F392466

General Info

Members Datasets Scaffolds Average Seq Length
295 154 590 218

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100524306|Ga0070670_1005243061
Length 254
Sequence MLDWGYDTKPANAALDTHARHKGFGSQPNGVILTHNVSPMAKYLDLKKWNRRDVFEFFRAFDKPYFNVCTQLDITQLLTALTGRGVSVSLAYHYFALRAANEIEPFRYRLKDGQVIVYDVIHGGTTVLLPSEIFTLTYFEYEPSFKKFMAGAELAMKEAVSGDGAFRPNPRDDMIHFTTLPWVSFTSFSHARNWGREDSVPKIAFGKFMKENGRTLLPFSVEVHHALMDGLHVGRYVACLEEALRNPETFLSEE

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
136 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
137 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
138 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
139 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
140 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
141 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
142 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
143 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
144 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
145 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
146 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
147 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
150 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
151 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
152 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
153 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
154 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.34
Nodule 0
Rhizoplane 1.02
Rhizosphere 97.97
Stem 0
Stem Tuber 0
Unclassified 22.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100524306 3300005331 Bacteria 1055
2 SwRhRL2b_contig_558374 2162886007 Unclassified 866
3 JGI24748J21848_1000014 3300002074 Bacteria 147126
4 JGI24034J26672_10000012 3300002239 Bacteria 146139
5 Ga0065704_10006061 3300005289 Bacteria 3161
6 Ga0065704_10271979 3300005289 Unclassified 941
7 Ga0065712_10272144 3300005290 Bacteria 913
8 Ga0065715_10002541 3300005293 Bacteria 11566
9 Ga0065715_10114851 3300005293 Unclassified 2436
10 Ga0065715_10259170 3300005293 Bacteria 1143
11 Ga0065715_10374965 3300005293 Bacteria 915
12 Ga0065707_10003847 3300005295 Unclassified 3684
13 Ga0065707_10291522 3300005295 Bacteria 1024
14 Ga0070676_10532645 3300005328 Unclassified 838
15 Ga0070683_100262421 3300005329 Bacteria 1643
16 Ga0070690_100704169 3300005330 Bacteria 776
17 Ga0070670_100004391 3300005331 Bacteria 11809
18 Ga0070670_100074177 3300005331 Unclassified 2922
19 Ga0070670_100256097 3300005331 Bacteria 1525
20 Ga0068869_100006109 3300005334 Bacteria 7619
21 Ga0068869_100114010 3300005334 Bacteria 2060
22 Ga0070666_10139999 3300005335 Bacteria 1685
23 Ga0070666_10476690 3300005335 Unclassified 903
24 Ga0070680_100007853 3300005336 Bacteria 8135
25 Ga0068868_100058488 3300005338 Bacteria 3047
26 Ga0070689_100003875 3300005340 Bacteria 10028
27 Ga0070689_100048152 3300005340 Unclassified 3287
28 Ga0070661_100102482 3300005344 Bacteria 2131
29 Ga0070669_100011687 3300005353 Bacteria 6228
30 Ga0070669_100141643 3300005353 Bacteria 1854
31 Ga0070669_100142119 3300005353 Bacteria 1851
32 Ga0070671_100053161 3300005355 Bacteria 3367
