F392554

General Info

Members Datasets Scaffolds Average Seq Length
295 177 295 121

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100365340|Ga0070665_1003653402
Length 123
Sequence VSVLALDHVQLAAPPGCEDEARRFYGDLLGLPELPKPESLRARGGVWFAVGAQQLHIGVEEPFSPARKAHPALRVDPDSLDAMADRLRAAGVEPRWDEELPGVRRFYADDPWGNRIELLATRP

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
48 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
49 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
50 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
70 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
71 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
72 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
73 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
74 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
75 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
76 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
77 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
78 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
79 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
80 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
81 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
82 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
83 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
84 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
89 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
90 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
91 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
92 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
93 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
94 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
95 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
96 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
97 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
98 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
99 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
100 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
101 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
102 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
103 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
104 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
105 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
106 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
107 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
108 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
109 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
110 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
111 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
112 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
113 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
114 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
115 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
116 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
117 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
118 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
119 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
122 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
123 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
124 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
125 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
126 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
127 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
128 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
129 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
130 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
131 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
132 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
133 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
134 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
135 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
136 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
137 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
138 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
139 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
140 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
141 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
142 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
143 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
144 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
149 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
150 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
151 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
152 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
165 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
166 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
167 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
168 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
169 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
170 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
171 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
172 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
173 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
174 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
175 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
176 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
177 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.64
Metatranscriptomes 1.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.34
Nodule 0
Rhizoplane 10.85
Rhizosphere 85.08
Stem 0
Stem Tuber 0
Unclassified 3.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_11069392 3300005327 Bacteria 702
2 Ga0070683_100166979 3300005329 Bacteria 2089
3 Ga0070690_100025002 3300005330 Bacteria 3676
4 Ga0070689_100260928 3300005340 Bacteria 1432
5 Ga0070668_100806807 3300005347 Bacteria 834
6 Ga0070671_100278121 3300005355 Bacteria 1423
7 Ga0070714_100882551 3300005435 Bacteria 868
8 Ga0070713_100631890 3300005436 Bacteria 1019
9 Ga0070711_100197134 3300005439 Bacteria 1551
10 Ga0070711_100812156 3300005439 Unclassified 794
11 Ga0070700_100266753 3300005441 Bacteria 1235
12 Ga0070694_100761572 3300005444 Bacteria 791
13 Ga0070663_100252688 3300005455 Bacteria 1396
14 Ga0070662_100874239 3300005457 Bacteria 766
15 Ga0070681_10172207 3300005458 Bacteria 2087
16 Ga0070707_100675226 3300005468 Bacteria 996
17 Ga0070679_100330525 3300005530 Bacteria 1473
