F392355

General Info

Members Datasets Scaffolds Average Seq Length
294 164 588 576

Family's Representative Sequence

Representative Sequence 3300050511|nmdc:mga08y16_41637_c1|nmdc:mga08y16_41637_c1_26_2023
Length 625
Sequence MHAPRARLRAHPEGGDGMNGVMNRRLLFVFGPVTGLVMFACVVLIATFLTNREYKEPYRAPAATVDATPRVEGLVAEEADAAAKARATPYAEAEYRRFPVVGSRVAIWAVAELHLLFAAFVLAVPIFAFIIEAIGYKTGDLRYDRLAHEFTKLLSVSFSLTATFGAFAAFLYTYYYGWGKFHPLVHLGLVGTAIMLIANSWLTFMMSPRGVSDTGAVISVWEAVDNFTWMPINVHRVIANVAFGGSVAAAYAAFKFLQAETDEERAHYDWMGYIGNFVAISAFLPLPFAGYWLAKEIYAFSQTLGLTMMGGAFSWLFIIQAVLIGNLFLAANYYLWLGMGRVEGAQPLQKFIKYLLIGITLCFAVWATPRSIIATVSEVRAMGGSAHPILGFLGVMSAKNTAVNILILTTFMSFLLYRRTGKIATVAWAKMGHAAQLFIFAGVAIFVIFLGVYGYFVEATVRIGLSVPQVSSVLFAMVSITAIDVFLFRGAKYTGEVRWGRMPAISQYVLIFIAVTFTWLMGLMGYVRSGLRQHWHVYGVIRDTSPDAFTPTLGFATQVVSWTVLAFFLLIGFVFWITSLHDRPEYVPSPEKQKVAHTGVDMTLGGAMSPQPGAISHLEGRTGLP

Samples

Sample ID Description Type Environment
1 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
98 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
99 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
100 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
101 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
102 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
103 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
104 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
105 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
106 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
107 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
108 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
109 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
110 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
111 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
112 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
113 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
114 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
115 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
116 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
117 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
118 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
119 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
120 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
121 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
122 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
123 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
130 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
137 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
138 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
139 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
140 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
141 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
142 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
143 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
144 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
147 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
150 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
151 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
152 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
153 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
154 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
155 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