33 Ga0070671_100255551 3300005355 Bacteria 1489
34 Ga0070674_100472403 3300005356 Bacteria 1039
35 Ga0070673_100085437 3300005364 Bacteria 2569
36 Ga0070673_100107258 3300005364 Unclassified 2310
37 Ga0070688_100144659 3300005365 Bacteria 1619
38 Ga0070659_100000547 3300005366 Bacteria 27443
39 Ga0070701_10035851 3300005438 Unclassified 2495
40 Ga0070705_100050848 3300005440 Bacteria 2413
41 Ga0070705_100051939 3300005440 Unclassified 2393
42 Ga0070700_100079324 3300005441 Unclassified 2116
43 Ga0070700_100280429 3300005441 Unclassified 1208
44 Ga0070700_100577786 3300005441 Bacteria 877
45 Ga0070694_100001750 3300005444 Bacteria 12820
46 Ga0070694_100304835 3300005444 Bacteria 1222
47 Ga0070694_100337362 3300005444 Bacteria 1164
48 Ga0070708_100114357 3300005445 Bacteria 2483
49 Ga0070662_100289530 3300005457 Bacteria 1327
50 Ga0070681_10159007 3300005458 Bacteria 2183
51 Ga0068867_100054366 3300005459 Bacteria 2958
52 Ga0068867_100208325 3300005459 Bacteria 1569
53 Ga0068867_100670030 3300005459 Bacteria 912
54 Ga0068867_100991082 3300005459 Bacteria 761
55 Ga0070706_100023188 3300005467 Bacteria 5716
56 Ga0070707_100377567 3300005468 Bacteria 1377
57 Ga0070707_100498126 3300005468 Bacteria 1180
58 Ga0070707_100958179 3300005468 Unclassified 821
59 Ga0070698_100017034 3300005471 Bacteria 7661
60 Ga0070698_100058822 3300005471 Bacteria 3884
61 Ga0070698_100149271 3300005471 Unclassified 2286
62 Ga0070698_100267836 3300005471 Bacteria 1640
63 Ga0070698_100592006 3300005471 Bacteria 1049
64 Ga0070699_100088415 3300005518 Bacteria 2706
65 Ga0070699_100122956 3300005518 Unclassified 2283
66 Ga0070699_100410828 3300005518 Bacteria 1224
67 Ga0070699_100462524 3300005518 Bacteria 1151
68 Ga0070699_100577692 3300005518 Bacteria 1024
69 Ga0070679_100252198 3300005530 Unclassified 1721
70 Ga0070684_100159915 3300005535 Bacteria 2043
71 Ga0070697_100000150 3300005536 Bacteria 56876
72 Ga0070697_100000619 3300005536 Bacteria 27010
73 Ga0070697_100226027 3300005536 Bacteria 1595
74 Ga0070697_100496961 3300005536 Unclassified 1066
75 Ga0070697_100517850 3300005536 Bacteria 1044
76 Ga0068853_100219583 3300005539 Bacteria 1736
77 Ga0070672_100060009 3300005543 Bacteria 2994
78 Ga0070695_100373442 3300005545 Bacteria 1074
79 Ga0070695_100472657 3300005545 Unclassified 965
80 Ga0070696_100033941 3300005546 Bacteria 3508
81 Ga0070696_100078094 3300005546 Bacteria 2340
82 Ga0070693_100247432 3300005547 Bacteria 1180
83 Ga0070665_100424509 3300005548 Bacteria 1338
84 Ga0070704_100159578 3300005549 Bacteria 1782
85 Ga0070704_100472217 3300005549 Bacteria 1084
86 Ga0070704_101043240 3300005549 Bacteria 741
87 Ga0068855_101292638 3300005563 Bacteria 755
88 Ga0070664_100085861 3300005564 Bacteria 2718
89 Ga0070664_100231730 3300005564 Unclassified 1655
90 Ga0068857_100001782 3300005577 Bacteria 17322
91 Ga0068854_100100153 3300005578 Bacteria 2171
92 Ga0070702_100373857 3300005615 Unclassified 1011
93 Ga0068852_100498419 3300005616 Unclassified 1212
94 Ga0068859_100033852 3300005617 Bacteria 5130
95 Ga0068859_100035376 3300005617 Bacteria 5012
96 Ga0068859_100097508 3300005617 Bacteria 2993