18 Ga0070684_100084842 3300005535 Bacteria 2808
19 Ga0070672_101351793 3300005543 Bacteria 637
20 Ga0070686_100703838 3300005544 Bacteria 806
21 Ga0070665_100365340 3300005548 Bacteria 1450
22 Ga0068855_100050351 3300005563 Bacteria 4908
23 Ga0068855_100089830 3300005563 Bacteria 3546
24 Ga0070664_100560995 3300005564 Bacteria 1056
25 Ga0068857_101395685 3300005577 Bacteria 681
26 Ga0068856_100250869 3300005614 Bacteria 1785
27 Ga0068866_11098454 3300005718 Bacteria 570
28 Ga0068866_11106205 3300005718 Bacteria 568
29 Ga0070717_11372518 3300006028 Unclassified 642
30 Ga0070715_10198738 3300006163 Bacteria 1017
31 Ga0070712_100666578 3300006175 Bacteria 885
32 Ga0075433_10247819 3300006852 Unclassified 1581
33 Ga0068865_100134796 3300006881 Bacteria 1854
34 Ga0075435_100031155 3300007076 Bacteria 4199
35 Ga0105240_10484504 3300009093 Bacteria 1378
36 Ga0105240_11815878 3300009093 Bacteria 635
37 Ga0105245_11956322 3300009098 Bacteria 640
38 Ga0105243_11159212 3300009148 Bacteria 784
39 Ga0105243_12511922 3300009148 Bacteria 554
40 Ga0105241_10679675 3300009174 Bacteria 938
41 Ga0105242_10072956 3300009176 Bacteria 2852
42 Ga0105237_10054007 3300009545 Bacteria 4026
43 Ga0105249_11571431 3300009553 Bacteria 730
44 Ga0157373_11390508 3300013100 Bacteria 533
45 Ga0157369_10012792 3300013105 Bacteria 9515
46 Ga0157369_10086544 3300013105 Bacteria 3347
47 Ga0157369_10965503 3300013105 Bacteria 873
48 Ga0157372_10204426 3300013307 Bacteria 2288
49 Ga0157372_12074169 3300013307 Bacteria 653
50 Ga0157375_12517815 3300013308 Bacteria 614
51 Ga0157380_10734164 3300014326 Bacteria 997
52 Ga0206356_11878143 3300020070 Bacteria 1230
53 Ga0206354_10271135 3300020081 Bacteria 3028
54 Ga0206353_10713789 3300020082 Bacteria 5093
55 Ga0206353_11330898 3300020082 Bacteria 2887
56 Ga0213874_10031673 3300021377 Bacteria 1532
57 Ga0213874_10036194 3300021377 Bacteria 1454
58 Ga0213876_10077700 3300021384 Bacteria 1753
59 Ga0207426_1016301 3300025302 Bacteria 2672
60 Ga0207642_10147377 3300025899 Bacteria 1248
61 Ga0207705_10202139 3300025909 Bacteria 1506
62 Ga0207705_11479231 3300025909 Bacteria 515
63 Ga0207693_10436023 3300025915 Bacteria 1024
64 Ga0207663_10286402 3300025916 Bacteria 1226
65 Ga0207652_10118029 3300025921 Bacteria 2357
66 Ga0207652_10290154 3300025921 Bacteria 1476
67 Ga0207700_10537047 3300025928 Bacteria 1037
68 Ga0207664_10030263 3300025929 Bacteria 4134
69 Ga0207644_10192079 3300025931 Bacteria 1606
70 Ga0207670_11686356 3300025936 Bacteria 539
71 Ga0207669_10092304 3300025937 Bacteria 1975
72 Ga0207669_10898897 3300025937 Bacteria 740
73 Ga0207691_11003499 3300025940 Bacteria 696
74 Ga0207689_10913483 3300025942 Bacteria 741
75 Ga0207712_10250316 3300025961 Bacteria 1432
76 Ga0207668_10725039 3300025972 Unclassified 875
77 Ga0207678_10114166 3300026067 Bacteria 2305
78 Ga0207708_10347572 3300026075 Bacteria 1216
79 Ga0207708_10429118 3300026075 Bacteria 1097
80 Ga0207702_10991193 3300026078 Bacteria 833
81 Ga0207675_100121618 3300026118 Bacteria 2471
82 Ga0207683_10455961 3300026121 Bacteria 1179
83 Ga0265322_10142262 3300028654 Bacteria 685
84 Ga0265339_10093724 3300031249 Unclassified 1571
85 Ga0265331_10261198 3300031250 Bacteria 776
86 Ga0265331_10353902 3300031250 Bacteria 658
87 Ga0265316_10152048 3300031344 Bacteria 1733
88 Ga0265316_10794745 3300031344 Bacteria 664
89 Ga0373944_0011782 3300035089 Bacteria 2400
90 Ga0373936_0005922 3300035113 Bacteria 4602
91 Ga0373945_0013562 3300035116 Bacteria 2721
92 Ga0373943_0001870 3300035170 Bacteria 9519
93 Ga0373946_0099197 3300035171 Bacteria 1303
94 Ga0373955_0064772 3300035172 Bacteria 2027
95 Ga0373931_0065102 3300035691 Bacteria 1975
96 Ga0373935_0290350 3300035692 Bacteria 1153
97 Ga0373927_0057432 3300035695 Bacteria 2517
98 Ga0373947_0001603 3300035725 Bacteria 13872
99 Ga0373937_0344923 3300036401 Bacteria 1410
100 Ga0373937_1097660 3300036401 Bacteria 744
101 Ga0373925_0003779 3300037068 Bacteria 11641
102 Ga0373925_0727639 3300037068 Bacteria 818
103 Ga0395899_0013593 3300037312 Bacteria 6223
104 Ga0395899_0994820 3300037312 Unclassified 506
105 Ga0395900_0011981 3300037418 Bacteria 8868
106 Ga0395900_0551796 3300037418 Bacteria 1097
107 Ga0395898_0009236 3300037466 Bacteria 10372
108 Ga0395898_0676680 3300037466 Bacteria 974
109 Ga0395898_1418477 3300037466 Unclassified 622
110 Ga0395898_1749465 3300037466 Bacteria 544
111 Ga0395905_0435587 3300037471 Bacteria 1208
112 Ga0436364_0797465 3300037853 Bacteria 500
113 Ga0395901_0068181 3300038443 Bacteria 3706
114 Ga0395901_0297474 3300038443 Bacteria 1674
115 Ga0395901_0644677 3300038443 Unclassified 1063
116 Ga0395901_0914208 3300038443 Unclassified 859
117 Ga0395901_1320021 3300038443 Bacteria 683
118 Ga0436365_0617675 3300039437 Bacteria 768
119 Ga0436365_0925424 3300039437 Bacteria 826
120 Ga0436365_1463062 3300039437 Unclassified 867
121 Ga0436365_1519287 3300039437 Bacteria 4100
122 Ga0436365_1769223 3300039437 Bacteria 1608
123 Ga0436363_0700158 3300039450 Bacteria 1747
124 Ga0436363_0936562 3300039450 Bacteria 1434
125 Ga0439446_0261423 3300042156 Archaea 599
126 Ga0466972_0572760 3300044658 Bacteria 533
127 Ga0466965_0385287 3300044683 Bacteria 773
128 Ga0466966_0020792 3300044684 Bacteria 4314
129 Ga0466966_0064576 3300044684 Bacteria 2304
130 Ga0466961_0048540 3300044693 Bacteria 2713
131 Ga0466961_0054361 3300044693 Bacteria 2554
132 Ga0466961_0114415 3300044693 Bacteria 1696
133 Ga0466961_0252390 3300044693 Bacteria 1083
134 Ga0466961_0386391 3300044693 Bacteria 850
135 Ga0466963_0053954 3300044694 Bacteria 2670
136 Ga0466963_0118508 3300044694 Bacteria 1820
137 Ga0466963_0212888 3300044694 Bacteria 1352
138 Ga0466963_0279027 3300044694 Bacteria 1174
139 Ga0466963_0304641 3300044694 Bacteria 1121
140 Ga0466963_0449074 3300044694 Bacteria 910
141 Ga0466963_0503142 3300044694 Bacteria 855
142 Ga0466971_0000590 3300044719 Bacteria 14368
143 Ga0466971_0007091 3300044719 Bacteria 4878
144 Ga0466971_0141889 3300044719 Bacteria 1119
145 Ga0466968_0005599 3300044735 Bacteria 4704
146 Ga0466970_0729082 3300044765 Bacteria 579
147 Ga0466970_0843670 3300044765 Bacteria 538
148 Ga0466957_0002630 3300044842 Bacteria 9695
149 Ga0466957_0131839 3300044842 Bacteria 1602
150 Ga0466957_0258133 3300044842 Bacteria 1160
151 Ga0466957_0268642 3300044842 Bacteria 1138
152 Ga0466960_0187766 3300044901 Bacteria 1123
153 Ga0466959_0060918 3300045049 Bacteria 2745
154 Ga0466959_0069333 3300045049 Bacteria 2555
155 Ga0466959_0128558 3300045049 Bacteria 1797
156 Ga0466959_0197645 3300045049 Bacteria 1401