156 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
157 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
158 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
159 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
160 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
161 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
162 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
163 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
164 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.04
Nodule 0
Rhizoplane 4.42
Rhizosphere 93.54
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga08y16_41637_c1 3300050511 Bacteria 4811
2 JGI25406J46586_10006533 3300003203 Bacteria 5363
3 Ga0065714_10080451 3300005288 Bacteria 2439
4 Ga0065704_10005590 3300005289 Bacteria 3294
5 Ga0065712_10000492 3300005290 Bacteria 34346
6 Ga0065712_10068753 3300005290 Bacteria 9147
7 Ga0065715_10000537 3300005293 Bacteria 10762
8 Ga0065715_10011183 3300005293 Bacteria 2773
9 Ga0065707_10003742 3300005295 Bacteria 5996
10 Ga0065707_10014281 3300005295 Bacteria 2479
11 Ga0070683_100000649 3300005329 Bacteria 25103
12 Ga0070683_100083849 3300005329 Bacteria 2986
13 Ga0070670_100005615 3300005331 Bacteria 10585
14 Ga0068869_100002961 3300005334 Bacteria 10312
15 Ga0070666_10023128 3300005335 Bacteria 4042
16 Ga0070680_100035744 3300005336 Bacteria 4011
17 Ga0068868_100029582 3300005338 Bacteria 4196
18 Ga0070689_100005047 3300005340 Bacteria 8972
19 Ga0070689_100010500 3300005340 Bacteria 6601
20 Ga0070689_100037077 3300005340 Bacteria 3728
21 Ga0070687_100007721 3300005343 Bacteria 4508
22 Ga0070661_100018364 3300005344 Bacteria 4972
23 Ga0070669_100004127 3300005353 Bacteria 10539
24 Ga0070669_100016305 3300005353 Bacteria 5300
25 Ga0070675_100005671 3300005354 Bacteria 9561
26 Ga0070671_100038742 3300005355 Bacteria 3955
27 Ga0070671_100069286 3300005355 Bacteria 2942
28 Ga0070673_100004325 3300005364 Bacteria 8972
29 Ga0070688_100032007 3300005365 Bacteria 3168
30 Ga0070701_10011816 3300005438 Bacteria 3921
31 Ga0070705_100000666 3300005440 Bacteria 19690
32 Ga0070694_100002136 3300005444 Bacteria 11719
33 Ga0070663_100014155 3300005455 Bacteria 5113
34 Ga0070662_100003587 3300005457 Bacteria 9679
35 Ga0070685_10008323 3300005466 Bacteria 5324
36 Ga0070685_10011331 3300005466 Bacteria 4669
37 Ga0070684_100003129 3300005535 Bacteria 12348
38 Ga0070684_100176962 3300005535 Bacteria 1939
39 Ga0070672_100006853 3300005543 Bacteria 7696
40 Ga0070686_100030291 3300005544 Bacteria 3299
41 Ga0070695_100000121 3300005545 Bacteria 34920
42 Ga0070695_100000217 3300005545 Bacteria 28008
43 Ga0070696_100003962 3300005546 Bacteria 9879
44 Ga0070665_100046579 3300005548 Bacteria 4355
45 Ga0068857_100025985 3300005577 Bacteria 5158
46 Ga0068857_100084857 3300005577 Bacteria 2830
47 Ga0068859_100003362 3300005617 Bacteria 16269
48 Ga0068859_100027776 3300005617 Bacteria 5675
49 Ga0068859_100062347 3300005617 Bacteria 3758
50 Ga0068864_100001699 3300005618 Bacteria 18094
51 Ga0068866_10030798 3300005718 Bacteria 2579
52 Ga0068863_100091379 3300005841 Bacteria 2887
53 Ga0068858_100015847 3300005842 Bacteria 7084
54 Ga0068860_100001938 3300005843 Bacteria 21894
55 Ga0068862_100002403 3300005844 Bacteria 16650
56 Ga0081539_10000736 3300005985 Bacteria 65538
57 Ga0075367_10003275 3300006178 Bacteria 7673
