F392556

General Info

Members Datasets Scaffolds Average Seq Length
295 196 590 125

Family's Representative Sequence

Representative Sequence 3300005564|Ga0070664_101437292|Ga0070664_1014372921
Length 143
Sequence MVDVPTVPVAPRFNPRQNHGMLDHLAIQCADVPASAAFYDAALAPLGVGRVMDFGTVIGFGVGGKPDFWIGPHTSGDGFRESHIAFAARDRASVRAFFDAAVVAGAAVLHEPRLWPEYHPNYYGAFVRDPDGNNVEAVSHLPE

Samples

Sample ID Description Type Environment
1 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
11 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
12 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
13 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
14 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
17 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
18 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
19 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
20 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
21 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
22 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
23 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
61 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
64 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
65 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
66 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
67 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
68 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
69 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
70 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
71 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
72 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
73 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
74 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
75 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
76 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
77 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
78 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
79 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
80 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
81 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
82 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
83 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
84 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
85 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
86 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
87 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
88 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
89 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
90 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
91 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
92 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
93 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
94 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
97 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
98 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
99 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
100 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
101 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
102 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
103 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
104 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
105 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
106 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
107 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
108 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
109 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
110 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
111 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
112 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
113 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
114 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
115 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
116 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
117 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
118 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
119 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
120 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
121 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
122 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
123 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
124 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
125 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
126 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
127 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
128 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
129 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
135 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
136 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
137 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
149 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
150 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
151 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
152 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
153 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
154 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
155 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
156 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
157 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
160 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
161 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
162 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
163 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
164 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
165 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
166 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
170 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
173 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
174 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
175 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
176 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
177 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
178 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
179 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
180 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
181 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
182 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
183 2508501039 Frankia saprophytica CN3 Isolate Nodule
184 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
185 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
186 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
187 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
188 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
189 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
190 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
191 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
192 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
193 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
194 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
195 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
196 8002784119 Frankia sp. AgB1.9 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.25
Metatranscriptomes 0
Isolates 4.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.64
Nodule 1.02
Rhizoplane 3.39
Rhizosphere 73.56
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070664_101437292 3300005564 Bacteria 652
2 Ga0065707_10686629 3300005295 Bacteria 646
3 Ga0070658_10014670 3300005327 Bacteria 6286
4 Ga0070658_10130650 3300005327 Bacteria 2093
5 Ga0070658_11008892 3300005327 Bacteria 724
6 Ga0070683_100214920 3300005329 Bacteria 1827
7 Ga0070670_100892981 3300005331 Bacteria 805
8 Ga0070670_101436505 3300005331 Bacteria 633
9 Ga0070675_100052179 3300005354 Bacteria 3361
10 Ga0070675_100265856 3300005354 Bacteria 1504
11 Ga0070673_100175362 3300005364 Bacteria 1832
