F392596

General Info

Members Datasets Scaffolds Average Seq Length
295 149 295 114

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10003833|Ga0099794_100038336
Length 114
Sequence MNMDDCIFCKIAQGKIPAQRLAEDDELLAFPDIEPQAPVHVLVIPKQHVPSLHDVKDWSLVGRLHALALRVARDQGIADSGFRVLINTGADGVQTVGHVHLHLLGGRTMQWPPG

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
59 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
115 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
116 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
117 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
118 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
119 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
120 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
121 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
122 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
123 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
124 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
125 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
126 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
127 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
128 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
129 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
130 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
131 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
132 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
133 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
134 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
137 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
140 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
141 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
142 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
143 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
144 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
145 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
146 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
147 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
148 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
149 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.03
Rhizosphere 97.97
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10189849 3300005293 Bacteria 1422
2 Ga0065707_10130109 3300005295 Bacteria 1935
3 Ga0070676_10606361 3300005328 Bacteria 790
4 Ga0070676_11576766 3300005328 Bacteria 507
5 Ga0070690_100097879 3300005330 Bacteria 1941
6 Ga0070670_100184538 3300005331 Bacteria 1811
7 Ga0068869_101155574 3300005334 Bacteria 679
8 Ga0070666_10014840 3300005335 Bacteria 4964
9 Ga0070666_11317074 3300005335 Bacteria 539
10 Ga0070680_101175869 3300005336 Bacteria 663
11 Ga0068868_100084658 3300005338 Bacteria 2547
12 Ga0070660_100463553 3300005339 Bacteria 1052
13 Ga0070660_101480703 3300005339 Bacteria 577
14 Ga0070691_10596823 3300005341 Bacteria 651
15 Ga0070687_100411848 3300005343 Bacteria 889
16 Ga0070668_100597980 3300005347 Bacteria 965
17 Ga0070669_100011153 3300005353 Bacteria 6378
18 Ga0070669_101363758 3300005353 Bacteria 615
19 Ga0070675_100000942 3300005354 Bacteria 20711
20 Ga0070675_100894097 3300005354 Bacteria 814
21 Ga0070674_100004830 3300005356 Bacteria 7724
22 Ga0070674_100160562 3300005356 Bacteria 1705
23 Ga0070673_100005721 3300005364 Bacteria 7992
24 Ga0070673_100212911 3300005364 Bacteria 1670
25 Ga0070673_102037772 3300005364 Bacteria 545
26 Ga0070688_100079324 3300005365 Bacteria 2120
27 Ga0070659_100109266 3300005366 Bacteria 2232
28 Ga0070710_10283299 3300005437 Bacteria 1076
29 Ga0070705_100726636 3300005440 Bacteria 783
30 Ga0070700_100657540 3300005441 Bacteria 828
31 Ga0070708_100018590 3300005445 Bacteria 5818
32 Ga0070708_100206584 3300005445 Bacteria 1840
33 Ga0070708_100439824 3300005445 Bacteria 1230
34 Ga0070708_100644718 3300005445 Bacteria 998
35 Ga0070708_101692347 3300005445 Bacteria 588
36 Ga0070678_100179203 3300005456 Bacteria 1733
37 Ga0070662_100077885 3300005457 Bacteria 2461
38 Ga0070662_100590958 3300005457 Bacteria 933
39 Ga0070681_10134462 3300005458 Bacteria 2404
40 Ga0070706_100650644 3300005467 Bacteria 978
41 Ga0070706_101211287 3300005467 Bacteria 693
42 Ga0070707_100129216 3300005468 Bacteria 2456
43 Ga0070707_100563680 3300005468 Unclassified 1101
44 Ga0070707_100949367 3300005468 Bacteria 825
45 Ga0070698_100479469 3300005471 Bacteria 1181
46 Ga0070698_101635835 3300005471 Bacteria 596
47 Ga0070699_100003197 3300005518 Bacteria 14487
48 Ga0070699_100288893 3300005518 Bacteria 1470
49 Ga0070699_100913676 3300005518 Bacteria 804
50 Ga0070699_101120130 3300005518 Bacteria 722
51 Ga0070697_100079377 3300005536 Bacteria 2702
52 Ga0070697_100089959 3300005536 Unclassified 2537
53 Ga0070697_100140128 3300005536 Unclassified 2033
54 Ga0070697_100295945 3300005536 Bacteria 1391
55 Ga0070686_100001205 3300005544 Bacteria 14747
56 Ga0070686_100374669 3300005544 Bacteria 1076
57 Ga0070686_100992815 3300005544 Unclassified 688
58 Ga0070665_102667464 3300005548 Bacteria 500
59 Ga0070704_100034196 3300005549 Bacteria 3444
60 Ga0068855_100310199 3300005563 Bacteria 1746
61 Ga0070664_100886632 3300005564 Bacteria 836
62 Ga0068854_100042097 3300005578 Bacteria 3231
63 Ga0068854_100088338 3300005578 Bacteria 2301
64 Ga0068854_102203455 3300005578 Bacteria 510
65 Ga0068852_101942527 3300005616 Bacteria 611
66 Ga0068864_100293933 3300005618 Bacteria 1519
67 Ga0068861_100045706 3300005719 Bacteria 3299
68 Ga0068861_100097019 3300005719 Bacteria 2337