157 Ga0466958_0001026 3300045836 Bacteria 12733
158 Ga0466958_0014823 3300045836 Bacteria 4456
159 Ga0466958_0078850 3300045836 Bacteria 2024
160 Ga0466958_0092561 3300045836 Bacteria 1872
161 Ga0466958_0109761 3300045836 Bacteria 1722
162 Ga0466958_0777631 3300045836 Bacteria 624
163 Ga0466958_0925715 3300045836 Bacteria 569
164 Ga0466967_0019312 3300045976 Bacteria 5476
165 Ga0466967_0024586 3300045976 Bacteria 4955
166 Ga0466967_0037813 3300045976 Bacteria 4134
167 Ga0466967_0074830 3300045976 Bacteria 3043
168 Ga0466967_0259645 3300045976 Bacteria 1662
169 Ga0466967_0552945 3300045976 Bacteria 1133
170 Ga0466967_0876102 3300045976 Bacteria 893
171 Ga0466967_1124468 3300045976 Bacteria 783
172 Ga0466967_1275727 3300045976 Bacteria 732
173 Ga0466967_1342221 3300045976 Bacteria 712
174 Ga0495592_0138329 3300046454 Bacteria 1696
175 Ga0495592_0145732 3300046454 Bacteria 1642
176 Ga0495603_0139198 3300046455 Bacteria 1412
177 Ga0495629_0214146 3300046459 Unclassified 1330
178 Ga0495629_1125635 3300046459 Bacteria 507
179 Ga0495641_0007981 3300046461 Bacteria 6524
180 Ga0495641_0037912 3300046461 Bacteria 2255
181 Ga0495651_0090958 3300046462 Bacteria 2288
182 Ga0495651_0165862 3300046462 Bacteria 1578
183 Ga0495653_0064439 3300046463 Bacteria 2761
184 Ga0495582_0026394 3300046473 Bacteria 3184
185 Ga0495639_0552990 3300046475 Bacteria 590
186 Ga0495662_0506777 3300046476 Bacteria 592
187 Ga0495664_0209752 3300046477 Bacteria 1180
188 Ga0495608_0035515 3300046511 Bacteria 3362
189 Ga0495608_0100747 3300046511 Bacteria 1862
190 Ga0495618_0097822 3300046514 Bacteria 1878
191 Ga0495628_0211520 3300046516 Bacteria 1459
192 Ga0495630_0046316 3300046517 Bacteria 3251
193 Ga0495630_0568807 3300046517 Bacteria 869
194 Ga0495630_0770255 3300046517 Bacteria 735
195 Ga0495630_1269765 3300046517 Bacteria 556
196 Ga0495644_0076585 3300046523 Bacteria 1260
197 Ga0495652_0119212 3300046529 Bacteria 2108
198 Ga0495652_0733263 3300046529 Bacteria 662
199 Ga0495640_0008589 3300046533 Bacteria 8009
200 Ga0495640_0217397 3300046533 Bacteria 1206
201 Ga0495586_0013210 3300046535 Bacteria 4378
202 Ga0495587_0446685 3300046536 Bacteria 716
203 Ga0495667_0074423 3300046559 Bacteria 2211
204 Ga0495667_0075954 3300046559 Bacteria 2186
205 Ga0495667_0329725 3300046559 Bacteria 965
206 Ga0495634_0238243 3300046642 Bacteria 1117
207 Ga0495634_0338010 3300046642 Bacteria 904
208 Ga0495657_0069633 3300046675 Bacteria 2301
209 Ga0495657_0465056 3300046675 Bacteria 740
210 Ga0495599_0572634 3300046678 Bacteria 660
211 Ga0495623_0050513 3300046679 Bacteria 2633
212 Ga0495646_0324910 3300046680 Bacteria 810
213 Ga0495658_0006615 3300046683 Bacteria 5696
214 Ga0495658_0074481 3300046683 Bacteria 1978
215 Ga0495658_0168629 3300046683 Bacteria 1354
216 Ga0495613_0061728 3300046689 Bacteria 2744
217 Ga0495613_0064987 3300046689 Bacteria 2667
218 Ga0495613_0130762 3300046689 Bacteria 1798
219 Ga0495613_0387518 3300046689 Bacteria 955
220 Ga0495624_0087919 3300046690 Bacteria 1919
221 Ga0495589_0066918 3300046794 Bacteria 1759
222 Ga0495581_0573969 3300047315 Bacteria 654
223 Ga0495581_0638142 3300047315 Bacteria 616
224 Ga0495604_0128448 3300047317 Bacteria 1824
225 Ga0495604_0177834 3300047317 Bacteria 1490
226 Ga0495674_0142790 3300047319 Bacteria 2012
227 Ga0495674_0186798 3300047319 Bacteria 1724
228 Ga0495674_0798406 3300047319 Bacteria 734
229 Ga0495676_0025046 3300047321 Bacteria 5155
230 Ga0495676_0301886 3300047321 Bacteria 1079
231 Ga0495680_0006791 3300047322 Bacteria 10571
232 Ga0495680_0054144 3300047322 Bacteria 3117
233 Ga0495680_0079659 3300047322 Bacteria 2476
234 Ga0495675_0705264 3300047444 Bacteria 565
235 Ga0495684_0165220 3300047471 Bacteria 1649
236 Ga0495684_0167882 3300047471 Bacteria 1634
237 Ga0495602_0504249 3300048088 Bacteria 845
238 Ga0495602_0817849 3300048088 Unclassified 625
239 Ga0495614_0234959 3300048089 Bacteria 836
240 Ga0495614_0648780 3300048089 Bacteria 509
241 Ga0496100_0068152 3300048903 Bacteria 2365
242 Ga0496100_0148633 3300048903 Bacteria 1668
243 Ga0496100_0150032 3300048903 Bacteria 1661
244 Ga0496101_0012847 3300048904 Bacteria 5600
245 Ga0496101_0058606 3300048904 Bacteria 2789
246 Ga0496101_0262387 3300048904 Bacteria 1347
247 Ga0496101_0624448 3300048904 Bacteria 852
248 Ga0496102_0014636 3300048905 Bacteria 6819
249 Ga0496102_0201699 3300048905 Bacteria 1875
250 Ga0496103_0015857 3300048906 Bacteria 4493
251 Ga0496103_0209245 3300048906 Bacteria 1254
252 Ga0496104_0256097 3300048907 Bacteria 1663
253 Ga0496104_1730375 3300048907 Bacteria 527
254 Ga0496105_0111269 3300048908 Bacteria 2260
255 Ga0496105_1051828 3300048908 Unclassified 606
256 Ga0496106_0027742 3300048909 Bacteria 4218
257 Ga0496107_0017765 3300048910 Bacteria 5005
258 Ga0496107_0019528 3300048910 Bacteria 4782
259 Ga0496107_0022301 3300048910 Bacteria 4475
260 Ga0496107_0606718 3300048910 Bacteria 809
261 Ga0496108_0613934 3300048911 Bacteria 947
262 Ga0496109_0006160 3300048912 Bacteria 10082
263 Ga0496109_0542677 3300048912 Unclassified 1097
264 Ga0496109_1849308 3300048912 Bacteria 537
265 Ga0496110_0360068 3300048913 Bacteria 1325
266 Ga0496112_0095866 3300048915 Bacteria 2937
267 Ga0496112_0265933 3300048915 Unclassified 1664
268 Ga0496113_0015242 3300048916 Bacteria 5276
269 Ga0496114_0051825 3300048917 Bacteria 3417
270 Ga0496114_0572790 3300048917 Bacteria 997
271 Ga0496115_0014541 3300048918 Bacteria 5958
272 Ga0496115_0097344 3300048918 Bacteria 2410
273 Ga0501036_0427795 3300049572 Bacteria 1104
274 Ga0501039_0609430 3300049575 Bacteria 856
275 Ga0501042_0844983 3300049578 Bacteria 666
276 Ga0501047_1390802 3300049581 Bacteria 517
277 Ga0501069_0960850 3300049585 Bacteria 521
278 Ga0501070_0091382 3300049586 Bacteria 2519
279 Ga0501071_0877497 3300049587 Bacteria 692
280 Ga0501074_0178703 3300049590 Bacteria 1514
281 Ga0501074_0686310 3300049590 Bacteria 723
282 Ga0501075_1383519 3300049591 Unclassified 533
283 Ga0501079_1050191 3300049741 Bacteria 642
284 Ga0501080_0321123 3300049742 Bacteria 1402
285 Ga0501035_0467927 3300049822 Bacteria 1041
286 Ga0501035_1359638 3300049822 Bacteria 546
287 nmdc:mga0rr50_31408_c1 3300050513 Bacteria 3771
288 nmdc:mga0a205_315066_c1 3300050515 Unclassified 1436
289 Ga0495601_0150970 3300053077 Bacteria 1517
290 Ga0495601_0877785 3300053077 Bacteria 567
291 Ga0495595_0287951 3300053084 Bacteria 825
292 Ga0495619_0685936 3300053085 Unclassified 697
293 Ga0466962_0000105 3300061719 Bacteria 34251
294 Ga0466962_0014371 3300061719 Bacteria 3814
295 Ga0466962_0029367 3300061719 Bacteria 2632