12 Ga0070714_100081961 3300005435 Bacteria 2810
13 Ga0070713_100514076 3300005436 Bacteria 1131
14 Ga0070685_10509104 3300005466 Bacteria 853
15 Ga0070685_11302141 3300005466 Bacteria 555
16 Ga0068859_100000155 3300005617 Bacteria 65623
17 Ga0068859_100092548 3300005617 Bacteria 3075
18 Ga0068859_101215666 3300005617 Bacteria 830
19 Ga0068863_101403727 3300005841 Bacteria 706
20 Ga0068860_100073408 3300005843 Bacteria 3252
21 Ga0068862_100000009 3300005844 Bacteria 298620
22 Ga0068862_101502769 3300005844 Bacteria 679
23 Ga0081455_10318599 3300005937 Bacteria 1109
24 Ga0075365_10000628 3300006038 Bacteria 13925
25 Ga0075365_10073339 3300006038 Bacteria 2307
26 Ga0075365_10116717 3300006038 Bacteria 1838
27 Ga0075365_10167594 3300006038 Bacteria 1533
28 Ga0075365_10960597 3300006038 Bacteria 602
29 Ga0075368_10016664 3300006042 Bacteria 2740
30 Ga0075368_10228584 3300006042 Bacteria 792
31 Ga0075363_100058478 3300006048 Bacteria 2071
32 Ga0075363_100363906 3300006048 Bacteria 846
33 Ga0075363_100411589 3300006048 Bacteria 795
34 Ga0075364_10007159 3300006051 Bacteria 6604
35 Ga0075364_10009373 3300006051 Bacteria 5869
36 Ga0075364_10020927 3300006051 Bacteria 4119
37 Ga0075364_10544410 3300006051 Bacteria 793
38 Ga0075364_10569236 3300006051 Bacteria 774
39 Ga0075362_10023784 3300006177 Bacteria 2594
40 Ga0075362_10057579 3300006177 Bacteria 1751
41 Ga0075362_10149871 3300006177 Bacteria 1119
42 Ga0075362_10154214 3300006177 Bacteria 1103
43 Ga0075367_10157508 3300006178 Bacteria 1411
44 Ga0075367_10235225 3300006178 Bacteria 1147
45 Ga0075367_10674900 3300006178 Bacteria 657
46 Ga0075369_10419891 3300006186 Bacteria 632
47 Ga0075370_10121462 3300006353 Bacteria 1521
48 Ga0075370_10170310 3300006353 Bacteria 1280
49 Ga0075428_100023427 3300006844 Bacteria 6833
50 Ga0075428_100055903 3300006844 Bacteria 4323
51 Ga0075428_101281298 3300006844 Bacteria 771
52 Ga0075428_101366889 3300006844 Bacteria 744
53 Ga0075430_100005639 3300006846 Bacteria 10572
54 Ga0075430_100016142 3300006846 Bacteria 6360
55 Ga0075430_100422862 3300006846 Bacteria 1100
56 Ga0075430_101599806 3300006846 Bacteria 535
57 Ga0075431_100003785 3300006847 Bacteria 14705
58 Ga0075431_100390909 3300006847 Bacteria 1393
59 Ga0075429_100122503 3300006880 Bacteria 2273
60 Ga0075436_100272113 3300006914 Bacteria 1210
61 Ga0097620_100000155 3300006931 Bacteria 65623
62 Ga0097620_100092546 3300006931 Bacteria 3075
63 Ga0097620_101215594 3300006931 Bacteria 830
64 Ga0105240_10080205 3300009093 Bacteria 4014
65 Ga0111539_10044796 3300009094 Bacteria 5298
66 Ga0111539_10542109 3300009094 Bacteria 1355
67 Ga0111539_11759044 3300009094 Bacteria 719
68 Ga0105245_10004974 3300009098 Bacteria 11690
69 Ga0105245_10191528 3300009098 Bacteria 1959
70 Ga0114129_10007858 3300009147 Bacteria 15175
71 Ga0105241_11042783 3300009174 Bacteria 767
72 Ga0105242_10087091 3300009176 Bacteria 2622
73 Ga0105248_12198965 3300009177 Bacteria 628
74 Ga0105237_11933119 3300009545 Bacteria 598
75 Ga0105249_10005468 3300009553 Bacteria 10968
76 Ga0105239_13195916 3300010375 Bacteria 533
77 Ga0157374_10847153 3300013296 Bacteria 931
78 Ga0157374_11532036 3300013296 Bacteria 690
79 Ga0157378_11029939 3300013297 Bacteria 858
80 Ga0163162_11704146 3300013306 Bacteria 720
81 Ga0163162_12936760 3300013306 Bacteria 548
82 Ga0163163_10091847 3300014325 Bacteria 3050
83 Ga0163163_11256788 3300014325 Bacteria 803
84 Ga0157376_10279303 3300014969 Bacteria 1572
85 Ga0207645_10335837 3300025907 Bacteria 1010
86 Ga0207705_10181738 3300025909 Bacteria 1587
87 Ga0207657_10060383 3300025919 Bacteria 3254
88 Ga0207657_10269968 3300025919 Bacteria 1352
89 Ga0207650_11057319 3300025925 Bacteria 691
90 Ga0207659_10062258 3300025926 Bacteria 2693
91 Ga0207687_10002438 3300025927 Bacteria 12629
92 Ga0207687_11616528 3300025927 Bacteria 556
93 Ga0207664_10108996 3300025929 Bacteria 2300
94 Ga0207686_10125114 3300025934 Bacteria 1756
95 Ga0207686_10263963 3300025934 Bacteria 1264
96 Ga0207709_10517841 3300025935 Bacteria 933
97 Ga0207661_10166515 3300025944 Bacteria 1916