58 Ga0075428_100000241 3300006844 Bacteria 53452
59 Ga0075428_100001202 3300006844 Bacteria 27731
60 Ga0075428_100002397 3300006844 Bacteria 20349
61 Ga0075428_100004241 3300006844 Bacteria 15786
62 Ga0075428_100016998 3300006844 Bacteria 8037
63 Ga0075428_100144955 3300006844 Bacteria 2581
64 Ga0075430_100000820 3300006846 Bacteria 24262
65 Ga0075430_100002846 3300006846 Bacteria 14485
66 Ga0075430_100054930 3300006846 Bacteria 3350
67 Ga0075431_100014151 3300006847 Bacteria 8067
68 Ga0075431_100021149 3300006847 Bacteria 6648
69 Ga0075431_100034770 3300006847 Bacteria 5191
70 Ga0075431_100038691 3300006847 Bacteria 4912
71 Ga0075431_100043018 3300006847 Bacteria 4661
72 Ga0075431_100110946 3300006847 Bacteria 2831
73 Ga0075433_10003173 3300006852 Bacteria 12670
74 Ga0075433_10003978 3300006852 Bacteria 11436
75 Ga0075433_10008532 3300006852 Bacteria 8173
76 Ga0075434_100007024 3300006871 Bacteria 10385
77 Ga0075434_100045054 3300006871 Bacteria 4376
78 Ga0075429_100034834 3300006880 Bacteria 4375
79 Ga0075429_100051356 3300006880 Bacteria 3588
80 Ga0068865_100039607 3300006881 Bacteria 3197
81 Ga0097620_100003362 3300006931 Bacteria 16269
82 Ga0097620_100018160 3300006931 Bacteria 7069
83 Ga0097620_100027776 3300006931 Bacteria 5675
84 Ga0097620_100062346 3300006931 Bacteria 3758
85 Ga0075435_100010001 3300007076 Bacteria 6915
86 Ga0075435_100037189 3300007076 Bacteria 3875
87 Ga0075435_100048481 3300007076 Bacteria 3413
88 Ga0075435_100057321 3300007076 Bacteria 3151
89 Ga0111539_10000903 3300009094 Bacteria 38809
90 Ga0111539_10001592 3300009094 Bacteria 30246
91 Ga0111539_10002799 3300009094 Bacteria 23156
92 Ga0111539_10004600 3300009094 Bacteria 18032
93 Ga0111539_10008883 3300009094 Bacteria 12725
94 Ga0111539_10020436 3300009094 Bacteria 8154
95 Ga0111539_10027755 3300009094 Bacteria 6915
96 Ga0111539_10130831 3300009094 Bacteria 2939
97 Ga0111539_10193603 3300009094 Bacteria 2372
98 Ga0105245_10037746 3300009098 Bacteria 4295
99 Ga0105247_10056724 3300009101 Bacteria 2420
100 Ga0114129_10000390 3300009147 Bacteria 51153
101 Ga0114129_10003440 3300009147 Bacteria 22260
102 Ga0114129_10012328 3300009147 Bacteria 12166
103 Ga0114129_10029873 3300009147 Bacteria 7718
104 Ga0114129_10046525 3300009147 Bacteria 6097
105 Ga0114129_10049203 3300009147 Bacteria 5924
106 Ga0114129_10139263 3300009147 Bacteria 3328
107 Ga0105243_10029259 3300009148 Bacteria 4235
108 Ga0105248_10001705 3300009177 Bacteria 24457
109 Ga0105248_10024521 3300009177 Bacteria 6706
110 Ga0105248_10119306 3300009177 Bacteria 2975
111 Ga0105249_10001631 3300009553 Bacteria 19642
112 Ga0105249_10055400 3300009553 Bacteria 3627
113 Ga0105249_10152269 3300009553 Bacteria 2227
114 Ga0105239_10132354 3300010375 Bacteria 2775
115 Ga0163162_10006208 3300013306 Bacteria 11576
116 Ga0163162_10046529 3300013306 Bacteria 4349
117 Ga0157375_10008615 3300013308 Bacteria 8930
118 Ga0157375_10069004 3300013308 Bacteria 3540
119 Ga0157380_10001558 3300014326 Bacteria 15076
120 Ga0157380_10015290 3300014326 Bacteria 5638
121 Ga0163161_10104289 3300017792 Bacteria 2113
122 Ga0207697_10000903 3300025315 Bacteria 16780
123 Ga0207697_10001470 3300025315 Bacteria 12872
124 Ga0207697_10024416 3300025315 Bacteria 2475
125 Ga0207682_10013999 3300025893 Bacteria 3124
126 Ga0207645_10001445 3300025907 Bacteria 19465
127 Ga0207645_10007729 3300025907 Bacteria 7569