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300021377 Ga0213874_10036194 Ga0213874_100361942 111
2 3300031250 Ga0265331_10353902 Ga0265331_103539021 111
3 3300031344 Ga0265316_10152048 Ga0265316_101520482 111
4 3300044683 Ga0466965_0385287 Ga0466965_0385287_297_632 111
5 3300044842 Ga0466957_0002630 Ga0466957_0002630_995_1339 111
6 3300045049 Ga0466959_0197645 Ga0466959_0197645_175_519 111
7 3300045836 Ga0466958_0014823 Ga0466958_0014823_3101_3445 111
8 3300045836 Ga0466958_0925715 Ga0466958_0925715_16_351 111
9 3300061719 Ga0466962_0014371 Ga0466962_0014371_2029_2373 111
10 3300026075 Ga0207708_10429118 Ga0207708_104291182 112
11 3300013308 Ga0157375_12517815 Ga0157375_125178151 113
12 3300025302 Ga0207426_1016301 Ga0207426_10163013 113
13 3300044719 Ga0466971_0007091 Ga0466971_0007091_679_1047 113
14 3300005340 Ga0070689_100260928 Ga0070689_1002609282 114
15 3300005544 Ga0070686_100703838 Ga0070686_1007038381 114
16 3300009148 Ga0105243_12511922 Ga0105243_125119222 114
17 3300025936 Ga0207670_11686356 Ga0207670_116863562 114
18 3300048907 Ga0496104_0256097 Ga0496104_0256097_1243_1593 116
19 3300048915 Ga0496112_0265933 Ga0496112_0265933_933_1283 116
20 3300005563 Ga0068855_100089830 Ga0068855_1000898303 117
21 3300025909 Ga0207705_11479231 Ga0207705_114792311 117
22 3300035691 Ga0373931_0065102 Ga0373931_0065102_34_387 117
23 3300045049 Ga0466959_0128558 Ga0466959_0128558_107_490 117
24 3300045836 Ga0466958_0078850 Ga0466958_0078850_1463_1822 117
25 3300013105 Ga0157369_10965503 Ga0157369_109655032 118
26 3300038443 Ga0395901_1320021 Ga0395901_1320021_274_630 118
27 3300044765 Ga0466970_0729082 Ga0466970_0729082_21_389 118
28 3300044901 Ga0466960_0187766 Ga0466960_0187766_182_547 118
29 3300045976 Ga0466967_0552945 Ga0466967_0552945_477_836 118
30 3300046689 Ga0495613_0130762 Ga0495613_0130762_380_742 118
31 3300005329 Ga0070683_100166979 Ga0070683_1001669793 119
32 3300005435 Ga0070714_100882551 Ga0070714_1008825512 119
33 3300005436 Ga0070713_100631890 Ga0070713_1006318902 119
34 3300005439 Ga0070711_100197134 Ga0070711_1001971341 119
35 3300005439 Ga0070711_100812156 Ga0070711_1008121561 119
36 3300005458 Ga0070681_10172207 Ga0070681_101722072 119
37 3300005468 Ga0070707_100675226 Ga0070707_1006752262 119
38 3300005530 Ga0070679_100330525 Ga0070679_1003305252 119
39 3300005563 Ga0068855_100050351 Ga0068855_1000503513 119
40 3300005614 Ga0068856_100250869 Ga0068856_1002508692 119
41 3300005718 Ga0068866_11106205 Ga0068866_111062051 119
42 3300006163 Ga0070715_10198738 Ga0070715_101987382 119
43 3300006175 Ga0070712_100666578 Ga0070712_1006665782 119
44 3300006852 Ga0075433_10247819 Ga0075433_102478192 119
45 3300007076 Ga0075435_100031155 Ga0075435_1000311553 119
46 3300009098 Ga0105245_11956322 Ga0105245_119563221 119
47 3300009148 Ga0105243_11159212 Ga0105243_111592122 119
48 3300009174 Ga0105241_10679675 Ga0105241_106796752 119
49 3300009176 Ga0105242_10072956 Ga0105242_100729562 119
50 3300009545 Ga0105237_10054007 Ga0105237_100540072 119
51 3300013100 Ga0157373_11390508 Ga0157373_113905081 119
52 3300013105 Ga0157369_10012792 Ga0157369_100127924 119
53 3300013307 Ga0157372_10204426 Ga0157372_102044263 119
54 3300020070 Ga0206356_11878143 Ga0206356_118781432 119
55 3300020082 Ga0206353_11330898 Ga0206353_113308983 119
56 3300021377 Ga0213874_10031673 Ga0213874_100316733 119
57 3300021384 Ga0213876_10077700 Ga0213876_100777002 119
58 3300025915 Ga0207693_10436023 Ga0207693_104360232 119
59 3300025916 Ga0207663_10286402 Ga0207663_102864022 119
60 3300025921 Ga0207652_10118029 Ga0207652_101180293 119
61 3300025921 Ga0207652_10290154 Ga0207652_102901542 119
62 3300025928 Ga0207700_10537047 Ga0207700_105370472 119
63 3300025929 Ga0207664_10030263 Ga0207664_100302632 119
64 3300025937 Ga0207669_10898897 Ga0207669_108988971 119
65 3300026078 Ga0207702_10991193 Ga0207702_109911931 119
66 3300026121 Ga0207683_10455961 Ga0207683_104559612 119
67 3300028654 Ga0265322_10142262 Ga0265322_101422621 119
68 3300031249 Ga0265339_10093724 Ga0265339_100937242 119
69 3300031344 Ga0265316_10794745 Ga0265316_107947451 119
70 3300035172 Ga0373955_0064772 Ga0373955_0064772_101_460 119
71 3300036401 Ga0373937_0344923 Ga0373937_0344923_538_897 119
72 3300037068 Ga0373925_0727639 Ga0373925_0727639_38_397 119
73 3300037312 Ga0395899_0013593 Ga0395899_0013593_3313_3672 119
74 3300037312 Ga0395899_0994820 Ga0395899_0994820_56_418 119
75 3300037418 Ga0395900_0011981 Ga0395900_0011981_7441_7800 119
76 3300037418 Ga0395900_0551796 Ga0395900_0551796_301_660 119
77 3300037466 Ga0395898_0009236 Ga0395898_0009236_7132_7491 119