69 Ga0068861_100102001 3300005719 Bacteria 2284
70 Ga0068861_101872624 3300005719 Bacteria 596
71 Ga0068863_100516911 3300005841 Bacteria 1177
72 Ga0068858_100410915 3300005842 Bacteria 1301
73 Ga0068858_100777550 3300005842 Bacteria 934
74 Ga0068858_101563606 3300005842 Bacteria 651
75 Ga0068860_100114537 3300005843 Bacteria 2578
76 Ga0068860_101335735 3300005843 Bacteria 738
77 Ga0068862_100031044 3300005844 Bacteria 4506
78 Ga0068862_101314486 3300005844 Bacteria 724
79 Ga0068862_102621864 3300005844 Bacteria 516
80 Ga0081455_10193547 3300005937 Bacteria 1529
81 Ga0081539_10032875 3300005985 Bacteria 3169
82 Ga0070715_10150046 3300006163 Unclassified 1141
83 Ga0070716_100842669 3300006173 Unclassified 713
84 Ga0097621_100076152 3300006237 Bacteria 2782
85 Ga0097621_100528693 3300006237 Bacteria 1071
86 Ga0068871_100157361 3300006358 Bacteria 1941
87 Ga0068871_100682163 3300006358 Bacteria 940
88 Ga0068871_101600308 3300006358 Bacteria 617
89 Ga0075431_100115248 3300006847 Bacteria 2774
90 Ga0075431_100123263 3300006847 Bacteria 2674
91 Ga0075433_10014281 3300006852 Bacteria 6485
92 Ga0075433_10078098 3300006852 Bacteria 2917
93 Ga0075433_10160254 3300006852 Unclassified 2002
94 Ga0075433_10305684 3300006852 Bacteria 1408
95 Ga0075434_100003727 3300006871 Bacteria 13611
96 Ga0075434_100420815 3300006871 Bacteria 1357
97 Ga0075434_100524324 3300006871 Bacteria 1205
98 Ga0075434_101076945 3300006871 Bacteria 817
99 Ga0075434_101252895 3300006871 Bacteria 753
100 Ga0075434_101473853 3300006871 Bacteria 690
101 Ga0075434_101842376 3300006871 Bacteria 611
102 Ga0075434_102542664 3300006871 Bacteria 513
103 Ga0075434_102553187 3300006871 Bacteria 512
104 Ga0075429_100347610 3300006880 Bacteria 1298
105 Ga0068865_100116278 3300006881 Bacteria 1981
106 Ga0068865_101945760 3300006881 Bacteria 533
107 Ga0075436_100021719 3300006914 Bacteria 4404
108 Ga0075436_100053418 3300006914 Bacteria 2789
109 Ga0075436_100194282 3300006914 Bacteria 1436
110 Ga0075435_100004110 3300007076 Bacteria 9977
111 Ga0075435_100013574 3300007076 Bacteria 6065
112 Ga0075435_100019994 3300007076 Bacteria 5119
113 Ga0075435_100345006 3300007076 Bacteria 1276
114 Ga0099794_10003833 3300007265 Bacteria 5813
115 Ga0099794_10118270 3300007265 Unclassified 1332
116 Ga0099795_10162231 3300007788 Bacteria 923
117 Ga0105240_10462106 3300009093 Bacteria 1418
118 Ga0105240_10478719 3300009093 Bacteria 1388
119 Ga0105240_10506434 3300009093 Bacteria 1342
120 Ga0111539_10128538 3300009094 Bacteria 2968
121 Ga0111539_10565897 3300009094 Bacteria 1324
122 Ga0111539_11173433 3300009094 Bacteria 892
123 Ga0105245_11564941 3300009098 Bacteria 711
124 Ga0114129_10001496 3300009147 Bacteria 31625
125 Ga0114129_10023525 3300009147 Bacteria 8732
126 Ga0114129_10034713 3300009147 Bacteria 7126
127 Ga0114129_10112576 3300009147 Bacteria 3753
128 Ga0114129_10383535 3300009147 Bacteria 1855
129 Ga0114129_10722305 3300009147 Bacteria 1278
130 Ga0114129_11292859 3300009147 Bacteria 904
131 Ga0114129_11912142 3300009147 Bacteria 719
132 Ga0105243_10667797 3300009148 Bacteria 1009
133 Ga0105243_10736098 3300009148 Bacteria 965
134 Ga0105243_12903807 3300009148 Bacteria 520
135 Ga0105241_10084010 3300009174 Bacteria 2499
136 Ga0105241_10790342 3300009174 Bacteria 873
137 Ga0105242_10126850 3300009176 Bacteria 2197
138 Ga0105242_11614226 3300009176 Bacteria 682
139 Ga0105248_10048031 3300009177 Bacteria 4787
140 Ga0105248_10090048 3300009177 Bacteria 3454
141 Ga0105248_10504253 3300009177 Bacteria 1364
142 Ga0105248_10568477 3300009177 Bacteria 1279
143 Ga0105248_11113162 3300009177 Bacteria 893
144 Ga0105248_11201385 3300009177 Bacteria 857
145 Ga0105249_10168949 3300009553 Bacteria 2119
146 Ga0105249_11360521 3300009553 Bacteria 782
147 Ga0105249_12572250 3300009553 Bacteria 581
148 Ga0099796_10115152 3300010159 Unclassified 1027
149 Ga0105239_10693355 3300010375 Bacteria 1164
150 Ga0105239_13077365 3300010375 Bacteria 543
151 Ga0157370_10530116 3300013104 Bacteria 1080
152 Ga0163162_11276828 3300013306 Bacteria 834
153 Ga0157375_10736305 3300013308 Bacteria 1138
154 Ga0157375_12821022 3300013308 Unclassified 581
155 Ga0157380_10057358 3300014326 Bacteria 3101
156 Ga0157380_10131407 3300014326 Bacteria 2136
157 Ga0157380_11304100 3300014326 Bacteria 773
158 Ga0157380_13169373 3300014326 Bacteria 525
159 Ga0157377_10037003 3300014745 Bacteria 2688
160 Ga0157379_10974538 3300014968 Bacteria 807
161 Ga0157379_12028853 3300014968 Bacteria 569
162 Ga0207688_10139270 3300025901 Bacteria 1427
163 Ga0207685_10222908 3300025905 Unclassified 898
164 Ga0207684_10209031 3300025910 Bacteria 1683
165 Ga0207684_10364745 3300025910 Bacteria 1243
166 Ga0207654_10110916 3300025911 Bacteria 1707
167 Ga0207707_10197822 3300025912 Bacteria 1753
168 Ga0207695_10689214 3300025913 Bacteria 902
169 Ga0207695_10763578 3300025913 Bacteria 847
170 Ga0207657_10402708 3300025919 Bacteria 1076
171 Ga0207646_10362360 3300025922 Bacteria 1310
172 Ga0207646_10428808 3300025922 Bacteria 1193
173 Ga0207681_10380269 3300025923 Bacteria 1136
174 Ga0207681_11013159 3300025923 Bacteria 697
175 Ga0207681_11028138 3300025923 Bacteria 691
176 Ga0207659_10000159 3300025926 Bacteria 40400
177 Ga0207644_10077794 3300025931 Bacteria 2444
178 Ga0207644_10952515 3300025931 Bacteria 720
179 Ga0207690_11106968 3300025932 Bacteria 660
180 Ga0207706_10113207 3300025933 Bacteria 2387
181 Ga0207706_10415436 3300025933 Bacteria 1166
182 Ga0207686_11611169 3300025934 Bacteria 536
183 Ga0207709_10036118 3300025935 Bacteria 2927