98 Ga0207651_10057924 3300025960 Bacteria 2675
99 Ga0207712_10001811 3300025961 Bacteria 14124
100 Ga0207668_10551874 3300025972 Bacteria 998
101 Ga0207708_10410435 3300026075 Bacteria 1121
102 Ga0209971_1077229 3300027682 Bacteria 810
103 Ga0207428_10112660 3300027907 Bacteria 2092
104 Ga0268265_10000050 3300028380 Bacteria 175787
105 Ga0268265_11162269 3300028380 Bacteria 768
106 Ga0268264_10056366 3300028381 Bacteria 3285
107 Ga0268264_10718283 3300028381 Bacteria 993
108 Ga0265338_10663766 3300028800 Bacteria 722
109 Ga0265320_10179181 3300031240 Bacteria 950
110 Ga0316576_10857920 3300031727 Bacteria 652
111 Ga0307413_10719193 3300031824 Bacteria 831
112 Ga0307413_11356279 3300031824 Bacteria 624
113 Ga0307410_10074613 3300031852 Bacteria 2363
114 Ga0307407_11405649 3300031903 Bacteria 550
115 Ga0307409_100738772 3300031995 Bacteria 987
116 Ga0373934_0000177 3300035086 Bacteria 23559
117 Ga0373936_0087616 3300035113 Bacteria 1302
118 Ga0373953_0000881 3300035117 Bacteria 8407
119 Ga0373954_0001801 3300035118 Bacteria 8832
120 Ga0373956_0000554 3300035119 Bacteria 15308
121 Ga0373957_0000067 3300035120 Bacteria 25673
122 Ga0373955_0000018 3300035172 Bacteria 68313
123 Ga0316574_1011714 3300035398 Bacteria 500
124 Ga0373924_0002591 3300035410 Bacteria 6095
125 Ga0373935_0499516 3300035692 Bacteria 883
126 Ga0373927_0009281 3300035695 Bacteria 6597
127 Ga0373933_0000003 3300035724 Bacteria 150420
128 Ga0373937_0000016 3300036401 Bacteria 145523
129 Ga0373937_0252449 3300036401 Bacteria 1663
130 Ga0316582_0409925 3300036647 Bacteria 934
131 Ga0373925_0003574 3300037068 Bacteria 11981
132 Ga0436363_0506941 3300039450 Bacteria 551
133 Ga0439438_118287 3300041405 Bacteria 638
134 Ga0451804_0928452 3300041463 Bacteria 601
135 Ga0451851_0569466 3300041507 Bacteria 712
136 Ga0466969_0141076 3300044656 Bacteria 1114
137 Ga0466965_0885371 3300044683 Bacteria 520
138 Ga0466966_0034437 3300044684 Bacteria 3274
139 Ga0466961_0110652 3300044693 Bacteria 1728
140 Ga0466964_0091316 3300044706 Bacteria 1326
141 Ga0466958_0349428 3300045836 Bacteria 952
142 Ga0466967_1118612 3300045976 Bacteria 785
143 Ga0466967_2406114 3300045976 Bacteria 522
144 Ga0495592_0000268 3300046454 Bacteria 44554
145 Ga0495603_0206794 3300046455 Bacteria 1134
146 Ga0495651_0000009 3300046462 Bacteria 150455
147 Ga0495653_0000782 3300046463 Bacteria 24451
148 Ga0495653_0230840 3300046463 Bacteria 1238
149 Ga0495582_0290271 3300046473 Bacteria 940
150 Ga0495582_0439953 3300046473 Bacteria 753
151 Ga0495639_0128228 3300046475 Bacteria 1213
152 Ga0495664_0475572 3300046477 Bacteria 747
153 Ga0495594_0188303 3300046499 Bacteria 1175
154 Ga0495608_0000019 3300046511 Bacteria 180119
155 Ga0495618_0210044 3300046514 Bacteria 1230
156 Ga0495618_0679390 3300046514 Bacteria 607
157 Ga0495628_0000761 3300046516 Bacteria 29708
158 Ga0495628_0014219 3300046516 Bacteria 6680
159 Ga0495628_0424256 3300046516 Bacteria 969
160 Ga0495666_0388120 3300046526 Bacteria 628
161 Ga0495652_0000082 3300046529 Bacteria 102163
162 Ga0495652_0138488 3300046529 Bacteria 1917
163 Ga0495665_0138839 3300046531 Bacteria 1271
164 Ga0495586_0237702 3300046535 Bacteria 1038
165 Ga0495587_0000041 3300046536 Bacteria 110168
166 Ga0495645_0360211 3300046543 Bacteria 935
167 Ga0495622_0171852 3300046557 Bacteria 974
168 Ga0495667_0000037 3300046559 Bacteria 133780
169 Ga0495657_0000094 3300046675 Bacteria 78779
170 Ga0495599_0000040 3300046678 Bacteria 97423
171 Ga0495623_0000465 3300046679 Bacteria 26661
172 Ga0495646_0032454 3300046680 Bacteria 3249
173 Ga0495647_0017322 3300046681 Bacteria 2548
174 Ga0495647_0293307 3300046681 Bacteria 732
175 Ga0495658_0007053 3300046683 Bacteria 5547
176 Ga0495658_0615433 3300046683 Bacteria 696
177 Ga0495600_0018042 3300046809 Bacteria 4493
178 Ga0495600_0155396 3300046809 Bacteria 1480
179 Ga0495604_0000040 3300047317 Bacteria 120837
180 Ga0495680_0000010 3300047322 Bacteria 142931
181 Ga0495680_0368763 3300047322 Bacteria 997
182 Ga0495680_0411346 3300047322 Bacteria 932
183 Ga0495675_0000688 3300047444 Bacteria 21208