97 Ga0068859_100134279 3300005617 Unclassified 2546
98 Ga0068859_101120245 3300005617 Bacteria 866
99 Ga0068864_100005314 3300005618 Bacteria 10547
100 Ga0068864_100709052 3300005618 Bacteria 983
101 Ga0068864_100882930 3300005618 Bacteria 882
102 Ga0068861_100018378 3300005719 Bacteria 4981
103 Ga0068861_100018602 3300005719 Unclassified 4951
104 Ga0068861_100022846 3300005719 Bacteria 4509
105 Ga0068861_100461409 3300005719 Bacteria 1140
106 Ga0068870_10235457 3300005840 Bacteria 1128
107 Ga0068863_100380132 3300005841 Unclassified 1379
108 Ga0068863_100890043 3300005841 Unclassified 890
109 Ga0068858_100000602 3300005842 Bacteria 37601
110 Ga0068858_100025598 3300005842 Bacteria 5490
111 Ga0068858_100541042 3300005842 Bacteria 1127
112 Ga0068862_100123545 3300005844 Viruses 2284
113 Ga0068862_100765538 3300005844 Unclassified 940
114 Ga0070715_10000013 3300006163 Bacteria 155405
115 Ga0075366_10077999 3300006195 Bacteria 1977
116 Ga0097621_100023314 3300006237 Bacteria 4817
117 Ga0097621_100315083 3300006237 Bacteria 1384
118 Ga0097621_100424082 3300006237 Unclassified 1194
119 Ga0068871_100106900 3300006358 Bacteria 2349
120 Ga0075428_101228612 3300006844 Unclassified 789
121 Ga0075433_10009563 3300006852 Bacteria 7752
122 Ga0075433_10023376 3300006852 Bacteria 5202
123 Ga0075433_10153690 3300006852 Unclassified 2047
124 Ga0075434_100027748 3300006871 Bacteria 5559
125 Ga0075434_100420914 3300006871 Bacteria 1357
126 Ga0075429_100472261 3300006880 Unclassified 1099
127 Ga0075429_100926253 3300006880 Unclassified 762
128 Ga0068865_100294772 3300006881 Bacteria 1296
129 Ga0068865_100385382 3300006881 Bacteria 1144
130 Ga0097620_100033851 3300006931 Bacteria 5130
131 Ga0097620_100035377 3300006931 Bacteria 5012
132 Ga0097620_100097510 3300006931 Bacteria 2993
133 Ga0097620_100134283 3300006931 Unclassified 2546
134 Ga0097620_101120282 3300006931 Bacteria 866
135 Ga0111539_10003562 3300009094 Bacteria 20524
136 Ga0111539_10013522 3300009094 Bacteria 10201
137 Ga0105245_10114446 3300009098 Bacteria 2512
138 Ga0105245_10288614 3300009098 Bacteria 1606
139 Ga0105247_10000050 3300009101 Bacteria 146183
140 Ga0105247_10232061 3300009101 Bacteria 1254
141 Ga0114129_10056917 3300009147 Bacteria 5474
142 Ga0114129_10334072 3300009147 Bacteria 2011
143 Ga0114129_10538803 3300009147 Unclassified 1519
144 Ga0114129_10909021 3300009147 Bacteria 1115
145 Ga0105243_10000029 3300009148 Bacteria 190577
146 Ga0105243_10002136 3300009148 Bacteria 16718
147 Ga0105243_10894247 3300009148 Bacteria 883
148 Ga0105241_10581525 3300009174 Bacteria 1009
149 Ga0105242_10000009 3300009176 Bacteria 162286
150 Ga0105242_10000581 3300009176 Bacteria 28877
151 Ga0105242_10249756 3300009176 Bacteria 1598
152 Ga0105248_10019517 3300009177 Bacteria 7502
153 Ga0105248_10070691 3300009177 Bacteria 3919
154 Ga0105248_10754945 3300009177 Bacteria 1098
155 Ga0105249_10042422 3300009553 Viruses 4137
156 Ga0105249_10066841 3300009553 Unclassified 3311
157 Ga0105249_10376435 3300009553 Unclassified 1445
158 Ga0105239_10095549 3300010375 Bacteria 3283
159 Ga0105246_10265528 3300011119 Bacteria 1369
160 Ga0105246_10308246 3300011119 Bacteria 1281