128 Ga0207662_10001856 3300025918 Bacteria 10382
129 Ga0207681_10019498 3300025923 Bacteria 4285
130 Ga0207681_10032114 3300025923 Bacteria 3436
131 Ga0207659_10004352 3300025926 Bacteria 8557
132 Ga0207659_10050071 3300025926 Bacteria 2966
133 Ga0207706_10001881 3300025933 Bacteria 20583
134 Ga0207706_10042068 3300025933 Bacteria 4049
135 Ga0207670_10004516 3300025936 Bacteria 7501
136 Ga0207669_10009930 3300025937 Bacteria 4559
137 Ga0207704_10020262 3300025938 Bacteria 3514
138 Ga0207691_10013918 3300025940 Bacteria 7675
139 Ga0207691_10065150 3300025940 Bacteria 3299
140 Ga0207711_10052785 3300025941 Bacteria 3485
141 Ga0207711_10063400 3300025941 Bacteria 3190
142 Ga0207661_10001184 3300025944 Bacteria 17452
143 Ga0207661_10056062 3300025944 Bacteria 3163
144 Ga0207679_10001966 3300025945 Bacteria 12737
145 Ga0207712_10021167 3300025961 Bacteria 4267
146 Ga0207712_10026604 3300025961 Bacteria 3856
147 Ga0207658_10022580 3300025986 Bacteria 4383
148 Ga0207708_10009867 3300026075 Bacteria 7088
149 Ga0207641_10076489 3300026088 Bacteria 2894
150 Ga0207676_10003137 3300026095 Bacteria 11798
151 Ga0207674_10037116 3300026116 Bacteria 5071
152 Ga0207674_10103262 3300026116 Bacteria 2830
153 Ga0207675_100017605 3300026118 Bacteria 6665
154 Ga0207683_10037411 3300026121 Bacteria 4226
155 Ga0207428_10000518 3300027907 Bacteria 46060
156 Ga0207428_10001652 3300027907 Bacteria 23192
157 Ga0207428_10002105 3300027907 Bacteria 20068
158 Ga0207428_10003676 3300027907 Bacteria 14762
159 Ga0207428_10011762 3300027907 Bacteria 7719
160 Ga0207428_10019425 3300027907 Bacteria 5794
161 Ga0207428_10054724 3300027907 Bacteria 3177
162 Ga0268265_10027251 3300028380 Bacteria 4076
163 Ga0268264_10000914 3300028381 Bacteria 30928
164 Ga0265324_10000107 3300029957 Bacteria 66412
165 Ga0307408_100001554 3300031548 Bacteria 16979
166 Ga0307405_10023291 3300031731 Bacteria 3517
167 Ga0307409_100072429 3300031995 Bacteria 2744
168 Ga0307416_100002876 3300032002 Bacteria 10029
169 Ga0307416_100007641 3300032002 Bacteria 6897
170 Ga0307411_10025057 3300032005 Bacteria 3567
171 Ga0373937_0000993 3300036401 Bacteria 24079
172 Ga0373925_0001039 3300037068 Bacteria 25175
173 Ga0373925_0001450 3300037068 Bacteria 20471
174 Ga0439449_0017978 3300042007 Bacteria 2654
175 Ga0439435_0001186 3300042436 Bacteria 4700
176 Ga0451577_0017416 3300042876 Bacteria 6639
177 Ga0451576_0027411 3300045051 Bacteria 6118
178 Ga0495629_0000024 3300046459 Bacteria 136884
179 Ga0495629_0000241 3300046459 Bacteria 47574
180 Ga0495638_0017129 3300046460 Bacteria 4839
181 Ga0495582_0009855 3300046473 Bacteria 5261
182 Ga0495639_0000654 3300046475 Bacteria 16009
183 Ga0495639_0001811 3300046475 Bacteria 9479
184 Ga0495594_0008026 3300046499 Bacteria 5427
185 Ga0495666_0000017 3300046526 Bacteria 68024
186 Ga0495640_0012426 3300046533 Bacteria 6504
187 Ga0495586_0000935 3300046535 Bacteria 16565
188 Ga0495598_0003962 3300046537 Bacteria 3179
189 Ga0495622_0003349 3300046557 Bacteria 7563
190 Ga0495622_0035554 3300046557 Bacteria 2323
191 Ga0495634_0022463 3300046642 Bacteria 4445
192 Ga0495635_0000345 3300046663 Bacteria 29623
193 Ga0495635_0000498 3300046663 Bacteria 24794
194 Ga0495659_0017120 3300046664 Bacteria 2397
195 Ga0495588_0020308 3300046674 Bacteria 3263
196 Ga0495658_0000016 3300046683 Bacteria 94726
197 Ga0495613_0005070 3300046689 Bacteria 9878
198 Ga0495581_0019936 3300047315 Bacteria 3893
