F392196

General Info

Members Datasets Scaffolds Average Seq Length
294 150 288 154

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0000128|Ga0395900_0000128_5918_6424
Length 168
Sequence LPVNIIKNKYNMEQRINAYEKGAAAFKALFSLGAYLAKSSIEKALLDLIDFRVSQINRCAYCLDMHSKDLRAAGETEQRLYMLEAWRETLLYSDRERAALAWAEAVTVVTDGFVPDAVYEQAREQFSEQELVDLTIGIITINCYNRINVAFRTPAGDYKVRQHAVQQN

Samples

Sample ID Description Type Environment
1 2739367651 Pedobacter sp. OK291 Isolate Unclassified
2 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
3 2884411467 Dyella sp. AD56 Isolate Rhizosphere
4 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
5 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
6 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
76 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
77 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
78 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
80 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
81 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
116 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
117 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
125 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
126 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
127 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
128 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
129 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
130 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
131 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
132 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
133 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
134 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
135 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
136 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
142 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
143 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
145 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
146 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
147 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
148 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
149 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
150 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.62
Metatranscriptomes 0.34
Isolates 2.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.46
Nodule 0
Rhizoplane 0
Rhizosphere 91.16
Stem 0
Stem Tuber 0
Unclassified 2.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1002813 3300002773 Bacteria 6283
2 JGI25150J39212_1000001 3300002774 Bacteria 1318726
3 JGI25151J46595_10000005 3300003187 Bacteria 431598
4 JGI25406J46586_10002563 3300003203 Bacteria 8582
5 JGI25153J46596_10000040 3300003215 Bacteria 165523
6 rootH1_10150998 3300003316 Unclassified 1402
7 rootH2_10075519 3300003320 Bacteria 5356
8 rootL2_10017333 3300003322 Bacteria 5289
9 Ga0055536_1000008 3300003781 Bacteria 335729
10 Ga0055530_10001133 3300003791 Bacteria 20756
11 Ga0058862_12040140 3300004803 Bacteria 1460
12 Ga0070658_10001030 3300005327 Bacteria 23838
13 Ga0070658_10016216 3300005327 Bacteria 5961
14 Ga0070658_10262296 3300005327 Bacteria 1467
15 Ga0070658_10295247 3300005327 Bacteria 1381
16 Ga0070658_10324316 3300005327 Bacteria 1315
17 Ga0070683_100343651 3300005329 Bacteria 1421
18 Ga0070683_100548494 3300005329 Bacteria 1105
19 Ga0070683_101674884 3300005329 Bacteria 612
20 Ga0068869_100021884 3300005334 Bacteria 4400
21 Ga0070666_10000128 3300005335 Bacteria 53252
22 Ga0070680_100000645 3300005336 Bacteria 24317
23 Ga0070680_100003607 3300005336 Bacteria 11556
24 Ga0070680_100245905 3300005336 Bacteria 1512
25 Ga0070680_100250179 3300005336 Bacteria 1498
26 Ga0070680_100373938 3300005336 Bacteria 1213
27 Ga0070680_100891123 3300005336 Bacteria 767
28 Ga0070682_100003068 3300005337 Bacteria 9255
29 Ga0070682_100290073 3300005337 Bacteria 1196
30 Ga0070660_100008530 3300005339 Bacteria 7175
31 Ga0070660_100040261 3300005339 Bacteria 3556
32 Ga0070660_100180514 3300005339 Bacteria 1708
33 Ga0070660_100349120 3300005339 Bacteria 1218
34 Ga0070660_100624416 3300005339 Bacteria 902
35 Ga0070660_100721127 3300005339 Unclassified 836
36 Ga0070689_100144947 3300005340 Bacteria 1912
37 Ga0070691_10007303 3300005341 Bacteria 5058
38 Ga0070691_10098988 3300005341 Bacteria 1446
39 Ga0070668_100326611 3300005347 Bacteria 1293
40 Ga0070671_100197240 3300005355 Bacteria 1707