184 Ga0495684_0062659 3300047471 Bacteria 2828
185 Ga0495602_0000109 3300048088 Bacteria 79404
186 Ga0495602_0805306 3300048088 Bacteria 631
187 Ga0495614_0014682 3300048089 Bacteria 3425
188 Ga0496100_0356044 3300048903 Bacteria 1106
189 Ga0496101_0743122 3300048904 Bacteria 774
190 Ga0496108_0758676 3300048911 Bacteria 839
191 Ga0496109_0444466 3300048912 Bacteria 1225
192 Ga0496112_0059620 3300048915 Bacteria 3761
193 Ga0496112_0398302 3300048915 Bacteria 1316
194 Ga0496112_0523719 3300048915 Bacteria 1120
195 Ga0496113_0121009 3300048916 Bacteria 2046
196 Ga0496113_0822998 3300048916 Bacteria 737
197 Ga0496122_0047917 3300048925 Bacteria 3292
198 Ga0496123_0216065 3300048926 Bacteria 970
199 Ga0496126_0011364 3300048929 Bacteria 9229
200 Ga0501032_0306686 3300049569 Bacteria 1026
201 Ga0501033_0164691 3300049570 Bacteria 1594
202 Ga0501036_0031928 3300049572 Bacteria 4449
203 Ga0501036_0320451 3300049572 Bacteria 1295
204 Ga0501036_0612457 3300049572 Bacteria 903
205 Ga0501037_0530443 3300049573 Bacteria 796
206 Ga0501039_0498325 3300049575 Bacteria 956
207 Ga0501040_0106630 3300049576 Bacteria 1958
208 Ga0501042_0067687 3300049578 Bacteria 2553
209 Ga0501043_0152504 3300049579 Bacteria 1808
210 Ga0501046_0566310 3300049580 Bacteria 809
211 Ga0501047_0185939 3300049581 Bacteria 1943
212 Ga0501048_0087207 3300049582 Bacteria 2202
213 Ga0501068_0018155 3300049584 Bacteria 4072
214 Ga0501069_0091971 3300049585 Bacteria 1716
215 Ga0501069_0199000 3300049585 Bacteria 1161
216 Ga0501072_0136448 3300049588 Bacteria 1956
217 Ga0501072_1470937 3300049588 Bacteria 526
218 Ga0501073_0156753 3300049589 Bacteria 1578
219 Ga0501073_0326808 3300049589 Bacteria 1059
220 Ga0501075_0069751 3300049591 Bacteria 2656
221 Ga0501076_0171308 3300049592 Bacteria 1769
222 Ga0501076_1253769 3300049592 Bacteria 610
223 Ga0501077_0100819 3300049593 Bacteria 1830
224 Ga0501079_0463558 3300049741 Bacteria 995
225 Ga0501079_0545408 3300049741 Bacteria 912
226 Ga0501080_0167572 3300049742 Bacteria 2027
227 Ga0501035_0032653 3300049822 Bacteria 4735
228 Ga0501044_0027762 3300049823 Bacteria 5976
229 Ga0501044_0450330 3300049823 Bacteria 1194
230 Ga0501045_0129561 3300049824 Bacteria 1875
231 nmdc:mga03683_32098_c1 3300050489 Bacteria 2111
232 nmdc:mga03683_66344_c1 3300050489 Bacteria 1534
233 nmdc:mga03683_93419_c1 3300050489 Bacteria 1314
234 nmdc:mga03n38_146296_c1 3300050490 Bacteria 1185
235 nmdc:mga03n38_20614_c1 3300050490 Bacteria 2641
236 nmdc:mga03n38_461917_c1 3300050490 Bacteria 708
237 nmdc:mga03n38_512016_c1 3300050490 Bacteria 675
238 nmdc:mga03n38_932604_c1 3300050490 Bacteria 512
239 nmdc:mga00v17_18571_c1 3300050491 Bacteria 3953
240 nmdc:mga00v17_24132_c1 3300050491 Bacteria 3524
241 nmdc:mga00v17_541455_c1 3300050491 Bacteria 753
242 nmdc:mga00v17_61839_c1 3300050491 Bacteria 2302
243 nmdc:mga0yw44_262959_c1 3300050492 Bacteria 1150
244 nmdc:mga0yw44_28856_c1 3300050492 Bacteria 3197
245 nmdc:mga0yw44_4493_c1 3300050492 Bacteria 4934
246 nmdc:mga0yw44_505959_c1 3300050492 Bacteria 820
247 nmdc:mga0yw44_51258_c1 3300050492 Bacteria 2498
248 nmdc:mga0yw44_687271_c1 3300050492 Bacteria 695
249 nmdc:mga06z11_11178_c1 3300050494 Bacteria 3859
250 nmdc:mga06z11_165864_c1 3300050494 Bacteria 1265
251 nmdc:mga06z11_609920_c1 3300050494 Bacteria 664
252 nmdc:mga06z11_789813_c1 3300050494 Bacteria 578
253 nmdc:mga04h51_164665_c1 3300050495 Bacteria 855
254 nmdc:mga04h51_241949_c1 3300050495 Bacteria 721
255 nmdc:mga07m45_427639_c1 3300050496 Bacteria 768
256 nmdc:mga05p37_377215_c1 3300050507 Bacteria 1663
257 nmdc:mga05p37_8311_c1 3300050507 Bacteria 12274
258 nmdc:mga09592_195979_c1 3300050508 Bacteria 1749
259 nmdc:mga09592_3761_c1 3300050508 Bacteria 12227
260 nmdc:mga0qj67_172436_c1 3300050509 Bacteria 1757
261 nmdc:mga0qj67_3878_c1 3300050509 Bacteria 10802
262 nmdc:mga0qj67_533195_c1 3300050509 Bacteria 942
263 nmdc:mga0qj67_754849_c1 3300050509 Bacteria 772
264 nmdc:mga06r32_18082_c1 3300050510 Bacteria 6446
265 nmdc:mga06r32_57057_c1 3300050510 Bacteria 3751