78 3300037466 Ga0395898_0676680 Ga0395898_0676680_318_677 119
79 3300037466 Ga0395898_1418477 Ga0395898_1418477_210_572 119
80 3300037466 Ga0395898_1749465 Ga0395898_1749465_138_497 119
81 3300037471 Ga0395905_0435587 Ga0395905_0435587_388_750 119
82 3300038443 Ga0395901_0068181 Ga0395901_0068181_17_376 119
83 3300038443 Ga0395901_0297474 Ga0395901_0297474_1293_1652 119
84 3300038443 Ga0395901_0644677 Ga0395901_0644677_333_692 119
85 3300038443 Ga0395901_0914208 Ga0395901_0914208_264_623 119
86 3300039437 Ga0436365_0925424 Ga0436365_0925424_92_451 119
87 3300039437 Ga0436365_1463062 Ga0436365_1463062_246_605 119
88 3300039437 Ga0436365_1519287 Ga0436365_1519287_3612_3977 119
89 3300039437 Ga0436365_1769223 Ga0436365_1769223_482_847 119
90 3300039450 Ga0436363_0700158 Ga0436363_0700158_886_1251 119
91 3300039450 Ga0436363_0936562 Ga0436363_0936562_401_760 119
92 3300044658 Ga0466972_0572760 Ga0466972_0572760_52_411 119
93 3300044684 Ga0466966_0020792 Ga0466966_0020792_3265_3624 119
94 3300044684 Ga0466966_0064576 Ga0466966_0064576_93_452 119
95 3300044693 Ga0466961_0048540 Ga0466961_0048540_1711_2070 119
96 3300044693 Ga0466961_0054361 Ga0466961_0054361_91_492 119
97 3300044693 Ga0466961_0114415 Ga0466961_0114415_1016_1375 119
98 3300044693 Ga0466961_0252390 Ga0466961_0252390_552_917 119
99 3300044693 Ga0466961_0386391 Ga0466961_0386391_15_374 119
100 3300044694 Ga0466963_0053954 Ga0466963_0053954_582_941 119
101 3300044694 Ga0466963_0118508 Ga0466963_0118508_211_570 119
102 3300044694 Ga0466963_0279027 Ga0466963_0279027_486_887 119
103 3300044694 Ga0466963_0304641 Ga0466963_0304641_673_1074 119
104 3300044694 Ga0466963_0449074 Ga0466963_0449074_424_783 119
105 3300044694 Ga0466963_0503142 Ga0466963_0503142_141_500 119
106 3300044719 Ga0466971_0000590 Ga0466971_0000590_13123_13482 119
107 3300044719 Ga0466971_0141889 Ga0466971_0141889_703_1080 119
108 3300044735 Ga0466968_0005599 Ga0466968_0005599_1733_2131 119
109 3300044765 Ga0466970_0843670 Ga0466970_0843670_120_479 119
110 3300044842 Ga0466957_0131839 Ga0466957_0131839_815_1174 119
111 3300044842 Ga0466957_0258133 Ga0466957_0258133_156_515 119
112 3300045049 Ga0466959_0060918 Ga0466959_0060918_1421_1819 119
113 3300045049 Ga0466959_0069333 Ga0466959_0069333_285_644 119
114 3300045836 Ga0466958_0001026 Ga0466958_0001026_11533_11892 119
115 3300045836 Ga0466958_0092561 Ga0466958_0092561_459_857 119
116 3300045836 Ga0466958_0109761 Ga0466958_0109761_815_1174 119
117 3300045976 Ga0466967_0019312 Ga0466967_0019312_115_492 119
118 3300045976 Ga0466967_0024586 Ga0466967_0024586_305_664 119
119 3300045976 Ga0466967_0037813 Ga0466967_0037813_1738_2103 119
120 3300045976 Ga0466967_0074830 Ga0466967_0074830_115_474 119
121 3300045976 Ga0466967_0259645 Ga0466967_0259645_1269_1628 119
122 3300045976 Ga0466967_0876102 Ga0466967_0876102_141_500 119
123 3300045976 Ga0466967_1124468 Ga0466967_1124468_325_684 119
124 3300045976 Ga0466967_1275727 Ga0466967_1275727_85_444 119
125 3300045976 Ga0466967_1342221 Ga0466967_1342221_221_580 119
126 3300046454 Ga0495592_0138329 Ga0495592_0138329_1137_1496 119
127 3300046454 Ga0495592_0145732 Ga0495592_0145732_164_523 119
128 3300046459 Ga0495629_1125635 Ga0495629_1125635_62_421 119
129 3300046462 Ga0495651_0090958 Ga0495651_0090958_322_681 119
130 3300046462 Ga0495651_0165862 Ga0495651_0165862_812_1171 119
131 3300046463 Ga0495653_0064439 Ga0495653_0064439_885_1244 119
132 3300046475 Ga0495639_0552990 Ga0495639_0552990_131_490 119
133 3300046476 Ga0495662_0506777 Ga0495662_0506777_96_455 119
134 3300046477 Ga0495664_0209752 Ga0495664_0209752_119_478 119
135 3300046511 Ga0495608_0035515 Ga0495608_0035515_2251_2610 119
136 3300046511 Ga0495608_0100747 Ga0495608_0100747_1083_1442 119
137 3300046516 Ga0495628_0211520 Ga0495628_0211520_744_1103 119
138 3300046517 Ga0495630_0046316 Ga0495630_0046316_1459_1836 119
139 3300046517 Ga0495630_0568807 Ga0495630_0568807_407_766 119
140 3300046517 Ga0495630_1269765 Ga0495630_1269765_44_403 119
141 3300046529 Ga0495652_0733263 Ga0495652_0733263_74_433 119
142 3300046533 Ga0495640_0008589 Ga0495640_0008589_782_1141 119
143 3300046535 Ga0495586_0013210 Ga0495586_0013210_1399_1776 119
144 3300046536 Ga0495587_0446685 Ga0495587_0446685_246_605 119
145 3300046559 Ga0495667_0074423 Ga0495667_0074423_671_1030 119
146 3300046559 Ga0495667_0329725 Ga0495667_0329725_189_548 119
147 3300046642 Ga0495634_0238243 Ga0495634_0238243_235_612 119
148 3300046642 Ga0495634_0338010 Ga0495634_0338010_56_415 119
149 3300046675 Ga0495657_0069633 Ga0495657_0069633_651_1010 119