161 Ga0157371_10256484 3300013102 Unclassified 1260
162 Ga0157374_10098349 3300013296 Bacteria 2802
163 Ga0157374_10814446 3300013296 Unclassified 950
164 Ga0157378_10000047 3300013297 Bacteria 104964
165 Ga0157378_10031033 3300013297 Bacteria 4720
166 Ga0157378_10050276 3300013297 Bacteria 3709
167 Ga0157378_10105312 3300013297 Bacteria 2579
168 Ga0157378_10285525 3300013297 Bacteria 1592
169 Ga0157378_10308249 3300013297 Unclassified 1534
170 Ga0157378_10928494 3300013297 Bacteria 902
171 Ga0163162_10005466 3300013306 Bacteria 12278
172 Ga0163162_10014809 3300013306 Bacteria 7616
173 Ga0163162_10153753 3300013306 Unclassified 2419
174 Ga0163162_10282988 3300013306 Unclassified 1790
175 Ga0157372_10026340 3300013307 Bacteria 6327
176 Ga0157372_11314809 3300013307 Bacteria 834
177 Ga0157375_10004211 3300013308 Bacteria 12479
178 Ga0157375_10014768 3300013308 Bacteria 6979
179 Ga0157375_10065651 3300013308 Bacteria 3618
180 Ga0157375_11735976 3300013308 Unclassified 739
181 Ga0163163_10016828 3300014325 Bacteria 6805
182 Ga0163163_10018341 3300014325 Bacteria 6549
183 Ga0163163_10024621 3300014325 Bacteria 5730
184 Ga0163163_10052929 3300014325 Unclassified 4007
185 Ga0163163_10056556 3300014325 Unclassified 3877
186 Ga0157380_10001644 3300014326 Bacteria 14722
187 Ga0157380_10652905 3300014326 Bacteria 1050
188 Ga0157377_10357146 3300014745 Bacteria 982
189 Ga0157376_10203867 3300014969 Bacteria 1822
190 Ga0157376_10537006 3300014969 Bacteria 1155
191 Ga0207672_1000326 3300025223 Bacteria 6361
192 Ga0207697_10109160 3300025315 Unclassified 1184
193 Ga0207642_10073517 3300025899 Bacteria 1635
194 Ga0207710_10000003 3300025900 Bacteria 1071597
195 Ga0207685_10000013 3300025905 Bacteria 186374
196 Ga0207643_10154826 3300025908 Bacteria 1376
197 Ga0207643_10252484 3300025908 Bacteria 1087
198 Ga0207684_10037108 3300025910 Bacteria 4136
199 Ga0207662_10087612 3300025918 Unclassified 1910
200 Ga0207649_10041418 3300025920 Bacteria 2803
201 Ga0207652_10261037 3300025921 Bacteria 1562
202 Ga0207646_10081776 3300025922 Bacteria 2888
203 Ga0207646_10215638 3300025922 Bacteria 1734
204 Ga0207646_10454398 3300025922 Unclassified 1156
205 Ga0207681_10003344 3300025923 Bacteria 10035
206 Ga0207681_10126739 3300025923 Bacteria 1881
207 Ga0207650_10001186 3300025925 Bacteria 19153
208 Ga0207650_10394059 3300025925 Bacteria 1145
209 Ga0207659_10167970 3300025926 Bacteria 1728
210 Ga0207659_10303127 3300025926 Bacteria 1313
211 Ga0207644_10002180 3300025931 Bacteria 12701
212 Ga0207706_10028876 3300025933 Bacteria 4951
213 Ga0207706_10226395 3300025933 Bacteria 1636
214 Ga0207686_10000010 3300025934 Bacteria 227471
215 Ga0207686_10000496 3300025934 Bacteria 25802
216 Ga0207686_10494127 3300025934 Bacteria 948
217 Ga0207709_10000052 3300025935 Bacteria 227471
218 Ga0207709_10001154 3300025935 Bacteria 19226
219 Ga0207709_10221342 3300025935 Bacteria 1365
220 Ga0207670_10173453 3300025936 Bacteria 1619
221 Ga0207704_10101545 3300025938 Bacteria 1919
222 Ga0207704_10328949 3300025938 Bacteria 1182
223 Ga0207711_10031018 3300025941 Bacteria 4510
224 Ga0207711_10557062 3300025941 Bacteria 1069