41 Ga0070659_100116266 3300005366 Unclassified 2162
42 Ga0070659_100445415 3300005366 Bacteria 1098
43 Ga0070663_100137326 3300005455 Bacteria 1863
44 Ga0070681_10007755 3300005458 Bacteria 10494
45 Ga0070681_10200457 3300005458 Bacteria 1914
46 Ga0070681_10463266 3300005458 Bacteria 1180
47 Ga0070679_100000242 3300005530 Bacteria 45444
48 Ga0070679_100009738 3300005530 Bacteria 9089
49 Ga0070679_100027498 3300005530 Bacteria 5599
50 Ga0070679_100211468 3300005530 Bacteria 1903
51 Ga0070679_100570745 3300005530 Bacteria 1075
52 Ga0070679_100575940 3300005530 Bacteria 1069
53 Ga0070679_100828462 3300005530 Bacteria 868
54 Ga0068853_100068354 3300005539 Bacteria 3088
55 Ga0068853_100202277 3300005539 Bacteria 1808
56 Ga0068853_100264544 3300005539 Bacteria 1582
57 Ga0068853_100469455 3300005539 Bacteria 1185
58 Ga0070695_100062000 3300005545 Bacteria 2427
59 Ga0070693_100060736 3300005547 Bacteria 2195
60 Ga0068855_100021828 3300005563 Bacteria 7679
61 Ga0068855_100102587 3300005563 Bacteria 3292
62 Ga0068855_100142517 3300005563 Bacteria 2730
63 Ga0068855_100302960 3300005563 Bacteria 1769
64 Ga0068855_100544508 3300005563 Bacteria 1257
65 Ga0068855_100696965 3300005563 Bacteria 1087
66 Ga0068855_100852129 3300005563 Bacteria 966
67 Ga0070664_101112018 3300005564 Bacteria 744
68 Ga0068857_100001923 3300005577 Bacteria 16746
69 Ga0068857_100096648 3300005577 Unclassified 2647
70 Ga0068857_100408159 3300005577 Bacteria 1265
71 Ga0068854_100915378 3300005578 Bacteria 771
72 Ga0068854_101697334 3300005578 Bacteria 577
73 Ga0068856_100066043 3300005614 Bacteria 3575
74 Ga0068852_100001612 3300005616 Bacteria 15375
75 Ga0068852_100013719 3300005616 Bacteria 6210
76 Ga0068852_100019380 3300005616 Bacteria 5382
77 Ga0068852_100135578 3300005616 Unclassified 2272
78 Ga0068859_100000018 3300005617 Bacteria 248813
79 Ga0068859_100008935 3300005617 Bacteria 10122
80 Ga0068864_100241259 3300005618 Bacteria 1675
81 Ga0068861_100084324 3300005719 Bacteria 2494
82 Ga0068861_101472659 3300005719 Bacteria 667
83 Ga0068863_100092371 3300005841 Bacteria 2871
84 Ga0068863_100676001 3300005841 Unclassified 1025
85 Ga0068858_100016208 3300005842 Bacteria 7001
86 Ga0068860_100003974 3300005843 Bacteria 15174
87 Ga0068862_101410514 3300005844 Bacteria 700
88 Ga0081539_10000816 3300005985 Bacteria 60353
89 Ga0097621_100061625 3300006237 Bacteria 3077
90 Ga0075428_100075105 3300006844 Bacteria 3692
91 Ga0097620_100000018 3300006931 Bacteria 248813
92 Ga0097620_100008935 3300006931 Bacteria 10122
93 Ga0075435_100459663 3300007076 Bacteria 1098
94 Ga0105240_10008738 3300009093 Bacteria 14441
95 Ga0105240_10008805 3300009093 Bacteria 14374
96 Ga0105245_10672297 3300009098 Bacteria 1067
97 Ga0105247_10001120 3300009101 Bacteria 19973
98 Ga0105247_10300695 3300009101 Bacteria 1113
99 Ga0105241_10000510 3300009174 Bacteria 29254
100 Ga0105241_10001334 3300009174 Bacteria 18742
101 Ga0105241_10173406 3300009174 Bacteria 1783
102 Ga0105241_10273120 3300009174 Bacteria 1441
103 Ga0105241_10375799 3300009174 Bacteria 1240
104 Ga0105241_11749456 3300009174 Bacteria 605
105 Ga0105242_11115031 3300009176 Bacteria 804
106 Ga0105237_10001030 3300009545 Bacteria 37560
107 Ga0105237_10056638 3300009545 Bacteria 3923
108 Ga0105238_10050457 3300009551 Bacteria 4189
109 Ga0105238_11119698 3300009551 Bacteria 810
110 Ga0105249_10026873 3300009553 Bacteria 5189
111 Ga0105239_10007958 3300010375 Bacteria 12111
112 Ga0105239_10097318 3300010375 Unclassified 3252
113 Ga0105246_10140916 3300011119 Bacteria 1813
114 Ga0157373_10070859 3300013100 Bacteria 2463
115 Ga0157373_10073183 3300013100 Bacteria 2419
116 Ga0157373_10186171 3300013100 Bacteria 1462
117 Ga0157373_10516203 3300013100 Bacteria 864
118 Ga0157371_10016929 3300013102 Bacteria 5429
119 Ga0157371_10060484 3300013102 Bacteria 2686
120 Ga0157371_10076917 3300013102 Bacteria 2363
121 Ga0157371_10086517 3300013102 Bacteria 2220
122 Ga0157371_10199459 3300013102 Bacteria 1434
123 Ga0157371_10241803 3300013102 Bacteria 1299
124 Ga0157371_10518834 3300013102 Bacteria 881
125 Ga0157370_10001924 3300013104 Bacteria 25541
126 Ga0157370_10003947 3300013104 Bacteria 17264
127 Ga0157370_10016327 3300013104 Bacteria 7520
128 Ga0157370_10196933 3300013104 Bacteria 1870
129 Ga0157370_10743273 3300013104 Bacteria 894
130 Ga0157370_11078407 3300013104 Unclassified 726
131 Ga0157369_10018848 3300013105 Bacteria 7733
132 Ga0157369_10079672 3300013105 Bacteria 3508