150 3300046678 Ga0495599_0572634 Ga0495599_0572634_106_465 119
151 3300046679 Ga0495623_0050513 Ga0495623_0050513_511_870 119
152 3300046680 Ga0495646_0324910 Ga0495646_0324910_60_419 119
153 3300046683 Ga0495658_0074481 Ga0495658_0074481_214_591 119
154 3300046689 Ga0495613_0064987 Ga0495613_0064987_1430_1807 119
155 3300046689 Ga0495613_0387518 Ga0495613_0387518_208_585 119
156 3300047317 Ga0495604_0128448 Ga0495604_0128448_221_580 119
157 3300047319 Ga0495674_0142790 Ga0495674_0142790_176_535 119
158 3300047319 Ga0495674_0186798 Ga0495674_0186798_1119_1496 119
159 3300047319 Ga0495674_0798406 Ga0495674_0798406_85_444 119
160 3300047321 Ga0495676_0301886 Ga0495676_0301886_500_859 119
161 3300047322 Ga0495680_0006791 Ga0495680_0006791_10181_10540 119
162 3300047322 Ga0495680_0054144 Ga0495680_0054144_560_919 119
163 3300047444 Ga0495675_0705264 Ga0495675_0705264_101_460 119
164 3300047471 Ga0495684_0167882 Ga0495684_0167882_777_1136 119
165 3300048088 Ga0495602_0504249 Ga0495602_0504249_178_537 119
166 3300048088 Ga0495602_0817849 Ga0495602_0817849_68_427 119
167 3300048089 Ga0495614_0234959 Ga0495614_0234959_310_687 119
168 3300048903 Ga0496100_0148633 Ga0496100_0148633_249_608 119
169 3300048903 Ga0496100_0150032 Ga0496100_0150032_1172_1534 119
170 3300048904 Ga0496101_0012847 Ga0496101_0012847_2646_3005 119
171 3300048904 Ga0496101_0262387 Ga0496101_0262387_38_400 119
172 3300048906 Ga0496103_0209245 Ga0496103_0209245_673_1035 119
173 3300048908 Ga0496105_1051828 Ga0496105_1051828_173_550 119
174 3300048909 Ga0496106_0027742 Ga0496106_0027742_919_1278 119
175 3300048910 Ga0496107_0017765 Ga0496107_0017765_2612_2971 119
176 3300048910 Ga0496107_0019528 Ga0496107_0019528_3090_3452 119
177 3300048910 Ga0496107_0606718 Ga0496107_0606718_233_592 119
178 3300048912 Ga0496109_1849308 Ga0496109_1849308_148_525 119
179 3300048915 Ga0496112_0095866 Ga0496112_0095866_570_929 119
180 3300048917 Ga0496114_0572790 Ga0496114_0572790_264_623 119
181 3300048918 Ga0496115_0097344 Ga0496115_0097344_1220_1579 119
182 3300049581 Ga0501047_1390802 Ga0501047_1390802_32_397 119
183 3300049585 Ga0501069_0960850 Ga0501069_0960850_112_477 119
184 3300049586 Ga0501070_0091382 Ga0501070_0091382_1234_1599 119
185 3300049590 Ga0501074_0178703 Ga0501074_0178703_528_893 119
186 3300049590 Ga0501074_0686310 Ga0501074_0686310_143_520 119
187 3300049742 Ga0501080_0321123 Ga0501080_0321123_694_1059 119
188 3300049822 Ga0501035_1359638 Ga0501035_1359638_87_452 119
189 3300050513 nmdc:mga0rr50_31408_c1 nmdc:mga0rr50_31408_c1_1455_1814 119
190 3300050515 nmdc:mga0a205_315066_c1 nmdc:mga0a205_315066_c1_48_407 119
191 3300053077 Ga0495601_0877785 Ga0495601_0877785_22_381 119
192 3300053084 Ga0495595_0287951 Ga0495595_0287951_54_413 119
193 3300053085 Ga0495619_0685936 Ga0495619_0685936_182_541 119
194 3300061719 Ga0466962_0000105 Ga0466962_0000105_33567_33926 119
195 3300061719 Ga0466962_0029367 Ga0466962_0029367_146_505 119
196 3300005441 Ga0070700_100266753 Ga0070700_1002667533 120
197 3300005444 Ga0070694_100761572 Ga0070694_1007615722 120
198 3300005455 Ga0070663_100252688 Ga0070663_1002526882 120
199 3300005457 Ga0070662_100874239 Ga0070662_1008742391 120
200 3300005543 Ga0070672_101351793 Ga0070672_1013517932 120
201 3300005564 Ga0070664_100560995 Ga0070664_1005609952 120
202 3300005577 Ga0068857_101395685 Ga0068857_1013956852 120
203 3300005718 Ga0068866_11098454 Ga0068866_110984541 120
204 3300006028 Ga0070717_11372518 Ga0070717_113725181 120
205 3300006881 Ga0068865_100134796 Ga0068865_1001347962 120
206 3300009093 Ga0105240_11815878 Ga0105240_118158781 120
207 3300009553 Ga0105249_11571431 Ga0105249_115714311 120
208 3300013307 Ga0157372_12074169 Ga0157372_120741692 120
209 3300014326 Ga0157380_10734164 Ga0157380_107341642 120
210 3300025899 Ga0207642_10147377 Ga0207642_101473772 120
211 3300025937 Ga0207669_10092304 Ga0207669_100923042 120
212 3300025940 Ga0207691_11003499 Ga0207691_110034992 120
213 3300025942 Ga0207689_10913483 Ga0207689_109134832 120
214 3300026067 Ga0207678_10114166 Ga0207678_101141662 120
215 3300026075 Ga0207708_10347572 Ga0207708_103475722 120
216 3300026118 Ga0207675_100121618 Ga0207675_1001216182 120
217 3300035089 Ga0373944_0011782 Ga0373944_0011782_785_1147 120
218 3300035113 Ga0373936_0005922 Ga0373936_0005922_80_442 120
219 3300035116 Ga0373945_0013562 Ga0373945_0013562_1831_2193 120
220 3300035170 Ga0373943_0001870 Ga0373943_0001870_5008_5370 120
221 3300035171 Ga0373946_0099197 Ga0373946_0099197_350_712 120
222 3300035692 Ga0373935_0290350 Ga0373935_0290350_101_463 120