266 nmdc:mga08y16_23272_c1 3300050511 Bacteria 6542
267 nmdc:mga0sz30_567830_c1 3300050516 Bacteria 512
268 Ga0495601_0138990 3300053077 Bacteria 1584
269 Ga0495612_0321673 3300053078 Bacteria 696
270 Ga0500635_0002004 3300053080 Bacteria 4973
271 Ga0495595_0103045 3300053084 Bacteria 1379
272 Ga0495619_0056006 3300053085 Bacteria 2613
273 Ga0495619_1146394 3300053085 Bacteria 516
274 Ga0500643_040653 3300053087 Bacteria 1369
275 Ga0500652_001855 3300053131 Bacteria 6386
276 Ga0500616_0193299 3300053153 Bacteria 907
277 Ga0501084_0063744 3300054114 Bacteria 3086
278 Ga0501084_0201779 3300054114 Bacteria 1678
279 Ga0501082_0075062 3300060353 Bacteria 2913
280 Ga0501082_0345283 3300060353 Bacteria 1297
281 Ga0501082_0398765 3300060353 Bacteria 1201
282 2508673430 2508501039 Bacteria 9978592
283 2515495338 2515154088 Bacteria 5526283
284 2515719466 2515154129 Bacteria 5584369
285 2515759390 2515154137 Bacteria 5711575
286 2516083804 2515154202 Bacteria 5471270
287 2516092237 2515154203 Bacteria 5458536
288 2738665816 2738541264 Bacteria 5935393
289 2738702651 2738541274 Bacteria 6909446
290 2739144950 2738541356 Bacteria 5935017
291 2739329561 2738543028 Bacteria 6917070
292 2842135142 2842134933 Bacteria 5847019
293 2929213191 2929212328 Bacteria 7708288
294 2939587088 2939582691 Bacteria 7088898
295 8002786412 8002784119 Bacteria 9788632
296 Ga0070664_101437292
297 Ga0065707_10686629
298 Ga0070658_10014670
299 Ga0070658_10130650
300 Ga0070658_11008892
301 Ga0070683_100214920
302 Ga0070670_100892981
303 Ga0070670_101436505
304 Ga0070675_100052179
305 Ga0070675_100265856
306 Ga0070673_100175362
307 Ga0070714_100081961
308 Ga0070713_100514076
309 Ga0070685_10509104
310 Ga0070685_11302141
311 Ga0068859_100000155
312 Ga0068859_100092548
313 Ga0068859_101215666
314 Ga0068863_101403727
315 Ga0068860_100073408
316 Ga0068862_100000009
317 Ga0068862_101502769
318 Ga0081455_10318599
319 Ga0075365_10000628
320 Ga0075365_10073339
321 Ga0075365_10116717
322 Ga0075365_10167594
323 Ga0075365_10960597
324 Ga0075368_10016664
325 Ga0075368_10228584
326 Ga0075363_100058478
327 Ga0075363_100363906
328 Ga0075363_100411589
329 Ga0075364_10007159
330 Ga0075364_10009373
331 Ga0075364_10020927
332 Ga0075364_10544410
333 Ga0075364_10569236
334 Ga0075362_10023784
335 Ga0075362_10057579
336 Ga0075362_10149871
337 Ga0075362_10154214
338 Ga0075367_10157508
339 Ga0075367_10235225
340 Ga0075367_10674900
341 Ga0075369_10419891
342 Ga0075370_10121462
343 Ga0075370_10170310
344 Ga0075428_100023427
345 Ga0075428_100055903
346 Ga0075428_101281298
347 Ga0075428_101366889
348 Ga0075430_100005639
349 Ga0075430_100016142
350 Ga0075430_100422862
351 Ga0075430_101599806
352 Ga0075431_100003785
353 Ga0075431_100390909
354 Ga0075429_100122503
355 Ga0075436_100272113
356 Ga0097620_100000155
357 Ga0097620_100092546
358 Ga0097620_101215594
359 Ga0105240_10080205
360 Ga0111539_10044796
361 Ga0111539_10542109
362 Ga0111539_11759044
363 Ga0105245_10004974
364 Ga0105245_10191528
365 Ga0114129_10007858
366 Ga0105241_11042783
367 Ga0105242_10087091
368 Ga0105248_12198965
369 Ga0105237_11933119
370 Ga0105249_10005468
371 Ga0105239_13195916
372 Ga0157374_10847153
373 Ga0157374_11532036
374 Ga0157378_11029939
375 Ga0163162_11704146
376 Ga0163162_12936760
377 Ga0163163_10091847
378 Ga0163163_11256788
379 Ga0157376_10279303
380 Ga0207645_10335837
381 Ga0207705_10181738
382 Ga0207657_10060383
383 Ga0207657_10269968
384 Ga0207650_11057319
385 Ga0207659_10062258
386 Ga0207687_10002438
387 Ga0207687_11616528
388 Ga0207664_10108996
389 Ga0207686_10125114
390 Ga0207686_10263963
391 Ga0207709_10517841
392 Ga0207661_10166515
393 Ga0207651_10057924
394 Ga0207712_10001811
395 Ga0207668_10551874
396 Ga0207708_10410435
397 Ga0209971_1077229
398 Ga0207428_10112660
399 Ga0268265_10000050
400 Ga0268265_11162269
401 Ga0268264_10056366
402 Ga0268264_10718283
403 Ga0265338_10663766
404 Ga0265320_10179181
405 Ga0316576_10857920
406 Ga0307413_10719193
407 Ga0307413_11356279
408 Ga0307410_10074613
409 Ga0307407_11405649
410 Ga0307409_100738772
411 Ga0373934_0000177