225 Ga0207689_10003115 3300025942 Bacteria 15213
226 Ga0207689_10020330 3300025942 Bacteria 5590
227 Ga0207689_10023115 3300025942 Bacteria 5221
228 Ga0207689_10032691 3300025942 Bacteria 4325
229 Ga0207689_10069274 3300025942 Bacteria 2898
230 Ga0207667_10624792 3300025949 Bacteria 1085
231 Ga0207651_10109338 3300025960 Bacteria 2071
232 Ga0207712_10028066 3300025961 Unclassified 3763
233 Ga0207640_10038021 3300025981 Bacteria 3033
234 Ga0207640_10435291 3300025981 Unclassified 1077
235 Ga0207677_10120480 3300026023 Unclassified 1973
236 Ga0207677_10652388 3300026023 Bacteria 929
237 Ga0207703_10000355 3300026035 Bacteria 49221
238 Ga0207703_10573854 3300026035 Bacteria 1065
239 Ga0207639_10855123 3300026041 Unclassified 849
240 Ga0207708_10005373 3300026075 Bacteria 9439
241 Ga0207708_10267875 3300026075 Bacteria 1381
242 Ga0207641_10014135 3300026088 Bacteria 6543
243 Ga0207641_10876817 3300026088 Unclassified 890
244 Ga0207641_10919729 3300026088 Bacteria 869
245 Ga0207648_10145194 3300026089 Unclassified 2093
246 Ga0207648_10174285 3300026089 Bacteria 1902
247 Ga0207648_11033310 3300026089 Bacteria 770
248 Ga0207676_10033672 3300026095 Bacteria 3872
249 Ga0207674_10000113 3300026116 Bacteria 93918
250 Ga0207675_100005270 3300026118 Bacteria 12439
251 Ga0207675_100058463 3300026118 Bacteria 3597
252 Ga0207675_100194721 3300026118 Unclassified 1945
253 Ga0207675_100270292 3300026118 Viruses 1650
254 Ga0207675_100623976 3300026118 Bacteria 1083
255 Ga0207675_100644827 3300026118 Bacteria 1065
256 Ga0207428_10013998 3300027907 Bacteria 6987
257 Ga0207428_10227934 3300027907 Bacteria 1395
258 Ga0207428_10313467 3300027907 Bacteria 1159
259 Ga0268266_10360833 3300028379 Bacteria 1367
260 Ga0268265_10027247 3300028380 Viruses 4076
261 Ga0268265_10037242 3300028380 Unclassified 3569
262 Ga0268264_10473291 3300028381 Unclassified 1217
263 Ga0307515_10000013 3300028794 Bacteria 568456
264 Ga0307515_10055158 3300028794 Bacteria 5814
265 Ga0307416_100082777 3300032002 Bacteria 2720
266 Ga0373937_0198853 3300036401 Bacteria 1884
267 Ga0395900_0130221 3300037418 Bacteria 2579
268 Ga0395898_0253793 3300037466 Bacteria 1677
269 Ga0395898_0744962 3300037466 Bacteria 921
270 Ga0395905_0150754 3300037471 Bacteria 2188
271 Ga0242420_020218 3300038996 Bacteria 1183
272 Ga0451577_0255411 3300042876 Bacteria 1587
273 Ga0495598_0038173 3300046537 Unclassified 1390
274 Ga0495621_0000061 3300046539 Bacteria 20947
275 Ga0495621_0004009 3300046539 Unclassified 4097
276 Ga0495621_0009674 3300046539 Bacteria 2935
277 Ga0495659_0011920 3300046664 Bacteria 2805
278 Ga0495658_0138688 3300046683 Bacteria 1486
279 Ga0495670_0313176 3300046691 Unclassified 842
280 Ga0495636_0006345 3300047318 Bacteria 4645
281 Ga0496100_0351656 3300048903 Unclassified 1113
282 Ga0496106_0008715 3300048909 Bacteria 7502
283 Ga0496114_0334444 3300048917 Bacteria 1339
284 Ga0501075_0318020 3300049591 Unclassified 1186
285 Ga0501079_0422494 3300049741 Unclassified 1046
286 nmdc:mga05p37_15693_c1 3300050507 Bacteria 9104
287 nmdc:mga09592_102825_c1 3300050508 Viruses 2448
288 nmdc:mga08y16_108896_c1 3300050511 Unclassified 2885