223 3300035695 Ga0373927_0057432 Ga0373927_0057432_600_962 120
224 3300035725 Ga0373947_0001603 Ga0373947_0001603_1038_1400 120
225 3300037068 Ga0373925_0003779 Ga0373925_0003779_6390_6752 120
226 3300037853 Ga0436364_0797465 Ga0436364_0797465_126_488 120
227 3300039437 Ga0436365_0617675 Ga0436365_0617675_307_669 120
228 3300046455 Ga0495603_0139198 Ga0495603_0139198_148_519 120
229 3300046459 Ga0495629_0214146 Ga0495629_0214146_145_516 120
230 3300046461 Ga0495641_0007981 Ga0495641_0007981_2888_3259 120
231 3300046461 Ga0495641_0037912 Ga0495641_0037912_105_467 120
232 3300046473 Ga0495582_0026394 Ga0495582_0026394_1902_2264 120
233 3300046514 Ga0495618_0097822 Ga0495618_0097822_422_793 120
234 3300046523 Ga0495644_0076585 Ga0495644_0076585_508_876 120
235 3300046529 Ga0495652_0119212 Ga0495652_0119212_70_438 120
236 3300046533 Ga0495640_0217397 Ga0495640_0217397_10_372 120
237 3300046559 Ga0495667_0075954 Ga0495667_0075954_998_1369 120
238 3300046675 Ga0495657_0465056 Ga0495657_0465056_16_393 120
239 3300046683 Ga0495658_0006615 Ga0495658_0006615_5303_5665 120
240 3300046683 Ga0495658_0168629 Ga0495658_0168629_26_397 120
241 3300046689 Ga0495613_0061728 Ga0495613_0061728_1030_1401 120
242 3300046690 Ga0495624_0087919 Ga0495624_0087919_1131_1502 120
243 3300046794 Ga0495589_0066918 Ga0495589_0066918_778_1146 120
244 3300047315 Ga0495581_0573969 Ga0495581_0573969_129_500 120
245 3300047315 Ga0495581_0638142 Ga0495581_0638142_89_451 120
246 3300047317 Ga0495604_0177834 Ga0495604_0177834_892_1263 120
247 3300047321 Ga0495676_0025046 Ga0495676_0025046_3179_3541 120
248 3300047322 Ga0495680_0079659 Ga0495680_0079659_2026_2397 120
249 3300047471 Ga0495684_0165220 Ga0495684_0165220_784_1155 120
250 3300048089 Ga0495614_0648780 Ga0495614_0648780_56_433 120
251 3300048904 Ga0496101_0624448 Ga0496101_0624448_69_446 120
252 3300048905 Ga0496102_0201699 Ga0496102_0201699_315_692 120
253 3300048911 Ga0496108_0613934 Ga0496108_0613934_110_484 120
254 3300048912 Ga0496109_0542677 Ga0496109_0542677_174_545 120
255 3300049822 Ga0501035_0467927 Ga0501035_0467927_398_760 120
256 3300005327 Ga0070658_11069392 Ga0070658_110693922 121
257 3300005330 Ga0070690_100025002 Ga0070690_1000250023 121
258 3300005347 Ga0070668_100806807 Ga0070668_1008068072 121
259 3300005355 Ga0070671_100278121 Ga0070671_1002781212 121
260 3300005535 Ga0070684_100084842 Ga0070684_1000848422 121
261 3300005548 Ga0070665_100365340 Ga0070665_1003653402 121
262 3300009093 Ga0105240_10484504 Ga0105240_104845042 121
263 3300013105 Ga0157369_10086544 Ga0157369_100865443 121
264 3300020081 Ga0206354_10271135 Ga0206354_102711353 121
265 3300020082 Ga0206353_10713789 Ga0206353_107137893 121
266 3300025909 Ga0207705_10202139 Ga0207705_102021392 121
267 3300025931 Ga0207644_10192079 Ga0207644_101920792 121
268 3300025961 Ga0207712_10250316 Ga0207712_102503162 121
269 3300025972 Ga0207668_10725039 Ga0207668_107250392 121
270 3300031250 Ga0265331_10261198 Ga0265331_102611982 121
271 3300036401 Ga0373937_1097660 Ga0373937_1097660_366_731 121
272 3300042156 Ga0439446_0261423 Ga0439446_0261423_12_416 121
273 3300044694 Ga0466963_0212888 Ga0466963_0212888_453_821 121
274 3300044842 Ga0466957_0268642 Ga0466957_0268642_149_523 121
275 3300045836 Ga0466958_0777631 Ga0466958_0777631_85_459 121
276 3300046517 Ga0495630_0770255 Ga0495630_0770255_284_649 121
277 3300048903 Ga0496100_0068152 Ga0496100_0068152_1505_1870 121
278 3300048904 Ga0496101_0058606 Ga0496101_0058606_1928_2293 121
279 3300048905 Ga0496102_0014636 Ga0496102_0014636_1781_2146 121
280 3300048906 Ga0496103_0015857 Ga0496103_0015857_530_895 121
281 3300048907 Ga0496104_1730375 Ga0496104_1730375_47_412 121
282 3300048908 Ga0496105_0111269 Ga0496105_0111269_115_480 121
283 3300048910 Ga0496107_0022301 Ga0496107_0022301_2016_2381 121
284 3300048912 Ga0496109_0006160 Ga0496109_0006160_4172_4537 121
285 3300048913 Ga0496110_0360068 Ga0496110_0360068_855_1220 121
286 3300048916 Ga0496113_0015242 Ga0496113_0015242_94_459 121
287 3300048917 Ga0496114_0051825 Ga0496114_0051825_1548_1913 121
288 3300048918 Ga0496115_0014541 Ga0496115_0014541_48_413 121
289 3300049572 Ga0501036_0427795 Ga0501036_0427795_111_488 121
290 3300049575 Ga0501039_0609430 Ga0501039_0609430_412_789 121
291 3300049578 Ga0501042_0844983 Ga0501042_0844983_18_395 121
292 3300049587 Ga0501071_0877497 Ga0501071_0877497_97_474 121
293 3300049591 Ga0501075_1383519 Ga0501075_1383519_97_474 121
294 3300049741 Ga0501079_1050191 Ga0501079_1050191_91_483 121
295 3300053077 Ga0495601_0150970 Ga0495601_0150970_191_562 121