412 Ga0373936_0087616
413 Ga0373953_0000881
414 Ga0373954_0001801
415 Ga0373956_0000554
416 Ga0373957_0000067
417 Ga0373955_0000018
418 Ga0316574_1011714
419 Ga0373924_0002591
420 Ga0373935_0499516
421 Ga0373927_0009281
422 Ga0373933_0000003
423 Ga0373937_0000016
424 Ga0373937_0252449
425 Ga0316582_0409925
426 Ga0373925_0003574
427 Ga0436363_0506941
428 Ga0439438_118287
429 Ga0451804_0928452
430 Ga0451851_0569466
431 Ga0466969_0141076
432 Ga0466965_0885371
433 Ga0466966_0034437
434 Ga0466961_0110652
435 Ga0466964_0091316
436 Ga0466958_0349428
437 Ga0466967_1118612
438 Ga0466967_2406114
439 Ga0495592_0000268
440 Ga0495603_0206794
441 Ga0495651_0000009
442 Ga0495653_0000782
443 Ga0495653_0230840
444 Ga0495582_0290271
445 Ga0495582_0439953
446 Ga0495639_0128228
447 Ga0495664_0475572
448 Ga0495594_0188303
449 Ga0495608_0000019
450 Ga0495618_0210044
451 Ga0495618_0679390
452 Ga0495628_0000761
453 Ga0495628_0014219
454 Ga0495628_0424256
455 Ga0495666_0388120
456 Ga0495652_0000082
457 Ga0495652_0138488
458 Ga0495665_0138839
459 Ga0495586_0237702
460 Ga0495587_0000041
461 Ga0495645_0360211
462 Ga0495622_0171852
463 Ga0495667_0000037
464 Ga0495657_0000094
465 Ga0495599_0000040
466 Ga0495623_0000465
467 Ga0495646_0032454
468 Ga0495647_0017322
469 Ga0495647_0293307
470 Ga0495658_0007053
471 Ga0495658_0615433
472 Ga0495600_0018042
473 Ga0495600_0155396
474 Ga0495604_0000040
475 Ga0495680_0000010
476 Ga0495680_0368763
477 Ga0495680_0411346
478 Ga0495675_0000688
479 Ga0495684_0062659
480 Ga0495602_0000109
481 Ga0495602_0805306
482 Ga0495614_0014682
483 Ga0496100_0356044
484 Ga0496101_0743122
485 Ga0496108_0758676
486 Ga0496109_0444466
487 Ga0496112_0059620
488 Ga0496112_0398302
489 Ga0496112_0523719
490 Ga0496113_0121009
491 Ga0496113_0822998
492 Ga0496122_0047917
493 Ga0496123_0216065
494 Ga0496126_0011364
495 Ga0501032_0306686
496 Ga0501033_0164691
497 Ga0501036_0031928
498 Ga0501036_0320451
499 Ga0501036_0612457
500 Ga0501037_0530443
501 Ga0501039_0498325
502 Ga0501040_0106630
503 Ga0501042_0067687
504 Ga0501043_0152504
505 Ga0501046_0566310
506 Ga0501047_0185939
507 Ga0501048_0087207
508 Ga0501068_0018155
509 Ga0501069_0091971
510 Ga0501069_0199000
511 Ga0501072_0136448
512 Ga0501072_1470937
513 Ga0501073_0156753
514 Ga0501073_0326808
515 Ga0501075_0069751
516 Ga0501076_0171308
517 Ga0501076_1253769
518 Ga0501077_0100819
519 Ga0501079_0463558
520 Ga0501079_0545408
521 Ga0501080_0167572
522 Ga0501035_0032653
523 Ga0501044_0027762
524 Ga0501044_0450330
525 Ga0501045_0129561
526 nmdc:mga03683_32098_c1
527 nmdc:mga03683_66344_c1
528 nmdc:mga03683_93419_c1
529 nmdc:mga03n38_146296_c1
530 nmdc:mga03n38_20614_c1
531 nmdc:mga03n38_461917_c1
532 nmdc:mga03n38_512016_c1
533 nmdc:mga03n38_932604_c1
534 nmdc:mga00v17_18571_c1
535 nmdc:mga00v17_24132_c1
536 nmdc:mga00v17_541455_c1
537 nmdc:mga00v17_61839_c1
538 nmdc:mga0yw44_262959_c1
539 nmdc:mga0yw44_28856_c1
540 nmdc:mga0yw44_4493_c1
541 nmdc:mga0yw44_505959_c1
542 nmdc:mga0yw44_51258_c1
543 nmdc:mga0yw44_687271_c1
544 nmdc:mga06z11_11178_c1
545 nmdc:mga06z11_165864_c1
546 nmdc:mga06z11_609920_c1
547 nmdc:mga06z11_789813_c1
548 nmdc:mga04h51_164665_c1
549 nmdc:mga04h51_241949_c1
550 nmdc:mga07m45_427639_c1
551 nmdc:mga05p37_377215_c1
552 nmdc:mga05p37_8311_c1
553 nmdc:mga09592_195979_c1
554 nmdc:mga09592_3761_c1
555 nmdc:mga0qj67_172436_c1
556 nmdc:mga0qj67_3878_c1
557 nmdc:mga0qj67_533195_c1
558 nmdc:mga0qj67_754849_c1
559 nmdc:mga06r32_18082_c1
560 nmdc:mga06r32_57057_c1
561 nmdc:mga08y16_23272_c1
562 nmdc:mga0sz30_567830_c1
563 Ga0495601_0138990
564 Ga0495612_0321673
565 Ga0500635_0002004
566 Ga0495595_0103045
567 Ga0495619_0056006
568 Ga0495619_1146394
569 Ga0500643_040653
570 Ga0500652_001855
571 Ga0500616_0193299
572 Ga0501084_0063744
573 Ga0501084_0201779
574 Ga0501082_0075062
575 Ga0501082_0345283
576 Ga0501082_0398765
577 2508673430
578 2515495338
579 2515719466
580 2515759390
581 2516083804
582 2516092237
583 2738665816
584 2738702651
585 2739144950
586 2739329561
587 2842135142
588 2929213191
589 2939587088
590 8002786412