184 Ga0207709_11556688 3300025935 Bacteria 549
185 Ga0207670_10824371 3300025936 Bacteria 774
186 Ga0207669_10021169 3300025937 Bacteria 3427
187 Ga0207669_10223154 3300025937 Bacteria 1384
188 Ga0207669_11025419 3300025937 Unclassified 694
189 Ga0207704_11636136 3300025938 Bacteria 553
190 Ga0207665_11103863 3300025939 Bacteria 632
191 Ga0207665_11689590 3300025939 Unclassified 501
192 Ga0207711_10194678 3300025941 Bacteria 1848
193 Ga0207711_10229584 3300025941 Bacteria 1700
194 Ga0207711_10416826 3300025941 Bacteria 1249
195 Ga0207711_10596923 3300025941 Bacteria 1030
196 Ga0207711_11051751 3300025941 Bacteria 754
197 Ga0207711_11693758 3300025941 Bacteria 576
198 Ga0207689_10079560 3300025942 Bacteria 2694
199 Ga0207667_11608774 3300025949 Unclassified 618
200 Ga0207651_10013600 3300025960 Bacteria 4664
201 Ga0207651_10046340 3300025960 Bacteria 2923
202 Ga0207651_10341935 3300025960 Bacteria 1257
203 Ga0207712_10311885 3300025961 Bacteria 1295
204 Ga0207712_10626319 3300025961 Bacteria 933
205 Ga0207712_11006836 3300025961 Bacteria 739
206 Ga0207668_10041339 3300025972 Bacteria 3116
207 Ga0207640_10005970 3300025981 Bacteria 6650
208 Ga0207640_10025453 3300025981 Bacteria 3583
209 Ga0207640_10053154 3300025981 Bacteria 2643
210 Ga0207677_10106516 3300026023 Bacteria 2077
211 Ga0207703_10103552 3300026035 Bacteria 2416
212 Ga0207703_10260147 3300026035 Bacteria 1568
213 Ga0207648_10863806 3300026089 Bacteria 844
214 Ga0207648_11369318 3300026089 Bacteria 665
215 Ga0207648_11780423 3300026089 Unclassified 578
216 Ga0207675_100538282 3300026118 Bacteria 1166
217 Ga0207675_100773726 3300026118 Bacteria 972
218 Ga0207675_101205252 3300026118 Bacteria 777
219 Ga0207675_101457996 3300026118 Bacteria 705
220 Ga0207675_101613167 3300026118 Unclassified 669
221 Ga0207683_10090626 3300026121 Bacteria 2723
222 Ga0207698_11741038 3300026142 Bacteria 638
223 Ga0207698_12462188 3300026142 Bacteria 531
224 Ga0209588_1000911 3300027671 Bacteria 7525
225 Ga0207428_10033156 3300027907 Bacteria 4244
226 Ga0268266_12301153 3300028379 Bacteria 510
227 Ga0268265_10073493 3300028380 Bacteria 2670
228 Ga0268265_10199295 3300028380 Bacteria 1735
229 Ga0268265_10773070 3300028380 Bacteria 934
230 Ga0268264_10943104 3300028381 Bacteria 868
231 Ga0265314_10000464 3300031711 Bacteria 53998
232 Ga0373930_0002397 3300034816 Bacteria 2896
233 Ga0373950_0010713 3300034818 Bacteria 1487
234 Ga0373958_0019243 3300034819 Bacteria 1246
235 Ga0373959_0000658 3300034820 Bacteria 5943
236 Ga0373938_0001682 3300034957 Bacteria 3542
237 Ga0373928_0000230 3300035084 Bacteria 10941
238 Ga0373929_0001312 3300035085 Bacteria 4794
239 Ga0373940_0004334 3300035088 Bacteria 2994
240 Ga0373951_0001428 3300035091 Bacteria 6268
241 Ga0373932_0002872 3300035112 Bacteria 4255
242 Ga0373939_0000764 3300035114 Bacteria 7931
243 Ga0373941_0001300 3300035115 Bacteria 5254
244 Ga0373960_0001378 3300035121 Bacteria 5362
245 Ga0373961_0001919 3300035241 Bacteria 5643
246 Ga0373962_0034856 3300035242 Bacteria 1395
247 Ga0373931_0051356 3300035691 Bacteria 2195
248 Ga0373931_0679148 3300035691 Unclassified 679
249 Ga0450916_027683 3300042530 Bacteria 811
250 Ga0451576_0018139 3300045051 Bacteria 7720
251 Ga0495580_0478634 3300046472 Bacteria 833
252 Ga0495621_0094160 3300046539 Bacteria 1133
253 Ga0496102_0123919 3300048905 Bacteria 2415
254 Ga0496106_0089568 3300048909 Bacteria 2373
255 Ga0496106_1293064 3300048909 Bacteria 566
256 Ga0496107_0059118 3300048910 Bacteria 2774
257 Ga0496109_0538231 3300048912 Bacteria 1102
258 Ga0496112_0329542 3300048915 Bacteria 1471
259 Ga0501044_0602997 3300049823 Bacteria 991
260 nmdc:mga05p37_1400596_c1 3300050507 Bacteria 704
261 nmdc:mga05p37_290764_c1 3300050507 Bacteria 1945
262 nmdc:mga05p37_4159_c1 3300050507 Bacteria 14559
263 nmdc:mga05p37_53453_c1 3300050507 Bacteria 4967
264 nmdc:mga05p37_58505_c1 3300050507 Bacteria 4747
265 nmdc:mga05p37_821419_c1 3300050507 Bacteria 1014
266 nmdc:mga09592_144821_c1 3300050508 Bacteria 2048
267 nmdc:mga09592_527747_c1 3300050508 Bacteria 1015
268 nmdc:mga06r32_196136_c1 3300050510 Bacteria 2006
269 nmdc:mga08y16_22795_c1 3300050511 Bacteria 6608
270 nmdc:mga08y16_557206_c1 3300050511 Bacteria 1159
271 nmdc:mga0n895_105720_c1 3300050512 Bacteria 2827
272 nmdc:mga0n895_115164_c1 3300050512 Bacteria 2707
273 nmdc:mga0n895_13419_c1 3300050512 Bacteria 7389
274 nmdc:mga0n895_1351331_c1 3300050512 Bacteria 682
275 nmdc:mga0n895_1457155_c1 3300050512 Bacteria 652
276 nmdc:mga0n895_2146126_c1 3300050512 Bacteria 515
277 nmdc:mga0n895_3352_c1 3300050512 Bacteria 12883
278 nmdc:mga0n895_601272_c1 3300050512 Bacteria 1102
279 nmdc:mga0n895_991186_c1 3300050512 Bacteria 822
280 nmdc:mga0rr50_342901_c1 3300050513 Bacteria 1255
281 nmdc:mga0rr50_45700_c1 3300050513 Bacteria 3221
282 nmdc:mga0rr50_605943_c1 3300050513 Bacteria 934
283 nmdc:mga0rr50_87_c1 3300050513 Bacteria 52403
284 nmdc:mga0rr50_91667_c1 3300050513 Bacteria 2368
285 nmdc:mga0rr50_932164_c1 3300050513 Bacteria 740
286 nmdc:mga08x19_177563_c1 3300050514 Bacteria 1453
287 nmdc:mga08x19_22113_c1 3300050514 Bacteria 3935
288 nmdc:mga08x19_44200_c1 3300050514 Bacteria 2844
289 nmdc:mga08x19_49909_c1 3300050514 Bacteria 2684
290 nmdc:mga0a205_22671_c1 3300050515 Bacteria 5951
291 nmdc:mga0a205_238639_c1 3300050515 Bacteria 1699
292 nmdc:mga0a205_46344_c1 3300050515 Bacteria 4193
293 nmdc:mga0a205_497160_c1 3300050515 Bacteria 1077
294 nmdc:mga0a205_67227_c1 3300050515 Bacteria 3462
295 Ga0501082_0678632 3300060353 Bacteria 902