199 Ga0495676_0001160 3300047321 Bacteria 22428
200 Ga0495676_0059139 3300047321 Bacteria 3012
201 Ga0495680_0000165 3300047322 Bacteria 68296
202 Ga0495680_0001236 3300047322 Bacteria 28036
203 Ga0495684_0019328 3300047471 Bacteria 5243
204 Ga0495614_0000030 3300048089 Bacteria 41355
205 Ga0496102_0003968 3300048905 Bacteria 12540
206 Ga0496102_0114339 3300048905 Bacteria 2518
207 Ga0496104_0002341 3300048907 Bacteria 16378
208 Ga0496104_0006875 3300048907 Bacteria 10030
209 Ga0496104_0112532 3300048907 Bacteria 2610
210 Ga0496108_0049050 3300048911 Bacteria 3531
211 Ga0496109_0001663 3300048912 Bacteria 18543
212 Ga0496109_0008603 3300048912 Bacteria 8688
213 Ga0496110_0003607 3300048913 Bacteria 11909
214 Ga0496110_0005733 3300048913 Bacteria 9755
215 Ga0496110_0049165 3300048913 Bacteria 3698
216 Ga0496112_0015035 3300048915 Bacteria 7204
217 Ga0496112_0017624 3300048915 Bacteria 6716
218 Ga0501299_000699 3300049522 Bacteria 4021
219 Ga0501038_0110024 3300049574 Bacteria 2283
220 Ga0501039_0072608 3300049575 Bacteria 2674
221 Ga0501041_0010235 3300049577 Bacteria 5526
222 Ga0501041_0061219 3300049577 Bacteria 2304
223 Ga0501042_0012197 3300049578 Bacteria 5816
224 Ga0501046_0000027 3300049580 Bacteria 197037
225 Ga0501048_0052165 3300049582 Bacteria 2910
226 Ga0501071_0011049 3300049587 Bacteria 6066
227 Ga0501072_0026911 3300049588 Bacteria 4488
228 Ga0501072_0060397 3300049588 Bacteria 2989
229 Ga0501072_0153161 3300049588 Bacteria 1838
230 Ga0501073_0061989 3300049589 Bacteria 2609
231 Ga0501075_0007748 3300049591 Bacteria 7450
232 Ga0501075_0041311 3300049591 Bacteria 3456
233 Ga0501076_0007052 3300049592 Bacteria 8164
234 Ga0501076_0054662 3300049592 Bacteria 3164
235 Ga0501077_0006147 3300049593 Bacteria 7333
236 Ga0501208_001102 3300049655 Bacteria 2450
237 Ga0501079_0067092 3300049741 Bacteria 2769
238 Ga0501081_0081932 3300049743 Bacteria 2260
239 Ga0501035_0109462 3300049822 Bacteria 2422
240 Ga0501045_0013829 3300049824 Bacteria 5707
241 nmdc:mga06z11_25293_c1 3300050494 Bacteria 2812
242 nmdc:mga05p37_121167_c1 3300050507 Bacteria 3213
243 nmdc:mga05p37_13666_c1 3300050507 Bacteria 9729
244 nmdc:mga05p37_14075_c1 3300050507 Bacteria 9600
245 nmdc:mga05p37_158274_c1 3300050507 Bacteria 2767
246 nmdc:mga05p37_18119_c1 3300050507 Bacteria 8507
247 nmdc:mga05p37_1946_c1 3300050507 Bacteria 24075
248 nmdc:mga05p37_19988_c1 3300050507 Bacteria 8103
249 nmdc:mga05p37_220056_c1 3300050507 Bacteria 2292
250 nmdc:mga05p37_22709_c1 3300050507 Bacteria 7610
251 nmdc:mga05p37_26764_c1 3300050507 Bacteria 7013
252 nmdc:mga05p37_365_c1 3300050507 Bacteria 48774
253 nmdc:mga05p37_60510_c1 3300050507 Bacteria 4663
254 nmdc:mga05p37_93088_c1 3300050507 Bacteria 3714
255 nmdc:mga09592_29566_c1 3300050508 Bacteria 4556
256 nmdc:mga09592_45428_c1 3300050508 Bacteria 3700
257 nmdc:mga09592_5618_c1 3300050508 Bacteria 10220
258 nmdc:mga09592_97290_c1 3300050508 Bacteria 2519
259 nmdc:mga0qj67_126_c1 3300050509 Bacteria 50369
260 nmdc:mga0qj67_3125_c1 3300050509 Bacteria 11918
261 nmdc:mga06r32_1602_c1 3300050510 Bacteria 20404
262 nmdc:mga06r32_33826_c1 3300050510 Bacteria 4816
263 nmdc:mga06r32_38528_c1 3300050510 Bacteria 4529
264 nmdc:mga06r32_6793_c1 3300050510 Bacteria 10283
265 nmdc:mga08y16_15952_c1 3300050511 Bacteria 7898
266 nmdc:mga08y16_20963_c1 3300050511 Bacteria 6899
267 nmdc:mga08y16_2510_c1 3300050511 Bacteria 18866