133 Ga0157369_10200999 3300013105 Bacteria 2092
134 Ga0157369_10407376 3300013105 Bacteria 1410
135 Ga0157369_12154485 3300013105 Bacteria 565
136 Ga0157374_10146143 3300013296 Bacteria 2296
137 Ga0157374_11008859 3300013296 Bacteria 852
138 Ga0157378_10181462 3300013297 Bacteria 1980
139 Ga0163162_10000599 3300013306 Bacteria 33336
140 Ga0157372_10000495 3300013307 Bacteria 43372
141 Ga0157372_10003151 3300013307 Bacteria 17789
142 Ga0157372_10042223 3300013307 Bacteria 5043
143 Ga0157372_10066801 3300013307 Bacteria 4041
144 Ga0157372_10120920 3300013307 Bacteria 3007
145 Ga0157372_10589147 3300013307 Bacteria 1296
146 Ga0157372_12590008 3300013307 Bacteria 582
147 Ga0157375_10050309 3300013308 Bacteria 4087
148 Ga0157379_10024344 3300014968 Bacteria 5374
149 Ga0157376_10114390 3300014969 Bacteria 2380
150 Ga0207425_1000002 3300025245 Bacteria 1362590
151 Ga0209129_1000002 3300025258 Bacteria 1359086
152 Ga0209233_1006148 3300025261 Bacteria 3897
153 Ga0209676_1000042 3300025292 Bacteria 424130
154 Ga0209025_1000004 3300025294 Bacteria 1361782
155 Ga0209758_1000006 3300025297 Bacteria 1359562
156 Ga0209050_1000035 3300025298 Bacteria 424005
157 Ga0209051_1125067 3300025303 Bacteria 645
158 Ga0207710_10000063 3300025900 Bacteria 163065
159 Ga0207710_10199705 3300025900 Bacteria 987
160 Ga0207680_10000193 3300025903 Bacteria 29312
161 Ga0207647_10394903 3300025904 Unclassified 780
162 Ga0207705_10000831 3300025909 Bacteria 25212
163 Ga0207705_10007369 3300025909 Bacteria 8088
164 Ga0207705_10034277 3300025909 Bacteria 3629
165 Ga0207705_10202243 3300025909 Unclassified 1505
166 Ga0207705_10220153 3300025909 Unclassified 1441
167 Ga0207705_10221875 3300025909 Bacteria 1436
168 Ga0207705_10638343 3300025909 Bacteria 828
169 Ga0207654_10002836 3300025911 Bacteria 8788
170 Ga0207654_10062655 3300025911 Bacteria 2180
171 Ga0207654_10402300 3300025911 Bacteria 952
172 Ga0207654_10638005 3300025911 Bacteria 762
173 Ga0207707_10001326 3300025912 Bacteria 23010
174 Ga0207707_10002694 3300025912 Bacteria 15868
175 Ga0207707_10826002 3300025912 Bacteria 770
176 Ga0207695_10015086 3300025913 Bacteria 9114
177 Ga0207695_10150706 3300025913 Bacteria 2265
178 Ga0207671_10001806 3300025914 Bacteria 23915
179 Ga0207671_10803380 3300025914 Bacteria 746
180 Ga0207660_10003453 3300025917 Bacteria 10308
181 Ga0207660_10027848 3300025917 Unclassified 3861
182 Ga0207660_10290015 3300025917 Bacteria 1301
183 Ga0207657_10034468 3300025919 Bacteria 4551
184 Ga0207657_10044096 3300025919 Bacteria 3923
185 Ga0207657_10225497 3300025919 Unclassified 1500
186 Ga0207657_10401967 3300025919 Bacteria 1077
187 Ga0207652_10001967 3300025921 Bacteria 17765
188 Ga0207652_10002079 3300025921 Bacteria 17245
189 Ga0207652_10002817 3300025921 Bacteria 14595
190 Ga0207652_10003605 3300025921 Bacteria 12753
191 Ga0207652_10026996 3300025921 Bacteria 4784
192 Ga0207652_10357908 3300025921 Bacteria 1317
193 Ga0207652_10835193 3300025921 Bacteria 816
194 Ga0207652_11002480 3300025921 Bacteria 734
195 Ga0207644_11258922 3300025931 Bacteria 622
196 Ga0207690_10034241 3300025932 Bacteria 3271
197 Ga0207686_10842089 3300025934 Bacteria 737
198 Ga0207691_10056683 3300025940 Unclassified 3569
199 Ga0207689_10000602 3300025942 Bacteria 34433
200 Ga0207661_10126336 3300025944 Bacteria 2185
201 Ga0207661_10334721 3300025944 Bacteria 1363
202 Ga0207661_10472184 3300025944 Bacteria 1144
203 Ga0207667_10002332 3300025949 Bacteria 23768
204 Ga0207667_10016869 3300025949 Bacteria 8238
205 Ga0207667_10086157 3300025949 Bacteria 3251
206 Ga0207667_10322606 3300025949 Bacteria 1577
207 Ga0207667_11387135 3300025949 Bacteria 677
208 Ga0207651_10147304 3300025960 Bacteria 1828
209 Ga0207712_10033246 3300025961 Bacteria 3485
210 Ga0207658_10067423 3300025986 Bacteria 2695
211 Ga0207677_10241073 3300026023 Unclassified 1463
212 Ga0207703_10006445 3300026035 Bacteria 9375
213 Ga0207639_10032198 3300026041 Bacteria 3858
214 Ga0207639_10208972 3300026041 Bacteria 1679
215 Ga0207639_10445699 3300026041 Bacteria 1174
216 Ga0207639_10478473 3300026041 Bacteria 1135
217 Ga0207678_10102929 3300026067 Bacteria 2437
218 Ga0207702_10047151 3300026078 Bacteria 3629
219 Ga0207641_10000015 3300026088 Bacteria 321332
220 Ga0207641_10162605 3300026088 Bacteria 2031
221 Ga0207676_10011487 3300026095 Bacteria 6332
222 Ga0207674_10018272 3300026116 Bacteria 7624
223 Ga0207674_10387355 3300026116 Bacteria 1351
224 Ga0207675_101115740 3300026118 Bacteria 809