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050515 nmdc:mga0a205_67227_c1 nmdc:mga0a205_67227_c1_570_869 99
2 3300006847 Ga0075431_100123263 Ga0075431_1001232632 112
3 3300006852 Ga0075433_10078098 Ga0075433_100780983 112
4 3300006871 Ga0075434_100524324 Ga0075434_1005243242 112
5 3300006871 Ga0075434_101473853 Ga0075434_1014738532 112
6 3300007265 Ga0099794_10003833 Ga0099794_100038336 112
7 3300007788 Ga0099795_10162231 Ga0099795_101622312 112
8 3300009147 Ga0114129_10001496 Ga0114129_100014963 112
9 3300010159 Ga0099796_10115152 Ga0099796_101151521 112
10 3300010375 Ga0105239_13077365 Ga0105239_130773652 112
11 3300026089 Ga0207648_11780423 Ga0207648_117804231 112
12 3300027671 Ga0209588_1000911 Ga0209588_10009114 112
13 3300050507 nmdc:mga05p37_53453_c1 nmdc:mga05p37_53453_c1_3729_4067 112
14 3300050510 nmdc:mga06r32_196136_c1 nmdc:mga06r32_196136_c1_122_460 112
15 3300050512 nmdc:mga0n895_13419_c1 nmdc:mga0n895_13419_c1_5496_5834 112
16 3300050513 nmdc:mga0rr50_605943_c1 nmdc:mga0rr50_605943_c1_29_367 112
17 3300050513 nmdc:mga0rr50_932164_c1 nmdc:mga0rr50_932164_c1_81_419 112
18 3300005331 Ga0070670_100184538 Ga0070670_1001845382 113
19 3300005335 Ga0070666_11317074 Ga0070666_113170741 113
20 3300005343 Ga0070687_100411848 Ga0070687_1004118482 113
21 3300005353 Ga0070669_100011153 Ga0070669_1000111533 113
22 3300005354 Ga0070675_100000942 Ga0070675_1000009423 113
23 3300005354 Ga0070675_100894097 Ga0070675_1008940972 113
24 3300005365 Ga0070688_100079324 Ga0070688_1000793243 113
25 3300005445 Ga0070708_100439824 Ga0070708_1004398241 113
26 3300005467 Ga0070706_100650644 Ga0070706_1006506441 113
27 3300005468 Ga0070707_100129216 Ga0070707_1001292162 113
28 3300005518 Ga0070699_100913676 Ga0070699_1009136762 113
29 3300005536 Ga0070697_100079377 Ga0070697_1000793773 113
30 3300005544 Ga0070686_100992815 Ga0070686_1009928152 113
31 3300005719 Ga0068861_101872624 Ga0068861_1018726242 113
32 3300005841 Ga0068863_100516911 Ga0068863_1005169111 113
33 3300005842 Ga0068858_100410915 Ga0068858_1004109153 113
34 3300005844 Ga0068862_100031044 Ga0068862_1000310447 113
35 3300006237 Ga0097621_100076152 Ga0097621_1000761523 113
36 3300006237 Ga0097621_100528693 Ga0097621_1005286932 113
37 3300006358 Ga0068871_100157361 Ga0068871_1001573612 113
38 3300006358 Ga0068871_100682163 Ga0068871_1006821632 113
39 3300009094 Ga0111539_10128538 Ga0111539_101285381 113
40 3300009094 Ga0111539_11173433 Ga0111539_111734332 113
41 3300009177 Ga0105248_10048031 Ga0105248_100480312 113
42 3300009177 Ga0105248_10090048 Ga0105248_100900482 113
43 3300009177 Ga0105248_11201385 Ga0105248_112013852 113
44 3300013306 Ga0163162_11276828 Ga0163162_112768282 113
45 3300013308 Ga0157375_10736305 Ga0157375_107363051 113
46 3300013308 Ga0157375_12821022 Ga0157375_128210222 113
47 3300014745 Ga0157377_10037003 Ga0157377_100370033 113
48 3300014968 Ga0157379_12028853 Ga0157379_120288532 113
49 3300025910 Ga0207684_10364745 Ga0207684_103647453 113
50 3300025922 Ga0207646_10362360 Ga0207646_103623602 113
51 3300025926 Ga0207659_10000159 Ga0207659_1000015914 113
52 3300025936 Ga0207670_10824371 Ga0207670_108243711 113
53 3300025941 Ga0207711_10194678 Ga0207711_101946782 113
54 3300025941 Ga0207711_10229584 Ga0207711_102295842 113
55 3300025941 Ga0207711_10416826 Ga0207711_104168262 113
56 3300025941 Ga0207711_11693758 Ga0207711_116937582 113
57 3300025960 Ga0207651_10046340 Ga0207651_100463403 113
58 3300025961 Ga0207712_10626319 Ga0207712_106263193 113
59 3300026118 Ga0207675_101613167 Ga0207675_1016131671 113
60 3300027907 Ga0207428_10033156 Ga0207428_100331563 113
61 3300028380 Ga0268265_10073493 Ga0268265_100734933 113
62 3300046539 Ga0495621_0094160 Ga0495621_0094160_303_644 113
63 3300048915 Ga0496112_0329542 Ga0496112_0329542_759_1100 113
64 3300050508 nmdc:mga09592_144821_c1 nmdc:mga09592_144821_c1_770_1111 113
65 3300050511 nmdc:mga08y16_22795_c1 nmdc:mga08y16_22795_c1_3735_4076 113
66 3300060353 Ga0501082_0678632 Ga0501082_0678632_322_663 113
67 3300005293 Ga0065715_10189849 Ga0065715_101898492 114
68 3300005295 Ga0065707_10130109 Ga0065707_101301092 114
69 3300005328 Ga0070676_10606361 Ga0070676_106063612 114
70 3300005328 Ga0070676_11576766 Ga0070676_115767661 114
71 3300005330 Ga0070690_100097879 Ga0070690_1000978793 114
72 3300005334 Ga0068869_101155574 Ga0068869_1011555742 114
73 3300005335 Ga0070666_10014840 Ga0070666_100148406 114
74 3300005336 Ga0070680_101175869 Ga0070680_1011758692 114
75 3300005338 Ga0068868_100084658 Ga0068868_1000846581 114