268 nmdc:mga08y16_3337_c1 3300050511 Bacteria 16626
269 nmdc:mga08y16_4206_c1 3300050511 Bacteria 15017
270 nmdc:mga08y16_53447_c1 3300050511 Bacteria 4224
271 nmdc:mga08y16_77836_c1 3300050511 Bacteria 3458
272 nmdc:mga08y16_8705_c1 3300050511 Bacteria 10644
273 nmdc:mga08y16_9526_c1 3300050511 Bacteria 10193
274 nmdc:mga0n895_21497_c1 3300050512 Bacteria 6036
275 nmdc:mga0n895_4725_c1 3300050512 Bacteria 11248
276 nmdc:mga0n895_56195_c1 3300050512 Bacteria 3877
277 nmdc:mga0rr50_3449_c1 3300050513 Bacteria 9098
278 nmdc:mga0rr50_50643_c2 3300050513 Bacteria 2700
279 nmdc:mga0rr50_62790_c1 3300050513 Bacteria 2804
280 nmdc:mga0a205_24041_c1 3300050515 Bacteria 5786
281 nmdc:mga0a205_3998_c1 3300050515 Bacteria 13189
282 nmdc:mga0a205_50222_c1 3300050515 Bacteria 4026
283 nmdc:mga0a205_5842_c1 3300050515 Bacteria 11084
284 Ga0495619_0007517 3300053085 Bacteria 6902
285 Ga0500641_0000664 3300053096 Bacteria 12396
286 Ga0500555_000048 3300053103 Bacteria 61782
287 Ga0500616_0001193 3300053153 Bacteria 26401
288 Ga0500645_000118 3300053730 Bacteria 62173
289 Ga0501084_0024868 3300054114 Bacteria 4998
290 Ga0590071_002375 3300059421 Bacteria 4741
291 Ga0590074_000528 3300059423 Bacteria 5720
292 Ga0590077_000162 3300059426 Bacteria 18830
293 Ga0530510_0003979 3300061734 Bacteria 10196
294 Ga0530510_0028600 3300061734 Bacteria 3998
295 nmdc:mga08y16_41637_c1
296 JGI25406J46586_10006533
297 Ga0065714_10080451
298 Ga0065704_10005590
299 Ga0065712_10000492
300 Ga0065712_10068753
301 Ga0065715_10000537
302 Ga0065715_10011183
303 Ga0065707_10003742
304 Ga0065707_10014281
305 Ga0070683_100000649
306 Ga0070683_100083849
307 Ga0070670_100005615
308 Ga0068869_100002961
309 Ga0070666_10023128
310 Ga0070680_100035744
311 Ga0068868_100029582
312 Ga0070689_100005047
313 Ga0070689_100010500
314 Ga0070689_100037077
315 Ga0070687_100007721
316 Ga0070661_100018364
317 Ga0070669_100004127
318 Ga0070669_100016305
319 Ga0070675_100005671
320 Ga0070671_100038742
321 Ga0070671_100069286
322 Ga0070673_100004325
323 Ga0070688_100032007
324 Ga0070701_10011816
325 Ga0070705_100000666
326 Ga0070694_100002136
327 Ga0070663_100014155
328 Ga0070662_100003587
329 Ga0070685_10008323
330 Ga0070685_10011331
331 Ga0070684_100003129
332 Ga0070684_100176962
333 Ga0070672_100006853
334 Ga0070686_100030291
335 Ga0070695_100000121
336 Ga0070695_100000217
337 Ga0070696_100003962
338 Ga0070665_100046579
339 Ga0068857_100025985
340 Ga0068857_100084857
341 Ga0068859_100003362
342 Ga0068859_100027776
343 Ga0068859_100062347
344 Ga0068864_100001699
345 Ga0068866_10030798
346 Ga0068863_100091379
347 Ga0068858_100015847
348 Ga0068860_100001938
349 Ga0068862_100002403
350 Ga0081539_10000736
351 Ga0075367_10003275
352 Ga0075428_100000241
353 Ga0075428_100001202
354 Ga0075428_100002397
355 Ga0075428_100004241
356 Ga0075428_100016998
357 Ga0075428_100144955
358 Ga0075430_100000820
359 Ga0075430_100002846
360 Ga0075430_100054930
361 Ga0075431_100014151
362 Ga0075431_100021149
363 Ga0075431_100034770
364 Ga0075431_100038691
365 Ga0075431_100043018
366 Ga0075431_100110946
367 Ga0075433_10003173
368 Ga0075433_10003978
369 Ga0075433_10008532
370 Ga0075434_100007024
371 Ga0075434_100045054
372 Ga0075429_100034834
373 Ga0075429_100051356
374 Ga0068865_100039607
375 Ga0097620_100003362
376 Ga0097620_100018160
377 Ga0097620_100027776
378 Ga0097620_100062346