289 nmdc:mga08y16_405465_c1 3300050511 Unclassified 1395
290 nmdc:mga0n895_343699_c1 3300050512 Bacteria 1511
291 nmdc:mga0n895_79199_c1 3300050512 Bacteria 3272
292 nmdc:mga0a205_6627_c1 3300050515 Bacteria 6819
293 nmdc:mga0a205_72624_c1 3300050515 Unclassified 3324
294 Ga0501084_0518662 3300054114 Unclassified 1007
295 Ga0501082_0585527 3300060353 Unclassified 976
296 Ga0070670_100524306
297 SwRhRL2b_contig_558374
298 JGI24748J21848_1000014
299 JGI24034J26672_10000012
300 Ga0065704_10006061
301 Ga0065704_10271979
302 Ga0065712_10272144
303 Ga0065715_10002541
304 Ga0065715_10114851
305 Ga0065715_10259170
306 Ga0065715_10374965
307 Ga0065707_10003847
308 Ga0065707_10291522
309 Ga0070676_10532645
310 Ga0070683_100262421
311 Ga0070690_100704169
312 Ga0070670_100004391
313 Ga0070670_100074177
314 Ga0070670_100256097
315 Ga0068869_100006109
316 Ga0068869_100114010
317 Ga0070666_10139999
318 Ga0070666_10476690
319 Ga0070680_100007853
320 Ga0068868_100058488
321 Ga0070689_100003875
322 Ga0070689_100048152
323 Ga0070661_100102482
324 Ga0070669_100011687
325 Ga0070669_100141643
326 Ga0070669_100142119
327 Ga0070671_100053161
328 Ga0070671_100255551
329 Ga0070674_100472403
330 Ga0070673_100085437
331 Ga0070673_100107258
332 Ga0070688_100144659
333 Ga0070659_100000547
334 Ga0070701_10035851
335 Ga0070705_100050848
336 Ga0070705_100051939
337 Ga0070700_100079324
338 Ga0070700_100280429
339 Ga0070700_100577786
340 Ga0070694_100001750
341 Ga0070694_100304835
342 Ga0070694_100337362
343 Ga0070708_100114357
344 Ga0070662_100289530
345 Ga0070681_10159007
346 Ga0068867_100054366
347 Ga0068867_100208325
348 Ga0068867_100670030
349 Ga0068867_100991082
350 Ga0070706_100023188
351 Ga0070707_100377567
352 Ga0070707_100498126
353 Ga0070707_100958179
354 Ga0070698_100017034
355 Ga0070698_100058822
356 Ga0070698_100149271
357 Ga0070698_100267836
358 Ga0070698_100592006
359 Ga0070699_100088415
360 Ga0070699_100122956
361 Ga0070699_100410828
362 Ga0070699_100462524
363 Ga0070699_100577692
364 Ga0070679_100252198
365 Ga0070684_100159915
366 Ga0070697_100000150
367 Ga0070697_100000619
368 Ga0070697_100226027
369 Ga0070697_100496961
370 Ga0070697_100517850
371 Ga0068853_100219583
372 Ga0070672_100060009
373 Ga0070695_100373442
374 Ga0070695_100472657
375 Ga0070696_100033941
376 Ga0070696_100078094
377 Ga0070693_100247432
378 Ga0070665_100424509
379 Ga0070704_100159578
380 Ga0070704_100472217
381 Ga0070704_101043240
382 Ga0068855_101292638
383 Ga0070664_100085861
384 Ga0070664_100231730
385 Ga0068857_100001782
386 Ga0068854_100100153
387 Ga0070702_100373857
388 Ga0068852_100498419
389 Ga0068859_100033852
390 Ga0068859_100035376
391 Ga0068859_100097508
392 Ga0068859_100134279
393 Ga0068859_101120245
394 Ga0068864_100005314
395 Ga0068864_100709052
396 Ga0068864_100882930
397 Ga0068861_100018378
398 Ga0068861_100018602
399 Ga0068861_100022846
400 Ga0068861_100461409
401 Ga0068870_10235457
402 Ga0068863_100380132
403 Ga0068863_100890043
404 Ga0068858_100000602
405 Ga0068858_100025598
406 Ga0068858_100541042
407 Ga0068862_100123545
408 Ga0068862_100765538
409 Ga0070715_10000013
410 Ga0075366_10077999
411 Ga0097621_100023314
412 Ga0097621_100315083