76 3300005339 Ga0070660_100463553 Ga0070660_1004635532 114
77 3300005339 Ga0070660_101480703 Ga0070660_1014807031 114
78 3300005341 Ga0070691_10596823 Ga0070691_105968232 114
79 3300005347 Ga0070668_100597980 Ga0070668_1005979802 114
80 3300005353 Ga0070669_101363758 Ga0070669_1013637581 114
81 3300005356 Ga0070674_100004830 Ga0070674_1000048306 114
82 3300005356 Ga0070674_100160562 Ga0070674_1001605622 114
83 3300005364 Ga0070673_100005721 Ga0070673_1000057215 114
84 3300005364 Ga0070673_100212911 Ga0070673_1002129112 114
85 3300005364 Ga0070673_102037772 Ga0070673_1020377722 114
86 3300005366 Ga0070659_100109266 Ga0070659_1001092663 114
87 3300005437 Ga0070710_10283299 Ga0070710_102832992 114
88 3300005440 Ga0070705_100726636 Ga0070705_1007266361 114
89 3300005441 Ga0070700_100657540 Ga0070700_1006575402 114
90 3300005445 Ga0070708_100018590 Ga0070708_1000185904 114
91 3300005445 Ga0070708_100206584 Ga0070708_1002065842 114
92 3300005445 Ga0070708_100644718 Ga0070708_1006447182 114
93 3300005445 Ga0070708_101692347 Ga0070708_1016923471 114
94 3300005456 Ga0070678_100179203 Ga0070678_1001792032 114
95 3300005457 Ga0070662_100077885 Ga0070662_1000778852 114
96 3300005457 Ga0070662_100590958 Ga0070662_1005909581 114
97 3300005458 Ga0070681_10134462 Ga0070681_101344622 114
98 3300005467 Ga0070706_101211287 Ga0070706_1012112871 114
99 3300005468 Ga0070707_100563680 Ga0070707_1005636802 114
100 3300005468 Ga0070707_100949367 Ga0070707_1009493671 114
101 3300005471 Ga0070698_100479469 Ga0070698_1004794692 114
102 3300005471 Ga0070698_101635835 Ga0070698_1016358351 114
103 3300005518 Ga0070699_100003197 Ga0070699_1000031976 114
104 3300005518 Ga0070699_100288893 Ga0070699_1002888932 114
105 3300005518 Ga0070699_101120130 Ga0070699_1011201301 114
106 3300005536 Ga0070697_100089959 Ga0070697_1000899592 114
107 3300005536 Ga0070697_100140128 Ga0070697_1001401282 114
108 3300005536 Ga0070697_100295945 Ga0070697_1002959452 114
109 3300005544 Ga0070686_100001205 Ga0070686_1000012054 114
110 3300005544 Ga0070686_100374669 Ga0070686_1003746692 114
111 3300005548 Ga0070665_102667464 Ga0070665_1026674641 114
112 3300005549 Ga0070704_100034196 Ga0070704_1000341962 114
113 3300005563 Ga0068855_100310199 Ga0068855_1003101991 114
114 3300005564 Ga0070664_100886632 Ga0070664_1008866322 114
115 3300005578 Ga0068854_100042097 Ga0068854_1000420972 114
116 3300005578 Ga0068854_100088338 Ga0068854_1000883384 114
117 3300005578 Ga0068854_102203455 Ga0068854_1022034551 114
118 3300005616 Ga0068852_101942527 Ga0068852_1019425272 114
119 3300005618 Ga0068864_100293933 Ga0068864_1002939331 114
120 3300005719 Ga0068861_100045706 Ga0068861_1000457062 114
121 3300005719 Ga0068861_100097019 Ga0068861_1000970192 114
122 3300005719 Ga0068861_100102001 Ga0068861_1001020014 114
123 3300005842 Ga0068858_100777550 Ga0068858_1007775501 114
124 3300005842 Ga0068858_101563606 Ga0068858_1015636061 114
125 3300005843 Ga0068860_100114537 Ga0068860_1001145372 114
126 3300005843 Ga0068860_101335735 Ga0068860_1013357351 114
127 3300005844 Ga0068862_101314486 Ga0068862_1013144862 114
128 3300005844 Ga0068862_102621864 Ga0068862_1026218641 114
129 3300005937 Ga0081455_10193547 Ga0081455_101935472 114
130 3300005985 Ga0081539_10032875 Ga0081539_100328754 114
131 3300006163 Ga0070715_10150046 Ga0070715_101500462 114
132 3300006173 Ga0070716_100842669 Ga0070716_1008426692 114
133 3300006358 Ga0068871_101600308 Ga0068871_1016003081 114
134 3300006847 Ga0075431_100115248 Ga0075431_1001152482 114
135 3300006852 Ga0075433_10014281 Ga0075433_100142812 114
136 3300006852 Ga0075433_10160254 Ga0075433_101602542 114
137 3300006852 Ga0075433_10305684 Ga0075433_103056843 114
138 3300006871 Ga0075434_100003727 Ga0075434_10000372710 114
139 3300006871 Ga0075434_100420815 Ga0075434_1004208151 114
140 3300006871 Ga0075434_101076945 Ga0075434_1010769452 114
141 3300006871 Ga0075434_101252895 Ga0075434_1012528952 114
142 3300006871 Ga0075434_101842376 Ga0075434_1018423761 114
143 3300006871 Ga0075434_102542664 Ga0075434_1025426641 114
144 3300006871 Ga0075434_102553187 Ga0075434_1025531871 114
145 3300006880 Ga0075429_100347610 Ga0075429_1003476102 114
146 3300006881 Ga0068865_100116278 Ga0068865_1001162782 114
147 3300006881 Ga0068865_101945760 Ga0068865_1019457601 114
148 3300006914 Ga0075436_100021719 Ga0075436_1000217192 114
149 3300006914 Ga0075436_100053418 Ga0075436_1000534183 114
150 3300006914 Ga0075436_100194282 Ga0075436_1001942824 114