379 Ga0075435_100010001
380 Ga0075435_100037189
381 Ga0075435_100048481
382 Ga0075435_100057321
383 Ga0111539_10000903
384 Ga0111539_10001592
385 Ga0111539_10002799
386 Ga0111539_10004600
387 Ga0111539_10008883
388 Ga0111539_10020436
389 Ga0111539_10027755
390 Ga0111539_10130831
391 Ga0111539_10193603
392 Ga0105245_10037746
393 Ga0105247_10056724
394 Ga0114129_10000390
395 Ga0114129_10003440
396 Ga0114129_10012328
397 Ga0114129_10029873
398 Ga0114129_10046525
399 Ga0114129_10049203
400 Ga0114129_10139263
401 Ga0105243_10029259
402 Ga0105248_10001705
403 Ga0105248_10024521
404 Ga0105248_10119306
405 Ga0105249_10001631
406 Ga0105249_10055400
407 Ga0105249_10152269
408 Ga0105239_10132354
409 Ga0163162_10006208
410 Ga0163162_10046529
411 Ga0157375_10008615
412 Ga0157375_10069004
413 Ga0157380_10001558
414 Ga0157380_10015290
415 Ga0163161_10104289
416 Ga0207697_10000903
417 Ga0207697_10001470
418 Ga0207697_10024416
419 Ga0207682_10013999
420 Ga0207645_10001445
421 Ga0207645_10007729
422 Ga0207662_10001856
423 Ga0207681_10019498
424 Ga0207681_10032114
425 Ga0207659_10004352
426 Ga0207659_10050071
427 Ga0207706_10001881
428 Ga0207706_10042068
429 Ga0207670_10004516
430 Ga0207669_10009930
431 Ga0207704_10020262
432 Ga0207691_10013918
433 Ga0207691_10065150
434 Ga0207711_10052785
435 Ga0207711_10063400
436 Ga0207661_10001184
437 Ga0207661_10056062
438 Ga0207679_10001966
439 Ga0207712_10021167
440 Ga0207712_10026604
441 Ga0207658_10022580
442 Ga0207708_10009867
443 Ga0207641_10076489
444 Ga0207676_10003137
445 Ga0207674_10037116
446 Ga0207674_10103262
447 Ga0207675_100017605
448 Ga0207683_10037411
449 Ga0207428_10000518
450 Ga0207428_10001652
451 Ga0207428_10002105
452 Ga0207428_10003676
453 Ga0207428_10011762
454 Ga0207428_10019425
455 Ga0207428_10054724
456 Ga0268265_10027251
457 Ga0268264_10000914
458 Ga0265324_10000107
459 Ga0307408_100001554
460 Ga0307405_10023291
461 Ga0307409_100072429
462 Ga0307416_100002876
463 Ga0307416_100007641
464 Ga0307411_10025057
465 Ga0373937_0000993
466 Ga0373925_0001039
467 Ga0373925_0001450
468 Ga0439449_0017978
469 Ga0439435_0001186
470 Ga0451577_0017416
471 Ga0451576_0027411
472 Ga0495629_0000024
473 Ga0495629_0000241
474 Ga0495638_0017129
475 Ga0495582_0009855
476 Ga0495639_0000654
477 Ga0495639_0001811
478 Ga0495594_0008026
479 Ga0495666_0000017
480 Ga0495640_0012426
481 Ga0495586_0000935
482 Ga0495598_0003962
483 Ga0495622_0003349
484 Ga0495622_0035554
485 Ga0495634_0022463
486 Ga0495635_0000345
487 Ga0495635_0000498
488 Ga0495659_0017120
489 Ga0495588_0020308
490 Ga0495658_0000016
491 Ga0495613_0005070
492 Ga0495581_0019936
493 Ga0495676_0001160
494 Ga0495676_0059139
495 Ga0495680_0000165
496 Ga0495680_0001236
497 Ga0495684_0019328
498 Ga0495614_0000030
499 Ga0496102_0003968
500 Ga0496102_0114339
501 Ga0496104_0002341
502 Ga0496104_0006875
503 Ga0496104_0112532
504 Ga0496108_0049050
505 Ga0496109_0001663
506 Ga0496109_0008603
507 Ga0496110_0003607
508 Ga0496110_0005733
509 Ga0496110_0049165
510 Ga0496112_0015035
511 Ga0496112_0017624
512 Ga0501299_000699
513 Ga0501038_0110024
514 Ga0501039_0072608
515 Ga0501041_0010235
516 Ga0501041_0061219
517 Ga0501042_0012197
518 Ga0501046_0000027
519 Ga0501048_0052165
520 Ga0501071_0011049
521 Ga0501072_0026911
522 Ga0501072_0060397
523 Ga0501072_0153161
524 Ga0501073_0061989
525 Ga0501075_0007748
526 Ga0501075_0041311
527 Ga0501076_0007052
528 Ga0501076_0054662