413 Ga0097621_100424082
414 Ga0068871_100106900
415 Ga0075428_101228612
416 Ga0075433_10009563
417 Ga0075433_10023376
418 Ga0075433_10153690
419 Ga0075434_100027748
420 Ga0075434_100420914
421 Ga0075429_100472261
422 Ga0075429_100926253
423 Ga0068865_100294772
424 Ga0068865_100385382
425 Ga0097620_100033851
426 Ga0097620_100035377
427 Ga0097620_100097510
428 Ga0097620_100134283
429 Ga0097620_101120282
430 Ga0111539_10003562
431 Ga0111539_10013522
432 Ga0105245_10114446
433 Ga0105245_10288614
434 Ga0105247_10000050
435 Ga0105247_10232061
436 Ga0114129_10056917
437 Ga0114129_10334072
438 Ga0114129_10538803
439 Ga0114129_10909021
440 Ga0105243_10000029
441 Ga0105243_10002136
442 Ga0105243_10894247
443 Ga0105241_10581525
444 Ga0105242_10000009
445 Ga0105242_10000581
446 Ga0105242_10249756
447 Ga0105248_10019517
448 Ga0105248_10070691
449 Ga0105248_10754945
450 Ga0105249_10042422
451 Ga0105249_10066841
452 Ga0105249_10376435
453 Ga0105239_10095549
454 Ga0105246_10265528
455 Ga0105246_10308246
456 Ga0157371_10256484
457 Ga0157374_10098349
458 Ga0157374_10814446
459 Ga0157378_10000047
460 Ga0157378_10031033
461 Ga0157378_10050276
462 Ga0157378_10105312
463 Ga0157378_10285525
464 Ga0157378_10308249
465 Ga0157378_10928494
466 Ga0163162_10005466
467 Ga0163162_10014809
468 Ga0163162_10153753
469 Ga0163162_10282988
470 Ga0157372_10026340
471 Ga0157372_11314809
472 Ga0157375_10004211
473 Ga0157375_10014768
474 Ga0157375_10065651
475 Ga0157375_11735976
476 Ga0163163_10016828
477 Ga0163163_10018341
478 Ga0163163_10024621
479 Ga0163163_10052929
480 Ga0163163_10056556
481 Ga0157380_10001644
482 Ga0157380_10652905
483 Ga0157377_10357146
484 Ga0157376_10203867
485 Ga0157376_10537006
486 Ga0207672_1000326
487 Ga0207697_10109160
488 Ga0207642_10073517
489 Ga0207710_10000003
490 Ga0207685_10000013
491 Ga0207643_10154826
492 Ga0207643_10252484
493 Ga0207684_10037108
494 Ga0207662_10087612
495 Ga0207649_10041418
496 Ga0207652_10261037
497 Ga0207646_10081776
498 Ga0207646_10215638
499 Ga0207646_10454398
500 Ga0207681_10003344
501 Ga0207681_10126739
502 Ga0207650_10001186
503 Ga0207650_10394059
504 Ga0207659_10167970
505 Ga0207659_10303127
506 Ga0207644_10002180
507 Ga0207706_10028876
508 Ga0207706_10226395
509 Ga0207686_10000010
510 Ga0207686_10000496
511 Ga0207686_10494127
512 Ga0207709_10000052
513 Ga0207709_10001154
514 Ga0207709_10221342
515 Ga0207670_10173453
516 Ga0207704_10101545
517 Ga0207704_10328949
518 Ga0207711_10031018
519 Ga0207711_10557062
520 Ga0207689_10003115
521 Ga0207689_10020330
522 Ga0207689_10023115
523 Ga0207689_10032691
524 Ga0207689_10069274
525 Ga0207667_10624792
526 Ga0207651_10109338
527 Ga0207712_10028066
528 Ga0207640_10038021
529 Ga0207640_10435291
530 Ga0207677_10120480
531 Ga0207677_10652388
532 Ga0207703_10000355
533 Ga0207703_10573854
534 Ga0207639_10855123
535 Ga0207708_10005373
536 Ga0207708_10267875
537 Ga0207641_10014135
538 Ga0207641_10876817
539 Ga0207641_10919729
540 Ga0207648_10145194
541 Ga0207648_10174285
542 Ga0207648_11033310
543 Ga0207676_10033672
544 Ga0207674_10000113
545 Ga0207675_100005270
546 Ga0207675_100058463
547 Ga0207675_100194721
548 Ga0207675_100270292