151 3300007076 Ga0075435_100004110 Ga0075435_1000041107 114
152 3300007076 Ga0075435_100013574 Ga0075435_1000135742 114
153 3300007076 Ga0075435_100019994 Ga0075435_1000199942 114
154 3300007076 Ga0075435_100345006 Ga0075435_1003450062 114
155 3300007265 Ga0099794_10118270 Ga0099794_101182701 114
156 3300009093 Ga0105240_10462106 Ga0105240_104621063 114
157 3300009093 Ga0105240_10478719 Ga0105240_104787192 114
158 3300009093 Ga0105240_10506434 Ga0105240_105064341 114
159 3300009094 Ga0111539_10565897 Ga0111539_105658972 114
160 3300009098 Ga0105245_11564941 Ga0105245_115649411 114
161 3300009147 Ga0114129_10023525 Ga0114129_100235252 114
162 3300009147 Ga0114129_10034713 Ga0114129_100347133 114
163 3300009147 Ga0114129_10112576 Ga0114129_101125762 114
164 3300009147 Ga0114129_10383535 Ga0114129_103835353 114
165 3300009147 Ga0114129_10722305 Ga0114129_107223051 114
166 3300009147 Ga0114129_11292859 Ga0114129_112928592 114
167 3300009147 Ga0114129_11912142 Ga0114129_119121422 114
168 3300009148 Ga0105243_10667797 Ga0105243_106677972 114
169 3300009148 Ga0105243_10736098 Ga0105243_107360981 114
170 3300009148 Ga0105243_12903807 Ga0105243_129038072 114
171 3300009174 Ga0105241_10084010 Ga0105241_100840102 114
172 3300009174 Ga0105241_10790342 Ga0105241_107903422 114
173 3300009176 Ga0105242_10126850 Ga0105242_101268503 114
174 3300009176 Ga0105242_11614226 Ga0105242_116142262 114
175 3300009177 Ga0105248_10504253 Ga0105248_105042531 114
176 3300009177 Ga0105248_10568477 Ga0105248_105684772 114
177 3300009177 Ga0105248_11113162 Ga0105248_111131622 114
178 3300009553 Ga0105249_10168949 Ga0105249_101689492 114
179 3300009553 Ga0105249_11360521 Ga0105249_113605212 114
180 3300009553 Ga0105249_12572250 Ga0105249_125722501 114
181 3300010375 Ga0105239_10693355 Ga0105239_106933552 114
182 3300013104 Ga0157370_10530116 Ga0157370_105301162 114
183 3300014326 Ga0157380_10057358 Ga0157380_100573582 114
184 3300014326 Ga0157380_10131407 Ga0157380_101314074 114
185 3300014326 Ga0157380_11304100 Ga0157380_113041002 114
186 3300014326 Ga0157380_13169373 Ga0157380_131693732 114
187 3300014968 Ga0157379_10974538 Ga0157379_109745382 114
188 3300025901 Ga0207688_10139270 Ga0207688_101392702 114
189 3300025905 Ga0207685_10222908 Ga0207685_102229082 114
190 3300025910 Ga0207684_10209031 Ga0207684_102090312 114
191 3300025911 Ga0207654_10110916 Ga0207654_101109163 114
192 3300025912 Ga0207707_10197822 Ga0207707_101978223 114
193 3300025913 Ga0207695_10689214 Ga0207695_106892142 114
194 3300025913 Ga0207695_10763578 Ga0207695_107635781 114
195 3300025919 Ga0207657_10402708 Ga0207657_104027082 114
196 3300025922 Ga0207646_10428808 Ga0207646_104288081 114
197 3300025923 Ga0207681_10380269 Ga0207681_103802692 114
198 3300025923 Ga0207681_11013159 Ga0207681_110131591 114
199 3300025923 Ga0207681_11028138 Ga0207681_110281381 114
200 3300025931 Ga0207644_10077794 Ga0207644_100777943 114
201 3300025931 Ga0207644_10952515 Ga0207644_109525152 114
202 3300025932 Ga0207690_11106968 Ga0207690_111069681 114
203 3300025933 Ga0207706_10113207 Ga0207706_101132074 114
204 3300025933 Ga0207706_10415436 Ga0207706_104154361 114
205 3300025934 Ga0207686_11611169 Ga0207686_116111691 114
206 3300025935 Ga0207709_10036118 Ga0207709_100361185 114
207 3300025935 Ga0207709_11556688 Ga0207709_115566881 114
208 3300025937 Ga0207669_10021169 Ga0207669_100211692 114
209 3300025937 Ga0207669_10223154 Ga0207669_102231542 114
210 3300025937 Ga0207669_11025419 Ga0207669_110254192 114
211 3300025938 Ga0207704_11636136 Ga0207704_116361361 114
212 3300025939 Ga0207665_11103863 Ga0207665_111038631 114
213 3300025939 Ga0207665_11689590 Ga0207665_116895901 114
214 3300025941 Ga0207711_10596923 Ga0207711_105969231 114
215 3300025941 Ga0207711_11051751 Ga0207711_110517512 114
216 3300025942 Ga0207689_10079560 Ga0207689_100795603 114
217 3300025949 Ga0207667_11608774 Ga0207667_116087742 114
218 3300025960 Ga0207651_10013600 Ga0207651_100136004 114
219 3300025960 Ga0207651_10341935 Ga0207651_103419352 114
220 3300025961 Ga0207712_10311885 Ga0207712_103118852 114
221 3300025961 Ga0207712_11006836 Ga0207712_110068362 114
222 3300025972 Ga0207668_10041339 Ga0207668_100413392 114
223 3300025981 Ga0207640_10005970 Ga0207640_100059709 114
224 3300025981 Ga0207640_10025453 Ga0207640_100254533 114
225 3300025981 Ga0207640_10053154 Ga0207640_100531543 114
226 3300026023 Ga0207677_10106516 Ga0207677_101065161 114
227 3300026035 Ga0207703_10103552 Ga0207703_101035522 114
228 3300026035 Ga0207703_10260147 Ga0207703_102601472 114