529 Ga0501077_0006147
530 Ga0501208_001102
531 Ga0501079_0067092
532 Ga0501081_0081932
533 Ga0501035_0109462
534 Ga0501045_0013829
535 nmdc:mga06z11_25293_c1
536 nmdc:mga05p37_121167_c1
537 nmdc:mga05p37_13666_c1
538 nmdc:mga05p37_14075_c1
539 nmdc:mga05p37_158274_c1
540 nmdc:mga05p37_18119_c1
541 nmdc:mga05p37_1946_c1
542 nmdc:mga05p37_19988_c1
543 nmdc:mga05p37_220056_c1
544 nmdc:mga05p37_22709_c1
545 nmdc:mga05p37_26764_c1
546 nmdc:mga05p37_365_c1
547 nmdc:mga05p37_60510_c1
548 nmdc:mga05p37_93088_c1
549 nmdc:mga09592_29566_c1
550 nmdc:mga09592_45428_c1
551 nmdc:mga09592_5618_c1
552 nmdc:mga09592_97290_c1
553 nmdc:mga0qj67_126_c1
554 nmdc:mga0qj67_3125_c1
555 nmdc:mga06r32_1602_c1
556 nmdc:mga06r32_33826_c1
557 nmdc:mga06r32_38528_c1
558 nmdc:mga06r32_6793_c1
559 nmdc:mga08y16_15952_c1
560 nmdc:mga08y16_20963_c1
561 nmdc:mga08y16_2510_c1
562 nmdc:mga08y16_3337_c1
563 nmdc:mga08y16_4206_c1
564 nmdc:mga08y16_53447_c1
565 nmdc:mga08y16_77836_c1
566 nmdc:mga08y16_8705_c1
567 nmdc:mga08y16_9526_c1
568 nmdc:mga0n895_21497_c1
569 nmdc:mga0n895_4725_c1
570 nmdc:mga0n895_56195_c1
571 nmdc:mga0rr50_3449_c1
572 nmdc:mga0rr50_50643_c2
573 nmdc:mga0rr50_62790_c1
574 nmdc:mga0a205_24041_c1
575 nmdc:mga0a205_3998_c1
576 nmdc:mga0a205_50222_c1
577 nmdc:mga0a205_5842_c1
578 Ga0495619_0007517
579 Ga0500641_0000664
580 Ga0500555_000048
581 Ga0500616_0001193
582 Ga0500645_000118
583 Ga0501084_0024868
584 Ga0590071_002375
585 Ga0590074_000528
586 Ga0590077_000162
587 Ga0530510_0003979
588 Ga0530510_0028600

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rx4-assembly1.cif.gz_A the structure of bd oxidase from escherichia coli 0.4016 82 560
7d5i-assembly1.cif.gz_A structure of mycobacterium smegmatis bd complex in the apo-form. 0.3881 83 577
5ir6-assembly1.cif.gz_A the structure of bd oxidase from geobacillus thermodenitrificans 0.3872 82 515
6rx4-assembly1.cif.gz_A the structure of bd oxidase from escherichia coli 0.3861 82 560
7d5i-assembly1.cif.gz_A structure of mycobacterium smegmatis bd complex in the apo-form. 0.3797 83 577
ID Description Score Start End Superfamily
af_Q9NYW2_5_306_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.4319 205 468 1.20.1070.10
af_Q565A7_4_252_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.4212 213 468 1.20.1070.10
af_Q675C0_4_288_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.407 203 465 1.20.1070.10
af_Q565A7_4_252_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.4026 213 468 1.20.1070.10
af_Q9NYW2_5_306_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3975 205 468 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A347UD09-F1-model_v4 Cytochrome ubiquinol oxidase subunit I 0.8402 76 571 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0020037
GO:0046872
GO:0070069
AF-A0A3N5FHU7-F1-model_v4 Cytochrome ubiquinol oxidase subunit I 0.8377 103 566 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0020037
GO:0046872
GO:0070069
AF-A0A832J430-F1-model_v4 Cytochrome ubiquinol oxidase subunit I 0.8375 77 570 GO:0005886
GO:0009055
GO:0019646
GO:0046872
GO:0070069
AF-A0A523GW62-F1-model_v4 Cytochrome ubiquinol oxidase subunit I 0.8352 76 566 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0020037
GO:0046872
GO:0070069
AF-A0A1F7Q5C2-F1-model_v4 Cytochrome ubiquinol oxidase subunit I 0.8293 103 561 GO:0005886
GO:0009055
GO:0019646
GO:0046872
GO:0070069

Map