225 Ga0207698_10000452 3300026142 Bacteria 23731
226 Ga0207698_10012186 3300026142 Bacteria 5614
227 Ga0207698_10017920 3300026142 Bacteria 4813
228 Ga0207698_10052832 3300026142 Bacteria 3115
229 Ga0268264_10000844 3300028381 Bacteria 32786
230 Ga0307515_10044471 3300028794 Bacteria 6859
231 Ga0307414_10000375 3300032004 Bacteria 24537
232 Ga0373946_0397034 3300035171 Bacteria 696
233 Ga0373925_0087312 3300037068 Bacteria 2381
234 Ga0395899_0000017 3300037312 Bacteria 440179
235 Ga0395899_0035345 3300037312 Unclassified 3751
236 Ga0395899_0158124 3300037312 Bacteria 1602
237 Ga0395899_0209685 3300037312 Bacteria 1354
238 Ga0395899_0588142 3300037312 Bacteria 710
239 Ga0395899_0762370 3300037312 Bacteria 601
240 Ga0395900_0000128 3300037418 Bacteria 127446
241 Ga0395900_0024749 3300037418 Bacteria 6144
242 Ga0395900_0095445 3300037418 Bacteria 3055
243 Ga0395900_0185699 3300037418 Bacteria 2110
244 Ga0395900_0218832 3300037418 Bacteria 1920
245 Ga0395898_0003807 3300037466 Bacteria 16705
246 Ga0395898_0033364 3300037466 Bacteria 5138
247 Ga0395898_0186258 3300037466 Bacteria 1983
248 Ga0395898_1014122 3300037466 Bacteria 765
249 Ga0395898_1592670 3300037466 Bacteria 577
250 Ga0395905_0281349 3300037471 Bacteria 1549
251 Ga0395905_0640290 3300037471 Bacteria 965
252 Ga0395901_0062425 3300038443 Bacteria 3877
253 Ga0395901_0067807 3300038443 Bacteria 3716
254 Ga0395901_0073611 3300038443 Bacteria 3563
255 Ga0395901_0095088 3300038443 Bacteria 3122
256 Ga0395901_0554586 3300038443 Bacteria 1164
257 Ga0395901_1063694 3300038443 Unclassified 781
258 Ga0466966_0183844 3300044684 Bacteria 1268
259 Ga0453684_0165940 3300044712 Bacteria 2607
260 Ga0451576_0249276 3300045051 Bacteria 1856
261 Ga0495650_0038428 3300046471 Bacteria 2074
262 Ga0495580_0162973 3300046472 Bacteria 1543
263 Ga0495584_0344253 3300046491 Bacteria 757
264 Ga0495606_0000213 3300046507 Bacteria 103305
265 Ga0495610_0000768 3300046512 Bacteria 30249
266 Ga0495637_0010944 3300046520 Bacteria 4372
267 Ga0495637_0011096 3300046520 Bacteria 4338
268 Ga0495668_0022449 3300046616 Bacteria 3607
269 Ga0495625_0191596 3300046660 Unclassified 1354
270 Ga0495687_000249 3300047443 Bacteria 72846
271 Ga0501032_0233549 3300049569 Bacteria 1196
272 Ga0501033_0156198 3300049570 Bacteria 1644
273 Ga0501034_0082568 3300049571 Bacteria 3215
274 Ga0501034_0188035 3300049571 Bacteria 2028
275 Ga0501037_1049739 3300049573 Bacteria 529
276 Ga0501043_0861207 3300049579 Bacteria 652
277 Ga0501072_0689606 3300049588 Bacteria 803
278 Ga0501074_0164927 3300049590 Bacteria 1582
279 Ga0501035_0195181 3300049822 Bacteria 1739
280 Ga0501035_0341802 3300049822 Unclassified 1254
281 Ga0501044_0234523 3300049823 Bacteria 1781
282 Ga0501044_0262710 3300049823 Bacteria 1664
283 nmdc:mga0k408_241_c1 3300050493 Bacteria 22414
284 nmdc:mga0rr50_444868_c1 3300050513 Bacteria 1098
285 Ga0500568_0017750 3300053139 Bacteria 3133
286 Ga0500577_0001299 3300053142 Bacteria 6383
287 Ga0500588_0424977 3300053146 Bacteria 506
288 Ga0500604_0018491 3300053151 Bacteria 1942

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009101 Ga0105247_10001120 Ga0105247_100011207 130
2 3300025900 Ga0207710_10000063 Ga0207710_10000063128 130
3 3300049573 Ga0501037_1049739 Ga0501037_1049739_95_514 130
4 3300005545 Ga0070695_100062000 Ga0070695_1000620002 132
5 3300037068 Ga0373925_0087312 Ga0373925_0087312_14_451 136
6 3300044712 Ga0453684_0165940 Ga0453684_0165940_2001_2444 136
7 3300049590 Ga0501074_0164927 Ga0501074_0164927_1112_1546 136
8 3300053146 Ga0500588_0424977 Ga0500588_0424977_43_474 136
9 3300005563 Ga0068855_100696965 Ga0068855_1006969652 137
10 3300025931 Ga0207644_11258922 Ga0207644_112589221 139
11 3300037466 Ga0395898_1592670 Ga0395898_1592670_118_558 143
12 3300047443 Ga0495687_000249 Ga0495687_000249_13107_13541 144
13 iso_pu_bacteria 2884411467 2884413321 145
14 iso_pu_bacteria 2739367651 2739591586 146
15 iso_pu_bacteria 2852627209 2852629987 146
16 iso_pu_bacteria 2896109856 2896115042 146
17 iso_pu_bacteria 2929150217 2929153359 146
18 iso_pu_bacteria 2929921140 2929923820 146
19 3300006844 Ga0075428_100075105 Ga0075428_1000751054 147
20 3300013104 Ga0157370_10196933 Ga0157370_101969332 148
21 3300045051 Ga0451576_0249276 Ga0451576_0249276_831_1304 148
22 3300049588 Ga0501072_0689606 Ga0501072_0689606_269_733 148
23 3300009174 Ga0105241_11749456 Ga0105241_117494561 149
24 3300002773 JGI25152J39213_1002813 JGI25152J39213_10028134 150