229 3300026089 Ga0207648_10863806 Ga0207648_108638062 114
230 3300026089 Ga0207648_11369318 Ga0207648_113693181 114
231 3300026118 Ga0207675_100538282 Ga0207675_1005382823 114
232 3300026118 Ga0207675_100773726 Ga0207675_1007737262 114
233 3300026118 Ga0207675_101205252 Ga0207675_1012052521 114
234 3300026118 Ga0207675_101457996 Ga0207675_1014579962 114
235 3300026121 Ga0207683_10090626 Ga0207683_100906263 114
236 3300026142 Ga0207698_11741038 Ga0207698_117410381 114
237 3300026142 Ga0207698_12462188 Ga0207698_124621881 114
238 3300028379 Ga0268266_12301153 Ga0268266_123011531 114
239 3300028380 Ga0268265_10199295 Ga0268265_101992953 114
240 3300028380 Ga0268265_10773070 Ga0268265_107730701 114
241 3300028381 Ga0268264_10943104 Ga0268264_109431042 114
242 3300031711 Ga0265314_10000464 Ga0265314_1000046421 114
243 3300034816 Ga0373930_0002397 Ga0373930_0002397_95_439 114
244 3300034818 Ga0373950_0010713 Ga0373950_0010713_577_921 114
245 3300034819 Ga0373958_0019243 Ga0373958_0019243_664_1008 114
246 3300034820 Ga0373959_0000658 Ga0373959_0000658_1647_1991 114
247 3300034957 Ga0373938_0001682 Ga0373938_0001682_2287_2631 114
248 3300035084 Ga0373928_0000230 Ga0373928_0000230_2789_3133 114
249 3300035085 Ga0373929_0001312 Ga0373929_0001312_3151_3495 114
250 3300035088 Ga0373940_0004334 Ga0373940_0004334_2407_2751 114
251 3300035091 Ga0373951_0001428 Ga0373951_0001428_1783_2127 114
252 3300035112 Ga0373932_0002872 Ga0373932_0002872_3051_3395 114
253 3300035114 Ga0373939_0000764 Ga0373939_0000764_179_523 114
254 3300035115 Ga0373941_0001300 Ga0373941_0001300_811_1155 114
255 3300035121 Ga0373960_0001378 Ga0373960_0001378_2371_2715 114
256 3300035241 Ga0373961_0001919 Ga0373961_0001919_2882_3226 114
257 3300035242 Ga0373962_0034856 Ga0373962_0034856_347_691 114
258 3300035691 Ga0373931_0051356 Ga0373931_0051356_1187_1531 114
259 3300035691 Ga0373931_0679148 Ga0373931_0679148_46_390 114
260 3300042530 Ga0450916_027683 Ga0450916_027683_37_381 114
261 3300045051 Ga0451576_0018139 Ga0451576_0018139_56_400 114
262 3300046472 Ga0495580_0478634 Ga0495580_0478634_88_432 114
263 3300048905 Ga0496102_0123919 Ga0496102_0123919_1849_2193 114
264 3300048909 Ga0496106_0089568 Ga0496106_0089568_1787_2131 114
265 3300048909 Ga0496106_1293064 Ga0496106_1293064_13_357 114
266 3300048910 Ga0496107_0059118 Ga0496107_0059118_1397_1741 114
267 3300048912 Ga0496109_0538231 Ga0496109_0538231_23_367 114
268 3300049823 Ga0501044_0602997 Ga0501044_0602997_315_659 114
269 3300050507 nmdc:mga05p37_1400596_c1 nmdc:mga05p37_1400596_c1_16_360 114
270 3300050507 nmdc:mga05p37_290764_c1 nmdc:mga05p37_290764_c1_1108_1452 114
271 3300050507 nmdc:mga05p37_4159_c1 nmdc:mga05p37_4159_c1_8350_8706 114
272 3300050507 nmdc:mga05p37_58505_c1 nmdc:mga05p37_58505_c1_2997_3341 114
273 3300050507 nmdc:mga05p37_821419_c1 nmdc:mga05p37_821419_c1_71_415 114
274 3300050508 nmdc:mga09592_527747_c1 nmdc:mga09592_527747_c1_122_466 114
275 3300050511 nmdc:mga08y16_557206_c1 nmdc:mga08y16_557206_c1_82_426 114
276 3300050512 nmdc:mga0n895_105720_c1 nmdc:mga0n895_105720_c1_2390_2734 114
277 3300050512 nmdc:mga0n895_115164_c1 nmdc:mga0n895_115164_c1_11_355 114
278 3300050512 nmdc:mga0n895_1351331_c1 nmdc:mga0n895_1351331_c1_42_389 114
279 3300050512 nmdc:mga0n895_1457155_c1 nmdc:mga0n895_1457155_c1_193_537 114
280 3300050512 nmdc:mga0n895_2146126_c1 nmdc:mga0n895_2146126_c1_109_453 114
281 3300050512 nmdc:mga0n895_3352_c1 nmdc:mga0n895_3352_c1_9660_10004 114
282 3300050512 nmdc:mga0n895_601272_c1 nmdc:mga0n895_601272_c1_640_984 114
283 3300050512 nmdc:mga0n895_991186_c1 nmdc:mga0n895_991186_c1_388_732 114
284 3300050513 nmdc:mga0rr50_342901_c1 nmdc:mga0rr50_342901_c1_58_402 114
285 3300050513 nmdc:mga0rr50_45700_c1 nmdc:mga0rr50_45700_c1_2688_3032 114
286 3300050513 nmdc:mga0rr50_87_c1 nmdc:mga0rr50_87_c1_26547_26891 114
287 3300050513 nmdc:mga0rr50_91667_c1 nmdc:mga0rr50_91667_c1_84_428 114
288 3300050514 nmdc:mga08x19_177563_c1 nmdc:mga08x19_177563_c1_758_1102 114
289 3300050514 nmdc:mga08x19_22113_c1 nmdc:mga08x19_22113_c1_2127_2471 114
290 3300050514 nmdc:mga08x19_44200_c1 nmdc:mga08x19_44200_c1_2014_2358 114
291 3300050514 nmdc:mga08x19_49909_c1 nmdc:mga08x19_49909_c1_326_670 114
292 3300050515 nmdc:mga0a205_22671_c1 nmdc:mga0a205_22671_c1_4778_5122 114
293 3300050515 nmdc:mga0a205_238639_c1 nmdc:mga0a205_238639_c1_53_397 114
294 3300050515 nmdc:mga0a205_46344_c1 nmdc:mga0a205_46344_c1_158_502 114
295 3300050515 nmdc:mga0a205_497160_c1 nmdc:mga0a205_497160_c1_34_378 114