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

5

118

0.83

PF18029

Glyoxalase_6

Glyoxalase-like domain

16

119

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qqz-assembly1.cif.gz_B crystal structure of putative glyoxalase family protein from bacillus anthracis 0.9568 1 120
2qqz-assembly1.cif.gz_B crystal structure of putative glyoxalase family protein from bacillus anthracis 0.9416 1 120
3kol-assembly1.cif.gz_A-2 crystal structure of a glyoxalase/dioxygenase from nostoc punctiforme 0.8101 4 121
4nb2-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.89 angstrom resolution - apo structure 0.8059 1 120
2p7q-assembly4.cif.gz_A crystal structure of e126q mutant of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes complexed with mn(ii) and 1s,2s-dihydroxypropylphosphonic acid 0.8036 2 120
ID Description Score Start End Superfamily
2qqzB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.961 7 120 3.10.180.10
2qqzB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9527 7 120 3.10.180.10
af_Q0D8H0_68_188_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8409 4 119 3.10.180.10
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8269 66 118 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8198 70 121 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A5B8UCN4-F1-model_v4 Glyoxalase 0.9923 1 121
AF-A0A7W1LFJ7-F1-model_v4 VOC family protein 0.9884 2 121
AF-A0A5J5GFH5-F1-model_v4 Glyoxalase 0.9869 7 121
AF-A0A563E8M9-F1-model_v4 Methyltransferase domain-containing protein 0.986 3 119 GO:0030798
GO:0032259
AF-A0A2W4MJ58-F1-model_v4 Glyoxalase 0.9853 3 118

Feature Viewer

pLDDT pTM Quality
96.27 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map