25 3300002774 JGI25150J39212_1000001 JGI25150J39212_1000001965 150
26 3300003187 JGI25151J46595_10000005 JGI25151J46595_10000005236 150
27 3300003203 JGI25406J46586_10002563 JGI25406J46586_100025632 150
28 3300003215 JGI25153J46596_10000040 JGI25153J46596_100000405 150
29 3300003316 rootH1_10150998 rootH1_101509982 150
30 3300003320 rootH2_10075519 rootH2_100755192 150
31 3300003322 rootL2_10017333 rootL2_100173335 150
32 3300003781 Ga0055536_1000008 Ga0055536_100000845 150
33 3300003791 Ga0055530_10001133 Ga0055530_100011334 150
34 3300004803 Ga0058862_12040140 Ga0058862_120401402 150
35 3300005327 Ga0070658_10001030 Ga0070658_1000103016 150
36 3300005327 Ga0070658_10016216 Ga0070658_100162164 150
37 3300005327 Ga0070658_10262296 Ga0070658_102622962 150
38 3300005327 Ga0070658_10295247 Ga0070658_102952473 150
39 3300005327 Ga0070658_10324316 Ga0070658_103243162 150
40 3300005329 Ga0070683_100343651 Ga0070683_1003436513 150
41 3300005329 Ga0070683_100548494 Ga0070683_1005484941 150
42 3300005329 Ga0070683_101674884 Ga0070683_1016748841 150
43 3300005334 Ga0068869_100021884 Ga0068869_1000218842 150
44 3300005335 Ga0070666_10000128 Ga0070666_1000012843 150
45 3300005336 Ga0070680_100000645 Ga0070680_10000064510 150
46 3300005336 Ga0070680_100003607 Ga0070680_1000036072 150
47 3300005336 Ga0070680_100245905 Ga0070680_1002459051 150
48 3300005336 Ga0070680_100250179 Ga0070680_1002501793 150
49 3300005336 Ga0070680_100373938 Ga0070680_1003739381 150
50 3300005336 Ga0070680_100891123 Ga0070680_1008911232 150
51 3300005337 Ga0070682_100003068 Ga0070682_1000030689 150
52 3300005337 Ga0070682_100290073 Ga0070682_1002900731 150
53 3300005339 Ga0070660_100008530 Ga0070660_1000085304 150
54 3300005339 Ga0070660_100040261 Ga0070660_1000402612 150
55 3300005339 Ga0070660_100180514 Ga0070660_1001805142 150
56 3300005339 Ga0070660_100349120 Ga0070660_1003491202 150
57 3300005339 Ga0070660_100624416 Ga0070660_1006244162 150
58 3300005339 Ga0070660_100721127 Ga0070660_1007211271 150
59 3300005340 Ga0070689_100144947 Ga0070689_1001449472 150
60 3300005341 Ga0070691_10007303 Ga0070691_100073032 150
61 3300005341 Ga0070691_10098988 Ga0070691_100989882 150
62 3300005347 Ga0070668_100326611 Ga0070668_1003266112 150
63 3300005355 Ga0070671_100197240 Ga0070671_1001972402 150
64 3300005366 Ga0070659_100116266 Ga0070659_1001162663 150
65 3300005366 Ga0070659_100445415 Ga0070659_1004454152 150
66 3300005455 Ga0070663_100137326 Ga0070663_1001373261 150
67 3300005458 Ga0070681_10007755 Ga0070681_100077556 150
68 3300005458 Ga0070681_10200457 Ga0070681_102004571 150
69 3300005458 Ga0070681_10463266 Ga0070681_104632662 150
70 3300005530 Ga0070679_100000242 Ga0070679_10000024228 150
71 3300005530 Ga0070679_100009738 Ga0070679_1000097383 150
72 3300005530 Ga0070679_100027498 Ga0070679_1000274983 150
73 3300005530 Ga0070679_100211468 Ga0070679_1002114683 150
74 3300005530 Ga0070679_100570745 Ga0070679_1005707451 150
75 3300005530 Ga0070679_100575940 Ga0070679_1005759402 150
76 3300005530 Ga0070679_100828462 Ga0070679_1008284622 150
77 3300005539 Ga0068853_100068354 Ga0068853_1000683542 150
78 3300005539 Ga0068853_100202277 Ga0068853_1002022772 150
79 3300005539 Ga0068853_100264544 Ga0068853_1002645442 150
80 3300005539 Ga0068853_100469455 Ga0068853_1004694551 150
81 3300005547 Ga0070693_100060736 Ga0070693_1000607363 150
82 3300005563 Ga0068855_100021828 Ga0068855_1000218287 150
83 3300005563 Ga0068855_100102587 Ga0068855_1001025874 150
84 3300005563 Ga0068855_100142517 Ga0068855_1001425173 150
85 3300005563 Ga0068855_100302960 Ga0068855_1003029602 150
86 3300005563 Ga0068855_100544508 Ga0068855_1005445082 150
87 3300005563 Ga0068855_100852129 Ga0068855_1008521292 150
88 3300005564 Ga0070664_101112018 Ga0070664_1011120182 150
89 3300005577 Ga0068857_100001923 Ga0068857_1000019234 150
90 3300005577 Ga0068857_100096648 Ga0068857_1000966483 150
91 3300005577 Ga0068857_100408159 Ga0068857_1004081592 150
92 3300005578 Ga0068854_100915378 Ga0068854_1009153782 150
93 3300005578 Ga0068854_101697334 Ga0068854_1016973341 150
94 3300005614 Ga0068856_100066043 Ga0068856_1000660433 150
95 3300005616 Ga0068852_100001612 Ga0068852_10000161215 150
96 3300005616 Ga0068852_100013719 Ga0068852_1000137198 150
97 3300005616 Ga0068852_100019380 Ga0068852_1000193805 150
98 3300005616 Ga0068852_100135578 Ga0068852_1001355781 150
99 3300005617 Ga0068859_100000018 Ga0068859_10000001874 150