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01230

HIT

HIT domain

13

109

0.96

PF11969

DcpS_C

Scavenger mRNA decapping enzyme C-term binding

5

111

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uvm-assembly1.cif.gz_A hit family hydrolase from clostridium thermocellum cth-393 0.9226 1 110
3n1s-assembly2.cif.gz_F crystal structure of wild type echint gmp complex 0.9193 5 110
4egu-assembly1.cif.gz_B 0.95a resolution structure of a histidine triad protein from clostridium difficile 0.9115 1 110
6d6j-assembly1.cif.gz_A crystal structure of hit family hydrolase from legionella pneumophila philadelphia 1 0.9025 3 114
5km6-assembly1.cif.gz_A-2 human histidine triad nucleotide binding protein 1 (hhint1) h112n mutant ara-a nucleoside phosphoramidate substrate complex 0.8948 3 114
ID Description Score Start End Superfamily
5uvmA00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9314 1 107 3.30.428.10
4eguB00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9116 1 110 3.30.428.10
3n1sB00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8984 5 113 3.30.428.10
4q61B00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8911 5 107 3.30.428.10
1kpcB00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8861 3 114 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A7C3K2I8-F1-model_v4 Histidine triad nucleotide-binding protein 0.9521 3 107 GO:0003824
AF-A0A177E9G4-F1-model_v4 Histidine triad nucleotide-binding protein 0.9517 2 107 GO:0003824
AF-A0A7C7QUP4-F1-model_v4 Histidine triad nucleotide-binding protein 0.9491 4 107 GO:0003824
AF-A0A7V3P726-F1-model_v4 Histidine triad nucleotide-binding protein 0.949 2 107 GO:0003824
AF-A0A328F9U1-F1-model_v4 Histidine triad nucleotide-binding protein 0.9469 3 107 GO:0003824

Feature Viewer

pLDDT pTM Quality
86.91 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map