100000032 Ga0070665_100000032198 569
242 3300005563 Ga0068855_100000049 Ga0068855_10000004987 569
243 3300025949 Ga0207667_10000015 Ga0207667_10000015337 569
244 3300028379 Ga0268266_10000030 Ga0268266_10000030132 569
245 3300030731 Ga0316177_1152729 Ga0316177_11527295 569
246 3300030732 Ga0316176_1002041 Ga0316176_10020413 569
247 3300030745 Ga0316182_1350008 Ga0316182_13500082 569
248 3300002773 JGI25152J39213_1000195 JGI25152J39213_100019532 570
249 3300002774 JGI25150J39212_1000014 JGI25150J39212_100001465 570
250 3300003187 JGI25151J46595_10000042 JGI25151J46595_1000004265 570
251 3300003215 JGI25153J46596_10000009 JGI25153J46596_1000000965 570
252 3300013100 Ga0157373_10000245 Ga0157373_1000024523 570
253 3300013307 Ga0157372_10002062 Ga0157372_1000206215 570
254 3300025245 Ga0207425_1000023 Ga0207425_100002364 570
255 3300025250 Ga0209026_1000427 Ga0209026_100042726 570
256 3300025258 Ga0209129_1000032 Ga0209129_1000032209 570
257 3300025294 Ga0209025_1000047 Ga0209025_1000047209 570
258 3300025297 Ga0209758_1000145 Ga0209758_100014564 570
259 3300025913 Ga0207695_10000019 Ga0207695_10000019382 570
260 3300026041 Ga0207639_10011707 Ga0207639_100117076 570
261 2162886007 SwRhRL2b_contig_3953852 SwRhRL2b_0656.00003700 571
262 3300003320 rootH2_10195616 rootH2_101956161 571
263 3300003323 rootH1_10035652 rootH1_100356522 571
264 3300005288 Ga0065714_10002412 Ga0065714_1000241211 571
265 3300005288 Ga0065714_10003901 Ga0065714_1000390112 571
266 3300005288 Ga0065714_10065891 Ga0065714_100658917 571
267 3300005288 Ga0065714_10091993 Ga0065714_100919931 571
268 3300005289 Ga0065704_10000301 Ga0065704_100003013 571
269 3300009545 Ga0105237_10000578 Ga0105237_1000057827 571
270 3300013100 Ga0157373_10002269 Ga0157373_100022698 571
271 3300013100 Ga0157373_10003171 Ga0157373_100031713 571
272 3300013100 Ga0157373_10009785 Ga0157373_100097854 571
273 3300013102 Ga0157371_10000689 Ga0157371_100006898 571
274 3300013102 Ga0157371_10002152 Ga0157371_1000215214 571
275 3300013102 Ga0157371_10008985 Ga0157371_100089859 571
276 3300013104 Ga0157370_10000197 Ga0157370_1000019761 571
277 3300013105 Ga0157369_10027921 Ga0157369_100279217 571
278 3300013308 Ga0157375_10124680 Ga0157375_101246802 571
279 3300014497 Ga0182008_10000024 Ga0182008_1000002441 571
280 3300014497 Ga0182008_10000082 Ga0182008_1000008259 571
281 3300015261 Ga0182006_1000373 Ga0182006_100037324 571
282 3300015261 Ga0182006_1003663 Ga0182006_10036633 571
283 3300015262 Ga0182007_10008942 Ga0182007_100089422 571
284 3300015262 Ga0182007_10017443 Ga0182007_100174432 571
285 3300017792 Ga0163161_10000964 Ga0163161_1000096417 571
286 3300025914 Ga0207671_10002404 Ga0207671_1000240414 571
287 3300028794 Ga0307515_10050570 Ga0307515_100505702 571
288 3300031911 Ga0307412_10000030 Ga0307412_10000030154 571
289 3300032004 Ga0307414_10000262 Ga0307414_1000026216 571
290 3300032004 Ga0307414_10011036 Ga0307414_100110362 571
291 3300032004 Ga0307414_10056894 Ga0307414_100568943 571
292 3300046538 Ga0495609_0009817 Ga0495609_0009817_2317_4032 571
293 3300048926 Ga0496123_0004125 Ga0496123_0004125_3785_5500 571
294 3300048928 Ga0496125_0045368 Ga0496125_0045368_1037_2752 571
295 3300053093 Ga0500651_0000462 Ga0500651_0000462_347_2062 571

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01432

Peptidase_M3

Peptidase family M3

204

593

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2h1j-assembly2.cif.gz_B 3.1 a x-ray structure of putative oligoendopeptidase f: crystals grown by microfluidic seeding 0.942 16 568
3aho-assembly1.cif.gz_A pz peptidase a with inhibitor 2 0.9361 17 569
2h1j-assembly2.cif.gz_B 3.1 a x-ray structure of putative oligoendopeptidase f: crystals grown by microfluidic seeding 0.9209 16 568
3sks-assembly1.cif.gz_A crystal structure of a putative oligoendopeptidase f from bacillus anthracis str. ames 0.9204 10 569
3aho-assembly1.cif.gz_A pz peptidase a with inhibitor 2 0.9168 17 569
ID Description Score Start End Superfamily
2h1jA00 Mainly Alpha;Orthogonal Bundle;Neurolysin; domain 3; 0.9448 16 568 1.10.1370.30
2h1jA00 Mainly Alpha;Orthogonal Bundle;Neurolysin; domain 3; 0.9232 16 568 1.10.1370.30
af_Q2FYQ2_225_603_1.10.1370.20 Mainly Alpha;Orthogonal Bundle;Neurolysin; domain 3;Oligoendopeptidase f, C-terminal domain 0.777 201 570 1.10.1370.20
af_Q10714_28_605_1.10.1370.30 Mainly Alpha;Orthogonal Bundle;Neurolysin; domain 3; 0.7624 47 569 1.10.1370.30
af_Q2FYQ2_225_603_1.10.1370.20 Mainly Alpha;Orthogonal Bundle;Neurolysin; domain 3;Oligoendopeptidase f, C-terminal domain 0.748 201 570 1.10.1370.20
ID Description Score Start End GO Terms
AF-A0A4Q3GRV8-F1-model_v4 deleted 0.9937 1 370
AF-A0A3C2AIY3-F1-model_v4 M3 family oligoendopeptidase 0.9917 5 468 GO:0004222
GO:0006508
GO:0046872
AF-A0A846MMA7-F1-model_v4 Oligoendopeptidase F (EC 3.4.24.-) 0.989 20 565 GO:0004222
GO:0006508
GO:0006518
GO:0046872
AF-A0A520H3L2-F1-model_v4 M3 family oligoendopeptidase 0.9884 43 415 GO:0004222
GO:0006508
GO:0006518
GO:0046872
AF-A0A4Q3GRV8-F1-model_v4 deleted 0.9884 1 370

Feature Viewer

pLDDT pTM Quality
94.1 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map