549 Ga0207675_100623976
550 Ga0207675_100644827
551 Ga0207428_10013998
552 Ga0207428_10227934
553 Ga0207428_10313467
554 Ga0268266_10360833
555 Ga0268265_10027247
556 Ga0268265_10037242
557 Ga0268264_10473291
558 Ga0307515_10000013
559 Ga0307515_10055158
560 Ga0307416_100082777
561 Ga0373937_0198853
562 Ga0395900_0130221
563 Ga0395898_0253793
564 Ga0395898_0744962
565 Ga0395905_0150754
566 Ga0242420_020218
567 Ga0451577_0255411
568 Ga0495598_0038173
569 Ga0495621_0000061
570 Ga0495621_0004009
571 Ga0495621_0009674
572 Ga0495659_0011920
573 Ga0495658_0138688
574 Ga0495670_0313176
575 Ga0495636_0006345
576 Ga0496100_0351656
577 Ga0496106_0008715
578 Ga0496114_0334444
579 Ga0501075_0318020
580 Ga0501079_0422494
581 nmdc:mga05p37_15693_c1
582 nmdc:mga09592_102825_c1
583 nmdc:mga08y16_108896_c1
584 nmdc:mga08y16_405465_c1
585 nmdc:mga0n895_343699_c1
586 nmdc:mga0n895_79199_c1
587 nmdc:mga0a205_6627_c1
588 nmdc:mga0a205_72624_c1
589 Ga0501084_0518662
590 Ga0501082_0585527

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00302

CAT

Chloramphenicol acetyltransferase

40

241

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3u9b-assembly2.cif.gz_D structure of apo-cati 0.9258 2 208
1qca-assembly1.cif.gz_A quadruple mutant q92c, n146f, y168f, i172v type iii cat complexed with fusidic acid. crystals grown at ph 6.3. x-ray data collected at room temperature 0.9253 2 208
1cia-assembly1.cif.gz_A replacement of catalytic histidine-195 of chloramphenicol acetyltransferase: evidence for a general base role for glutamate 0.9241 2 206
4cla-assembly1.cif.gz_A alternative binding modes for chloramphenicol and 1-substituted chloramphenicol analogues revealed by site-directed mutagenesis and x-ray crystallography of chloramphenicol acetyltransferase 0.9236 2 206
3cla-assembly1.cif.gz_A refined crystal structure of type iii chloramphenicol acetyltransferase at 1.75 angstroms resolution 0.9231 2 206
ID Description Score Start End Superfamily
1qcaA00 Alpha Beta;2-Layer Sandwich;Chloramphenicol Acetyltransferase;Chloramphenicol acetyltransferase-like domain 0.9253 2 208 3.30.559.10
1qcaA00 Alpha Beta;2-Layer Sandwich;Chloramphenicol Acetyltransferase;Chloramphenicol acetyltransferase-like domain 0.9003 2 208 3.30.559.10
3u9fE00 Alpha Beta;2-Layer Sandwich;Chloramphenicol Acetyltransferase;Chloramphenicol acetyltransferase-like domain 0.8876 1 208 3.30.559.10
3u9fE00 Alpha Beta;2-Layer Sandwich;Chloramphenicol Acetyltransferase;Chloramphenicol acetyltransferase-like domain 0.8714 1 208 3.30.559.10
2i9dC00 Alpha Beta;2-Layer Sandwich;Chloramphenicol Acetyltransferase;Chloramphenicol acetyltransferase-like domain 0.8597 2 206 3.30.559.10
ID Description Score Start End GO Terms
AF-A0A7V9TXF0-F1-model_v4 Chloramphenicol acetyltransferase 0.9848 1 213 GO:0008811
AF-A0A7W1BZ42-F1-model_v4 Chloramphenicol acetyltransferase 0.9795 1 214 GO:0008811
AF-A0A7W1BZ42-F1-model_v4 Chloramphenicol acetyltransferase 0.975 1 214 GO:0008811
AF-A0A0C5VCC8-F1-model_v4 Chloramphenicol O-acetyltransferase (EC 2.3.1.28) 0.9735 3 208 GO:0008811
AF-A0A7V9TXF0-F1-model_v4 Chloramphenicol acetyltransferase 0.9712 1 213 GO:0008811

Map