100 3300005617 Ga0068859_100008935 Ga0068859_1000089352 150
101 3300005618 Ga0068864_100241259 Ga0068864_1002412591 150
102 3300005719 Ga0068861_100084324 Ga0068861_1000843242 150
103 3300005719 Ga0068861_101472659 Ga0068861_1014726591 150
104 3300005841 Ga0068863_100092371 Ga0068863_1000923711 150
105 3300005841 Ga0068863_100676001 Ga0068863_1006760012 150
106 3300005842 Ga0068858_100016208 Ga0068858_1000162082 150
107 3300005843 Ga0068860_100003974 Ga0068860_1000039749 150
108 3300005844 Ga0068862_101410514 Ga0068862_1014105141 150
109 3300005985 Ga0081539_10000816 Ga0081539_1000081652 150
110 3300006237 Ga0097621_100061625 Ga0097621_1000616253 150
111 3300006931 Ga0097620_100000018 Ga0097620_10000001874 150
112 3300006931 Ga0097620_100008935 Ga0097620_10000893514 150
113 3300007076 Ga0075435_100459663 Ga0075435_1004596632 150
114 3300009093 Ga0105240_10008738 Ga0105240_100087384 150
115 3300009093 Ga0105240_10008805 Ga0105240_100088055 150
116 3300009098 Ga0105245_10672297 Ga0105245_106722972 150
117 3300009101 Ga0105247_10300695 Ga0105247_103006952 150
118 3300009174 Ga0105241_10000510 Ga0105241_100005106 150
119 3300009174 Ga0105241_10001334 Ga0105241_100013349 150
120 3300009174 Ga0105241_10173406 Ga0105241_101734062 150
121 3300009174 Ga0105241_10273120 Ga0105241_102731202 150
122 3300009174 Ga0105241_10375799 Ga0105241_103757991 150
123 3300009176 Ga0105242_11115031 Ga0105242_111150311 150
124 3300009545 Ga0105237_10001030 Ga0105237_100010304 150
125 3300009545 Ga0105237_10056638 Ga0105237_100566383 150
126 3300009551 Ga0105238_10050457 Ga0105238_100504573 150
127 3300009551 Ga0105238_11119698 Ga0105238_111196982 150
128 3300009553 Ga0105249_10026873 Ga0105249_100268735 150
129 3300010375 Ga0105239_10007958 Ga0105239_1000795814 150
130 3300010375 Ga0105239_10097318 Ga0105239_100973181 150
131 3300011119 Ga0105246_10140916 Ga0105246_101409162 150
132 3300013100 Ga0157373_10070859 Ga0157373_100708594 150
133 3300013100 Ga0157373_10073183 Ga0157373_100731832 150
134 3300013100 Ga0157373_10186171 Ga0157373_101861712 150
135 3300013100 Ga0157373_10516203 Ga0157373_105162031 150
136 3300013102 Ga0157371_10016929 Ga0157371_100169295 150
137 3300013102 Ga0157371_10060484 Ga0157371_100604844 150
138 3300013102 Ga0157371_10076917 Ga0157371_100769172 150
139 3300013102 Ga0157371_10086517 Ga0157371_100865173 150
140 3300013102 Ga0157371_10199459 Ga0157371_101994593 150
141 3300013102 Ga0157371_10241803 Ga0157371_102418032 150
142 3300013102 Ga0157371_10518834 Ga0157371_105188341 150
143 3300013104 Ga0157370_10001924 Ga0157370_100019244 150
144 3300013104 Ga0157370_10003947 Ga0157370_100039476 150
145 3300013104 Ga0157370_10016327 Ga0157370_100163275 150
146 3300013104 Ga0157370_10743273 Ga0157370_107432731 150
147 3300013104 Ga0157370_11078407 Ga0157370_110784071 150
148 3300013105 Ga0157369_10018848 Ga0157369_100188489 150
149 3300013105 Ga0157369_10079672 Ga0157369_100796724 150
150 3300013105 Ga0157369_10200999 Ga0157369_102009992 150
151 3300013105 Ga0157369_10407376 Ga0157369_104073762 150
152 3300013105 Ga0157369_12154485 Ga0157369_121544851 150
153 3300013296 Ga0157374_10146143 Ga0157374_101461433 150
154 3300013296 Ga0157374_11008859 Ga0157374_110088591 150
155 3300013297 Ga0157378_10181462 Ga0157378_101814621 150
156 3300013306 Ga0163162_10000599 Ga0163162_100005995 150
157 3300013307 Ga0157372_10000495 Ga0157372_1000049538 150
158 3300013307 Ga0157372_10003151 Ga0157372_1000315112 150
159 3300013307 Ga0157372_10042223 Ga0157372_100422236 150
160 3300013307 Ga0157372_10066801 Ga0157372_100668016 150
161 3300013307 Ga0157372_10120920 Ga0157372_101209202 150
162 3300013307 Ga0157372_10589147 Ga0157372_105891472 150
163 3300013307 Ga0157372_12590008 Ga0157372_125900081 150
164 3300013308 Ga0157375_10050309 Ga0157375_100503095 150
165 3300014968 Ga0157379_10024344 Ga0157379_100243442 150
166 3300014969 Ga0157376_10114390 Ga0157376_101143902 150
167 3300025245 Ga0207425_1000002 Ga0207425_1000002222 150
168 3300025258 Ga0209129_1000002 Ga0209129_1000002222 150
169 3300025261 Ga0209233_1006148 Ga0209233_10061482 150
170 3300025292 Ga0209676_1000042 Ga0209676_100004245 150
171 3300025294 Ga0209025_1000004 Ga0209025_1000004967 150
172 3300025297 Ga0209758_1000006 Ga0209758_1000006967 150
173 3300025298 Ga0209050_1000035 Ga0209050_100003544 150
174 3300025303 Ga0209051_1125067 Ga0209051_11250671 150
175 3300025900 Ga0207710_10199705 Ga0207710_101997052 150