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

21

137

0.89

PF18029

Glyoxalase_6

Glyoxalase-like domain

24

138

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4z04-assembly1.cif.gz_A-2 crystal structure of a probable lactoylglutathione lyase from brucella melitensis in complex with glutathione 0.9182 1 122
4z04-assembly1.cif.gz_A-2 crystal structure of a probable lactoylglutathione lyase from brucella melitensis in complex with glutathione 0.9109 1 122
4qb5-assembly2.cif.gz_B crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.876 4 118
4qb5-assembly1.cif.gz_A crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.8481 4 121
4qb5-assembly2.cif.gz_B crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.8219 4 118
ID Description Score Start End Superfamily
4z04A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9182 1 122 3.10.180.10
4z04A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9109 1 122 3.10.180.10
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8625 61 121 3.30.720.110
af_Q8IK86_519_679_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8624 57 84 3.40.50.300
4qb5A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8411 6 121 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A7Y2FQG5-F1-model_v4 VOC family protein 0.9988 61 118
AF-M5CMF1-F1-model_v4 deleted 0.9865 61 122
AF-A0A0E1X199-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.9831 61 122 GO:0051213
AF-A0A352S8D7-F1-model_v4 Glyoxalase/bleomycin resistance/extradiol dioxygenase family protein 0.9811 59 122 GO:0051213
AF-A0A1Y2R398-F1-model_v4 Glyoxalase/fosfomycin resistance/dioxygenase domain-containing protein 0.9785 64 118

Map