176 3300025903 Ga0207680_10000193 Ga0207680_1000019321 150
177 3300025904 Ga0207647_10394903 Ga0207647_103949031 150
178 3300025909 Ga0207705_10000831 Ga0207705_1000083120 150
179 3300025909 Ga0207705_10007369 Ga0207705_100073697 150
180 3300025909 Ga0207705_10034277 Ga0207705_100342774 150
181 3300025909 Ga0207705_10202243 Ga0207705_102022432 150
182 3300025909 Ga0207705_10220153 Ga0207705_102201533 150
183 3300025909 Ga0207705_10221875 Ga0207705_102218752 150
184 3300025909 Ga0207705_10638343 Ga0207705_106383431 150
185 3300025911 Ga0207654_10002836 Ga0207654_100028362 150
186 3300025911 Ga0207654_10062655 Ga0207654_100626553 150
187 3300025911 Ga0207654_10402300 Ga0207654_104023001 150
188 3300025911 Ga0207654_10638005 Ga0207654_106380051 150
189 3300025912 Ga0207707_10001326 Ga0207707_1000132614 150
190 3300025912 Ga0207707_10002694 Ga0207707_100026947 150
191 3300025912 Ga0207707_10826002 Ga0207707_108260021 150
192 3300025913 Ga0207695_10015086 Ga0207695_1001508611 150
193 3300025913 Ga0207695_10150706 Ga0207695_101507062 150
194 3300025914 Ga0207671_10001806 Ga0207671_1000180628 150
195 3300025914 Ga0207671_10803380 Ga0207671_108033801 150
196 3300025917 Ga0207660_10003453 Ga0207660_100034532 150
197 3300025917 Ga0207660_10027848 Ga0207660_100278481 150
198 3300025917 Ga0207660_10290015 Ga0207660_102900153 150
199 3300025919 Ga0207657_10034468 Ga0207657_100344684 150
200 3300025919 Ga0207657_10044096 Ga0207657_100440964 150
201 3300025919 Ga0207657_10225497 Ga0207657_102254973 150
202 3300025919 Ga0207657_10401967 Ga0207657_104019672 150
203 3300025921 Ga0207652_10001967 Ga0207652_100019678 150
204 3300025921 Ga0207652_10002079 Ga0207652_100020798 150
205 3300025921 Ga0207652_10002817 Ga0207652_100028176 150
206 3300025921 Ga0207652_10003605 Ga0207652_100036053 150
207 3300025921 Ga0207652_10026996 Ga0207652_100269965 150
208 3300025921 Ga0207652_10357908 Ga0207652_103579083 150
209 3300025921 Ga0207652_10835193 Ga0207652_108351931 150
210 3300025921 Ga0207652_11002480 Ga0207652_110024801 150
211 3300025932 Ga0207690_10034241 Ga0207690_100342413 150
212 3300025934 Ga0207686_10842089 Ga0207686_108420891 150
213 3300025940 Ga0207691_10056683 Ga0207691_100566832 150
214 3300025942 Ga0207689_10000602 Ga0207689_100006026 150
215 3300025944 Ga0207661_10126336 Ga0207661_101263363 150
216 3300025944 Ga0207661_10334721 Ga0207661_103347213 150
217 3300025944 Ga0207661_10472184 Ga0207661_104721842 150
218 3300025949 Ga0207667_10002332 Ga0207667_100023328 150
219 3300025949 Ga0207667_10016869 Ga0207667_100168695 150
220 3300025949 Ga0207667_10086157 Ga0207667_100861572 150
221 3300025949 Ga0207667_10322606 Ga0207667_103226062 150
222 3300025949 Ga0207667_11387135 Ga0207667_113871351 150
223 3300025960 Ga0207651_10147304 Ga0207651_101473042 150
224 3300025961 Ga0207712_10033246 Ga0207712_100332462 150
225 3300025986 Ga0207658_10067423 Ga0207658_100674233 150
226 3300026023 Ga0207677_10241073 Ga0207677_102410733 150
227 3300026035 Ga0207703_10006445 Ga0207703_100064457 150
228 3300026041 Ga0207639_10032198 Ga0207639_100321984 150
229 3300026041 Ga0207639_10208972 Ga0207639_102089722 150
230 3300026041 Ga0207639_10445699 Ga0207639_104456991 150
231 3300026041 Ga0207639_10478473 Ga0207639_104784731 150
232 3300026067 Ga0207678_10102929 Ga0207678_101029293 150
233 3300026078 Ga0207702_10047151 Ga0207702_100471512 150
234 3300026088 Ga0207641_10000015 Ga0207641_1000001532 150
235 3300026088 Ga0207641_10162605 Ga0207641_101626051 150
236 3300026095 Ga0207676_10011487 Ga0207676_100114879 150
237 3300026116 Ga0207674_10018272 Ga0207674_100182725 150
238 3300026116 Ga0207674_10387355 Ga0207674_103873552 150
239 3300026118 Ga0207675_101115740 Ga0207675_1011157401 150
240 3300026142 Ga0207698_10000452 Ga0207698_1000045211 150
241 3300026142 Ga0207698_10012186 Ga0207698_100121862 150
242 3300026142 Ga0207698_10017920 Ga0207698_100179202 150
243 3300026142 Ga0207698_10052832 Ga0207698_100528323 150
244 3300028381 Ga0268264_10000844 Ga0268264_1000084426 150
245 3300028794 Ga0307515_10044471 Ga0307515_100444719 150
246 3300032004 Ga0307414_10000375 Ga0307414_1000037517 150
247 3300035171 Ga0373946_0397034 Ga0373946_0397034_49_522 150
248 3300037312 Ga0395899_0000017 Ga0395899_0000017_307958_308425 150
249 3300037312 Ga0395899_0035345 Ga0395899_0035345_1938_2399 150
250 3300037312 Ga0395899_0158124 Ga0395899_0158124_204_665 150
251 3300037312 Ga0395899_0209685 Ga0395899_0209685_179_640 150
252 3300037312 Ga0395899_0588142 Ga0395899_0588142_37_498 150
253 3300037312 Ga0395899_0762370 Ga0395899_0762370_46_507 150
254 3300037418 Ga0395900_0000128 Ga0395900_0000128_5918_6424 150
255 3300037418 Ga0395900_0024749 Ga0395900_0024749_4112_4573 150
256 3300037418 Ga0395900_0095445 Ga0395900_0095445_125_586 150
257 3300037418 Ga0395900_0185699 Ga0395900_0185699_1229_1690 150
258 3300037418 Ga0395900_0218832 Ga0395900_0218832_1159_1620 150
259 3300037466 Ga0395898_0003807 Ga0395898_0003807_3942_4403 150
260 3300037466 Ga0395898_0033364 Ga0395898_0033364_4077_4538 150
261 3300037466 Ga0395898_0186258 Ga0395898_0186258_1168_1629 150
262 3300037466 Ga0395898_1014122 Ga0395898_1014122_108_569 150
263 3300037471 Ga0395905_0281349 Ga0395905_0281349_648_1109 150
264 3300037471 Ga0395905_0640290 Ga0395905_0640290_371_832 150
265 3300038443 Ga0395901_0062425 Ga0395901_0062425_3312_3773 150
266 3300038443 Ga0395901_0067807 Ga0395901_0067807_320_781 150
267 3300038443 Ga0395901_0073611 Ga0395901_0073611_2177_2638 150
268 3300038443 Ga0395901_0095088 Ga0395901_0095088_2307_2768 150
269 3300038443 Ga0395901_0554586 Ga0395901_0554586_555_1016 150
270 3300038443 Ga0395901_1063694 Ga0395901_1063694_181_642 150
271 3300044684 Ga0466966_0183844 Ga0466966_0183844_329_796 150
272 3300046471 Ga0495650_0038428 Ga0495650_0038428_396_869 150
273 3300046472 Ga0495580_0162973 Ga0495580_0162973_665_1138 150
274 3300046491 Ga0495584_0344253 Ga0495584_0344253_119_592 150
275 3300046507 Ga0495606_0000213 Ga0495606_0000213_76315_76767 150
276 3300046512 Ga0495610_0000768 Ga0495610_0000768_20718_21170 150
277 3300046520 Ga0495637_0010944 Ga0495637_0010944_3884_4336 150
278 3300046520 Ga0495637_0011096 Ga0495637_0011096_3186_3638 150
279 3300046616 Ga0495668_0022449 Ga0495668_0022449_1084_1557 150
280 3300046660 Ga0495625_0191596 Ga0495625_0191596_274_726 150
281 3300049569 Ga0501032_0233549 Ga0501032_0233549_237_710 150
282 3300049570 Ga0501033_0156198 Ga0501033_0156198_260_733 150
283 3300049571 Ga0501034_0082568 Ga0501034_0082568_706_1179 150
284 3300049571 Ga0501034_0188035 Ga0501034_0188035_145_618 150
285 3300049579 Ga0501043_0861207 Ga0501043_0861207_148_621 150
286 3300049822 Ga0501035_0195181 Ga0501035_0195181_680_1153 150
287 3300049822 Ga0501035_0341802 Ga0501035_0341802_440_913 150
288 3300049823 Ga0501044_0234523 Ga0501044_0234523_775_1248 150
289 3300049823 Ga0501044_0262710 Ga0501044_0262710_1054_1527 150
290 3300050493 nmdc:mga0k408_241_c1 nmdc:mga0k408_241_c1_284_739 150
291 3300050513 nmdc:mga0rr50_444868_c1 nmdc:mga0rr50_444868_c1_325_795 150
292 3300053139 Ga0500568_0017750 Ga0500568_0017750_2382_2855 150
293 3300053142 Ga0500577_0001299 Ga0500577_0001299_3037_3513 150
294 3300053151 Ga0500604_0018491 Ga0500604_0018491_703_1176 150

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

23

105

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.9729 11 135
2ijc-assembly2.cif.gz_I structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa 0.9531 1 141
2gmy-assembly1.cif.gz_C crystal structure of a protein of unknown function atu0492 from agrobacterium tumefaciens, putative antioxidant defence protein ahpd 0.9382 2 144
2ijc-assembly2.cif.gz_I structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa 0.9212 1 141
2gmy-assembly1.cif.gz_C crystal structure of a protein of unknown function atu0492 from agrobacterium tumefaciens, putative antioxidant defence protein ahpd 0.9137 2 144
ID Description Score Start End Superfamily
af_Q2FVE0_2_139_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9663 6 135 1.20.1290.10
2ijcF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9466 4 139 1.20.1290.10
2o4dA00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.942 4 140 1.20.1290.10
af_P76222_42_172_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9382 17 136 1.20.1290.10
2gmyF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9336 2 145 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A7X6P6M7-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9928 28 135 GO:0051920
AF-A0A2V9JIF7-F1-model_v4 Carboxymuconolactone decarboxylase 0.9894 19 147 GO:0051920
AF-D5BGB8-F1-model_v4 Carboxymuconolactone decarboxylase 0.9883 19 136 GO:0051920
AF-A0A3D9P0U7-F1-model_v4 deleted 0.9851 1 150
AF-A0A220S825-F1-model_v4 Carboxymuconolactone decarboxylase 0.9821 1 150 GO:0051920

Feature Viewer

pLDDT pTM Quality
95.48 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map